BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig14030
         (917 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC134346_1741756 Oryza sativa (japonica cultivar-group) chrom...   390   e-107   
gb:AY039869_1560383 Arabidopsis thaliana At1g79600/F20B17_3 mRNA...   387   e-106   
gb:AE005173_895481 Arabidopsis thaliana chromosome 1, bottom arm...   387   e-106   
gb:AP008231_582010 Synechococcus elongatus PCC 6301 DNA, complet...   183   4e-45   
gb:BA000039_726734 Thermosynechococcus elongatus BP-1 DNA, compl...   178   1e-43   
sp|Q55680|Y005_SYNY3|Y005_SYNY3 Hypothetical protein sll0005.>pir|S76354|S7...   174   2e-42   Synechocystis sp.
pir|AH2425|AH2425 hypothetical protein all4960 [imported] - Nost...   171   1e-41   Nostoc sp. PCC 7120
gb:BA000045_743199 Gloeobacter violaceus PCC 7421 DNA, complete ...   161   2e-38   
gb:AE017166_396338 Prochlorococcus marinus subsp. marinus str. C...   160   3e-38   
sp|P73121|YJ19_SYNY3|YJ19_SYNY3 Hypothetical protein slr1919.>pir|S75233|S7...   156   5e-37   Synechocystis sp.
gb:BX572094_797340 Prochlorococcus marinus MED4 complete genome;...   156   6e-37   
gb:BX569695_777426 Synechococcus sp. WH8102 complete genome; seg...   152   1e-35   
gb:BX572101_799613 Prochlorococcus marinus MIT9313 complete geno...   150   4e-35   
gb:AP008231_580517 Synechococcus elongatus PCC 6301 DNA, complet...   150   4e-35   
gb:BA000039_727444 Thermosynechococcus elongatus BP-1 DNA, compl...   146   5e-34   
pir|AG1880|AG1880 hypothetical protein all0592 [imported] - Nost...   145   1e-33   Nostoc sp. PCC 7120
gb:BA000045_744487 Gloeobacter violaceus PCC 7421 DNA, complete ...   143   4e-33   
gb:AY093113_1575067 Arabidopsis thaliana unknown protein (At4g31...   129   1e-28   
gb:BX569691_775847 Synechococcus sp. WH8102 complete genome; seg...   124   2e-27   
gb:BX572098_798409 Prochlorococcus marinus MIT9313 complete geno...   119   6e-26   
gb:OSJN00094_1694814 Oryza sativa genomic DNA, chromosome 4, BAC...   112   1e-23   
gb:OSJN00015_1693300 Oryza sativa genomic DNA, chromosome 4, BAC...   112   1e-23   
gb:AY039896_1560410 Arabidopsis thaliana At1g71810/F14O23_17 mRN...   110   5e-23   
gb:AE017164_395569 Prochlorococcus marinus subsp. marinus str. C...   107   2e-22   
gb:BX572092_796709 Prochlorococcus marinus MED4 complete genome;...   103   4e-21   
gb:BT004318_1637393 Arabidopsis thaliana clone RAFL15-48-N06 (R5...   100   7e-20   
gb:AY081264_1568610 Arabidopsis thaliana unknown protein (At1g71...    99   1e-19   
gb:AP005111_1848039 Oryza sativa (japonica cultivar-group) genom...    99   2e-19   
gb:AB028621_1518066 Arabidopsis thaliana genomic DNA, chromosome...    98   3e-19   
gb:AP005642_1855303 Oryza sativa (japonica cultivar-group) genom...    90   7e-17   
gb:AP004153_1838264 Oryza sativa (japonica cultivar-group) genom...    77   6e-13   
pir|T02583|T02583 probable ABC transporter At2g39190 [imported] ...    69   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AC069158_1540661 Genomic Sequence for Oryza sativa, Nipponbar...    67   5e-10   
gb:AC004697_1532104 Arabidopsis thaliana chromosome 2 clone T16B...    66   1e-09   
pir|F96740|F96740 hypothetical protein F14O23.19 [imported] - Ar...    64   4e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T04506|T04506 hypothetical protein F8F16.210 - Arabidopsis t...    57   7e-07   Arabidopsis thaliana [mouse-ear cress]
sp|Q55884|Y095_SYNY3|Y095_SYNY3 Hypothetical protein sll0095.>pir|S76702|S7...    55   2e-06   Synechocystis sp.
pir|AC2370|AC2370 hypothetical protein alr4515 [imported] - Nost...    54   3e-06   Nostoc sp. PCC 7120
gb:BA000039_728069 Thermosynechococcus elongatus BP-1 DNA, compl...    54   4e-06   
sp|P73627|YH70_SYNY3|YH70_SYNY3 Hypothetical protein sll1770.>pir|S77114|S7...    53   9e-06   Synechocystis sp.
gb:TACID3_196624 Thermoplasma acidophilum complete genome; segme...    52   1e-05   
gb:AP008231_580367 Synechococcus elongatus PCC 6301 DNA, complet...    52   2e-05   
gb:ATAC009176_1542831 Arabidopsis thaliana chromosome III P1 MLP...    50   5e-05   
gb:BA000039_728026 Thermosynechococcus elongatus BP-1 DNA, compl...    50   5e-05   
pir|F84328|F84328 hypothetical protein Vng1770c [imported] - Hal...    50   5e-05   Halobacterium salinarum
gb:BA000011_665232 Thermoplasma volcanium GSS1 DNA, complete gen...    48   3e-04   
gb:AP005905_1859875 Oryza sativa (japonica cultivar-group) genom...    47   4e-04   
gb:AY059877_1564721 Arabidopsis thaliana ABC transporter-like (A...    47   5e-04   
gb:AB019236_1514248 Arabidopsis thaliana genomic DNA, chromosome...    47   5e-04   
gb:BX572090_795835 Prochlorococcus marinus MED4 complete genome;...    47   5e-04   
gb:BA000045_744253 Gloeobacter violaceus PCC 7421 DNA, complete ...    47   5e-04   
gb:AY088788_1573800 Arabidopsis thaliana clone 95043 mRNA, compl...    47   7e-04   
gb:AY080823_1568518 Arabidopsis thaliana unknown protein (At3g07...    47   7e-04   
gb:AY056806_1563855 Arabidopsis thaliana At3g07700/F17A17.4 mRNA...    47   7e-04   
gb:ATAC013483_1543532 Arabidopsis thaliana chromosome III BAC F1...    47   7e-04   
gb:BX572101_799423 Prochlorococcus marinus MIT9313 complete geno...    47   7e-04   
gb:BX569695_777251 Synechococcus sp. WH8102 complete genome; seg...    46   9e-04   
gb:AE017282_428605 Methylococcus capsulatus str. Bath, complete ...    46   9e-04   
gb:AP005116_1848160 Oryza sativa (japonica cultivar-group) genom...    46   0.001   
gb:AP005116_1848159 Oryza sativa (japonica cultivar-group) genom...    46   0.001   
gb:AY596297_633072 Haloarcula marismortui ATCC 43049 chromosome ...    45   0.003   
gb:AE017161_394694 Prochlorococcus marinus subsp. marinus str. C...    45   0.003   
gb:AE017261_419757 Picrophilus torridus DSM 9790, complete genome.     42   0.022   
gb:AY596298_634907 Haloarcula marismortui ATCC 43049 chromosome ...    41   0.028   
gb:BX294141_767644 Pirellula sp. strain 1 complete genome; segme...    41   0.037   
gb:AY714848_1189650 Uncultured archaeon GZfos27G5 clone GZfos27G...    40   0.049   
gb:AY741198_1190682 Uncultured archaeon GZfos23H7 clone GZfos23H...    40   0.063   
gb:AY596297_631991 Haloarcula marismortui ATCC 43049 chromosome ...    40   0.063   
gb:AE013136_289456 Thermoanaerobacter tengcongensis MB4, section...    40   0.063   
gb:AE012273_280970 Xanthomonas campestris pv. campestris str. AT...    39   0.18    
gb:AE011805_276676 Xanthomonas axonopodis pv. citri str. 306, se...    38   0.31    
gb:BA000016_675568 Clostridium perfringens str. 13 DNA, complete...    37   0.41    
gb:AE013598_296644 Xanthomonas oryzae pv. oryzae KACC10331, comp...    37   0.41    
gb:CR522870_99636 Desulfotalea psychrophila LSv54 chromosome.          37   0.41    
pir|G90433|G90433 ABC transporter, ABC1 family, probable SSO2605...    37   0.41    Saccharolobus solfataricus
gb:BA000045_741543 Gloeobacter violaceus PCC 7421 DNA, complete ...    36   0.92    
gb:AY302592_1943028 Homo sapiens putative ubiquinone biosynthesi...    36   1.2     
gb:AC006344_1875132 Homo sapiens PAC clone RP4-726N20 from 7q32-...    36   1.2     
gb:BX842648_823923 Bdellovibrio bacteriovorus complete genome, s...    35   1.6     
gb:AE017279_426098 Bacillus cereus ATCC 10987, section 16 of 18 ...    35   1.6     
gb:AY523972S1_625180 Azospirillum brasilense plasmid 90 MDa, par...    35   2.0     
gb:AE008692_240927 Zymomonas mobilis subsp. mobilis ZM4, complet...    35   2.0     
gb:AE016920_357928 Chromobacterium violaceum ATCC 12472 section ...    35   2.7     
gb:BA000043_738331 Geobacillus kaustophilus HTA426 DNA, complete...    34   4.5     
gb:AE017197_402570 Rickettsia typhi str. Wilmington complete gen...    34   4.5     
gb:AB186503_16810 Uncultured bacterium genes for hypothetical pr...    34   4.5     
gb:D86371_2399060 Sweet potato feathery mottle virus genomic RNA...    33   5.9     
gb:AE017315_440269 Desulfovibrio vulgaris subsp. vulgaris str. H...    33   5.9     
pir|D83988|D83988 ABC transporter BH2708 [imported] - Bacillus h...    33   5.9     Bacillus halodurans
gb:BC069944_2106210 Mus musculus aarF domain containing kinase 2...    33   7.7     
gb:AK028557_1161051 Mus musculus 0 day neonate skin cDNA, RIKEN ...    33   7.7     
gb:CP000025_877989 Campylobacter jejuni RM1221, complete genome.       33   7.7     
gb:AP006878_575612 Thermococcus kodakaraensis strain KOD1 DNA, c...    33   7.7     
gb:AE017237_413510 Mycobacterium avium subsp. paratuberculosis s...    33   7.7     


>gb:AC134346_1741756 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0018A03, complete sequence.
          Length = 426

 Score =  390 bits (1001), Expect = e-107
 Identities = 195/256 (76%), Positives = 221/256 (86%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           ALDFL PDVDVSPIVPAL++FFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI
Sbjct: 150 ALDFLEPDVDVSPIVPALKSFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 209

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 556
           LRSLTVLEGLALYADP FKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE
Sbjct: 210 LRSLTVLEGLALYADPNFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 269

Query: 555 NLLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFI 376
           NLLVQG +DR+F+A+DALQPVLKLLLGPDGEELRVLV KEA+RVTEA+  G++I+SYN  
Sbjct: 270 NLLVQGSQDREFAAKDALQPVLKLLLGPDGEELRVLVVKEAVRVTEAITFGTLIDSYNAA 329

Query: 375 PGPMRTIIFNGNAAGPLVMNPAEQESMMDLRAQVFRIWGLLRSSESFDPSXXXXXXXXXX 196
           P  ++ +I +GN AGP  ++  E+E M++LR +VFRIWGLLRSS+ FDP+          
Sbjct: 330 PEFLKPLISSGNPAGPFKISDTEREQMIELRDRVFRIWGLLRSSDGFDPTILQPIVQVLQ 389

Query: 195 XXEARSIGGRVVGGIS 148
             EAR +G RV GG++
Sbjct: 390 EPEARVLGSRVAGGVT 405



>gb:AY039869_1560383 Arabidopsis thaliana At1g79600/F20B17_3 mRNA,
            complete cds.
          Length = 569

 Score =  387 bits (993), Expect = e-106
 Identities = 192/255 (75%), Positives = 220/255 (86%)
 Frame = -3

Query: 915  ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
            AL FLSPDVDV+PI+PALR+FFDDALN TVSELNFKT+VDGLGAV YQYPFNVP YYALI
Sbjct: 291  ALKFLSPDVDVTPIIPALRDFFDDALNYTVSELNFKTLVDGLGAVFYQYPFNVPPYYALI 350

Query: 735  LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 556
            LRSLTVLEGLALYADP FKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE
Sbjct: 351  LRSLTVLEGLALYADPNFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 410

Query: 555  NLLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFI 376
            NLL QG KDRDFSA+DALQPVLKLLL P+GEELR+LV KEA+RV+EA+ LG+++++YN +
Sbjct: 411  NLLQQGSKDRDFSAKDALQPVLKLLLDPNGEELRLLVIKEAVRVSEAIALGTVVDTYNSL 470

Query: 375  PGPMRTIIFNGNAAGPLVMNPAEQESMMDLRAQVFRIWGLLRSSESFDPSXXXXXXXXXX 196
            P  +R+++FNGN  GPL M+ AE +S ++LR QV RIWGLL+SSESFDP+          
Sbjct: 471  PEFLRSLVFNGNGNGPLTMSTAELQSTLELRDQVSRIWGLLQSSESFDPAILQPILQVLQ 530

Query: 195  XXEARSIGGRVVGGI 151
              EAR +GGRV GG+
Sbjct: 531  QPEARRLGGRVAGGV 545



>gb:AE005173_895481 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC010793_1537059 Genomic sequence
            for Arabidopsis thaliana BAC F20B17 from chromosome I,
            complete sequence.>gb:AY064971_1566147 Arabidopsis
            thaliana At1g79600/F20B17_3 mRNA, complete
            cds.>gb:AY141992_1582829 Arabidopsis thaliana
            At1g79600/F20B17_3 mRNA, complete cds.
          Length = 711

 Score =  387 bits (993), Expect = e-106
 Identities = 192/255 (75%), Positives = 220/255 (86%)
 Frame = -3

Query: 915  ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
            AL FLSPDVDV+PI+PALR+FFDDALN TVSELNFKT+VDGLGAV YQYPFNVP YYALI
Sbjct: 433  ALKFLSPDVDVTPIIPALRDFFDDALNYTVSELNFKTLVDGLGAVFYQYPFNVPPYYALI 492

Query: 735  LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 556
            LRSLTVLEGLALYADP FKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE
Sbjct: 493  LRSLTVLEGLALYADPNFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 552

Query: 555  NLLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFI 376
            NLL QG KDRDFSA+DALQPVLKLLL P+GEELR+LV KEA+RV+EA+ LG+++++YN +
Sbjct: 553  NLLQQGSKDRDFSAKDALQPVLKLLLDPNGEELRLLVIKEAVRVSEAIALGTVVDTYNSL 612

Query: 375  PGPMRTIIFNGNAAGPLVMNPAEQESMMDLRAQVFRIWGLLRSSESFDPSXXXXXXXXXX 196
            P  +R+++FNGN  GPL M+ AE +S ++LR QV RIWGLL+SSESFDP+          
Sbjct: 613  PEFLRSLVFNGNGNGPLTMSTAELQSTLELRDQVSRIWGLLQSSESFDPAILQPILQVLQ 672

Query: 195  XXEARSIGGRVVGGI 151
              EAR +GGRV GG+
Sbjct: 673  QPEARRLGGRVAGGV 687



>gb:AP008231_582010 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 622

 Score =  183 bits (465), Expect = 4e-45
 Identities = 97/255 (38%), Positives = 149/255 (58%)
 Frame = -3

Query: 912  LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
            L+FL+PD D++PI+PAL   F DA+ ++V++LNFK+I D L  V+Y YPF VPAYYALI+
Sbjct: 359  LEFLTPDTDLTPIIPALAGVFKDAMGASVADLNFKSITDQLSQVMYDYPFRVPAYYALII 418

Query: 732  RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
            RSL  LEG+A+  DP FKVL+ +YP+ A+++LTDP+P LR +L ELLF  G+ RWNRLEN
Sbjct: 419  RSLVTLEGIAINVDPNFKVLSKAYPFIARQILTDPSPDLRASLRELLFNGGQLRWNRLEN 478

Query: 552  LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFIP 373
            LL       D+ +   +Q  +  LL   G++LR  + +E +   + +  G++        
Sbjct: 479  LLRNASNSSDYDSEHLIQQTVDFLLSESGQDLRDRLVEELVNSLDRLGRGAL-------- 530

Query: 372  GPMRTIIFNGNAAGPLVMNPAEQESMMDLRAQVFRIWGLLRSSESFDPSXXXXXXXXXXX 193
                  +        L M+P    ++ DL+  + R+  LL+  + F+P            
Sbjct: 531  -----PLLRNQIRQRLGMDPEPDSTLTDLQ-PLLRVLSLLQQGQRFEPQRFIPLIPVLGR 584

Query: 192  XEARSIGGRVVGGIS 148
             E + +G +VV G++
Sbjct: 585  PEVQQMGQQVVTGLA 599



>gb:BA000039_726734 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 648

 Score =  178 bits (451), Expect = 1e-43
 Identities = 88/162 (54%), Positives = 111/162 (68%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+PD DV PI+PAL   F+DAL ++VSELN + I D L  V+Y+YPF VPAYYALI+
Sbjct: 373 LGFLTPDTDVKPIIPALALVFEDALGASVSELNIQRIFDRLSEVMYEYPFQVPAYYALIV 432

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL  +EG+A+  DP FKVL+A+YPY AKRLLTDP P LR +L  LL KDG+FRW RLEN
Sbjct: 433 RSLLTMEGIAMGVDPNFKVLSAAYPYIAKRLLTDPAPELRTSLASLLLKDGQFRWTRLEN 492

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIR 427
           LL   ++ RD+     L+  L  L    G E R  +  E ++
Sbjct: 493 LLRNARESRDYDFNVVLEQALDFLFSERGAEYRDRLADEIVK 534



>sp|Q55680|Y005_SYNY3 Hypothetical protein sll0005.>pir|S76354|S76354
            ABC1-type transport protein sll0005 - Synechocystis sp.
            (strain PCC 6803)>gb:BA000022_689595 Synechocystis sp.
            PCC 6803 DNA, complete genome.
          Length = 681

 Score =  174 bits (442), Expect = 2e-42
 Identities = 102/244 (41%), Positives = 142/244 (58%), Gaps = 16/244 (6%)
 Frame = -3

Query: 912  LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
            LDFL PD D+ PI+PAL   F +AL ++V+ELNFK+I D + A++Y++PF VPAYYALI+
Sbjct: 390  LDFLKPDTDLKPIIPALGQVFGNALGASVAELNFKSITDQMSAMMYEFPFRVPAYYALII 449

Query: 732  RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
            RS+  LEG+A+  DP FKVL+ +YPY AKRLLTD +  LR +L ELLFK+G FRWNRLEN
Sbjct: 450  RSMVTLEGIAIGIDPNFKVLSKAYPYIAKRLLTDQSEELRTSLKELLFKEGSFRWNRLEN 509

Query: 552  LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAI-------RVTEAVILGSII 394
            LL   K    F     L    + LL   G+ +R  +  E +       R T   +  +I 
Sbjct: 510  LLRNAKNSPGFDFDYVLNEATEFLLSDRGQFIRDRLVAELVNSIDQLGRNTWQQVSHNIQ 569

Query: 393  ESYNFIPGPMRTIIFNGNAAG------PLVMNPA---EQESMMDLRAQVFRIWGLLRSSE 241
            E  +F+       + NGN          +V  PA   ++E+   L+     +W +L+ + 
Sbjct: 570  ERISFLGD-----LGNGNGKAHQTKTIKVVPQPAIAQQEETWQHLQ----NLWQILKETP 620

Query: 240  SFDP 229
             FDP
Sbjct: 621  GFDP 624



>pir|AH2425|AH2425 hypothetical protein all4960 [imported] - Nostoc
            sp. (strain PCC 7120)>gb:BA000019_685949 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 670

 Score =  171 bits (434), Expect = 1e-41
 Identities = 94/231 (40%), Positives = 137/231 (59%), Gaps = 2/231 (0%)
 Frame = -3

Query: 912  LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
            LDFLSP+ D++PI+PA    F +A  ++V+E N K+I D L  ++Y+YPF VP YYALI+
Sbjct: 394  LDFLSPETDLTPIIPAFGKVFANAQGASVAEFNIKSITDELSELMYEYPFRVPPYYALII 453

Query: 732  RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
            RSL  LEG+A+Y DP FKVL+ +YPY AKRLLTDP P LR +L +LLFKDG+FRWNRLEN
Sbjct: 454  RSLVTLEGIAIYIDPNFKVLSEAYPYVAKRLLTDPAPELRISLRDLLFKDGRFRWNRLEN 513

Query: 552  LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFIP 373
            LL   +K++D+     +   +  L    G  +R  +  E +    A +  +++ ++ ++ 
Sbjct: 514  LLRNARKNQDYDLNLVVNQGVDFLSSERGSFIRDKLVDEFLNGINA-LSKNVLHNFTYL- 571

Query: 372  GPMRTIIFNGNAAGPLVMN--PAEQESMMDLRAQVFRIWGLLRSSESFDPS 226
              +R         G   +N  PA           V  I  +L+ +  FDP+
Sbjct: 572  --LR------ERVGITAINETPAATVEQQQTLEHVKNILNILQETRGFDPA 614



>gb:BA000045_743199 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 616

 Score =  161 bits (407), Expect = 2e-38
 Identities = 80/153 (52%), Positives = 100/153 (65%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL PD D+ PIVP L   F  AL S+V  LN K+I D + +++Y  PF VPA++ALI+
Sbjct: 375 LGFLKPDQDLKPIVPVLAVVFGQALGSSVGSLNIKSITDNMSSMMYDLPFRVPAFFALII 434

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL  LEG+A+  DP FKVL  +YPY A+RLLTD  P LR +L ELLFKDG FRWNRLEN
Sbjct: 435 RSLVTLEGIAISVDPDFKVLEVAYPYVARRLLTDNAPELRASLSELLFKDGSFRWNRLEN 494

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELR 454
           L+   +  RD+    AL    + LL   G  +R
Sbjct: 495 LVRNARSARDYDINRALDQAAEFLLSERGASIR 527



>gb:AE017166_396338 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 6 of 6 of the complete
           genome.>gb:AE017126_1032007 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 615

 Score =  160 bits (405), Expect = 3e-38
 Identities = 75/153 (49%), Positives = 105/153 (68%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+ DV++ PIVPA    FD AL   VS+++FKT+ D +  ++Y++PF +P YYALI+
Sbjct: 356 LGFLNEDVNLEPIVPAFEKVFDGALTMGVSKMDFKTVTDDMSGLMYKFPFQLPPYYALII 415

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL  LEG+AL  DP FK+L A+YPYFA+RL+ DP+P LR +L E+LF  G F+WNRLEN
Sbjct: 416 RSLITLEGIALSVDPDFKILGAAYPYFARRLMEDPDPKLRKSLKEMLFDGGIFKWNRLEN 475

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELR 454
           L+    K ++ +  + L  V+  L   +G  LR
Sbjct: 476 LVSNASKQKEINIENLLDQVIDFLFSENGGILR 508



>sp|P73121|YJ19_SYNY3 Hypothetical protein
           slr1919.>pir|S75233|S75233 ABC transporter slr1919 -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_687926
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 566

 Score =  156 bits (395), Expect = 5e-37
 Identities = 76/154 (49%), Positives = 101/154 (65%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           AL FL+P+ D++PI+PAL N F  A+  +V + NFKTI D    ++Y YPF VPA +ALI
Sbjct: 356 ALGFLAPNTDITPIIPALENVFGSAIGQSVQDFNFKTITDDFSELMYDYPFRVPAKFALI 415

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 556
           +RSL   EGLAL  DP FK++  +YPY A+RLLT  +P LR  LI++LFK+GKF+W RLE
Sbjct: 416 IRSLVTQEGLALSLDPNFKIVEVAYPYVARRLLTGESPQLRRQLIDVLFKNGKFQWQRLE 475

Query: 555 NLLVQGKKDRDFSARDALQPVLKLLLGPDGEELR 454
           N+L   + D  F      Q  L+ L   +G  LR
Sbjct: 476 NMLSIARSDTKFDLLPTAQLGLQFLFSEEGLYLR 509



>gb:BX572094_797340 Prochlorococcus marinus MED4 complete genome;
           segment 5/5.
          Length = 618

 Score =  156 bits (394), Expect = 6e-37
 Identities = 77/180 (42%), Positives = 115/180 (63%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FLS +V++ PIVPA ++ F +A+   VS+++FK++ D +  V+Y++PF +P YYALI+
Sbjct: 356 LGFLSKEVNLEPIVPAFQDVFVNAVELGVSKMDFKSVTDDMSGVMYKFPFQLPPYYALII 415

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL  LEG+AL  DP FK+L A+YPYFA+RL+ DP+P LR++L E+LF   +F+W+RLE+
Sbjct: 416 RSLLTLEGIALSVDPDFKILGAAYPYFARRLMEDPDPQLRESLKEMLFDKKQFKWDRLED 475

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFIP 373
           LL    K  +      L  V+ LL  P G  LR  +        + + L  +    NF+P
Sbjct: 476 LLSNAAKQTNLDLEKLLDEVINLLFSPKGGFLRDEIINGLTSQIDLIGLKLLKSVNNFLP 535



>gb:BX569695_777426 Synechococcus sp. WH8102 complete genome;
           segment 7/7.
          Length = 626

 Score =  152 bits (383), Expect = 1e-35
 Identities = 73/167 (43%), Positives = 103/167 (61%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+ DV++ PIVPA  + F  AL + V+ ++FK + D +  V+Y++PF VP YYALI+
Sbjct: 363 LGFLAEDVNLEPIVPAFESVFSQALEAGVNRMDFKAVTDDMSGVMYKFPFRVPPYYALII 422

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL  LEG+AL  DP+FK+L A+YPYFA+RL+ DP+P LR +L E+LF    FRW RLEN
Sbjct: 423 RSLVTLEGIALSVDPQFKILGAAYPYFARRLMEDPDPQLRQSLKEMLFDGDAFRWTRLEN 482

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAV 412
           L+              L  +L  L  P    LR  + +  +   +A+
Sbjct: 483 LVSSAASQAQLDLEALLDQLLDFLFSPKAGLLRDQLVEATVDRLDAI 529



>gb:BX572101_799613 Prochlorococcus marinus MIT9313 complete genome;
           segment 7/7.
          Length = 629

 Score =  150 bits (378), Expect = 4e-35
 Identities = 75/166 (45%), Positives = 102/166 (61%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+ DV++ PIVPA  + F  AL   VS L+FK++ D L  V+Y++PF VP YYALI+
Sbjct: 363 LGFLAEDVNLEPIVPAFESVFSQALEMGVSRLDFKSVTDDLSGVMYRFPFKVPPYYALII 422

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL  LEG+AL  D +FK+L A+YPYFA+RL+ DP+P LR +L E+LF    FRW RLEN
Sbjct: 423 RSLITLEGIALSVDSEFKILGAAYPYFARRLMEDPDPQLRQSLKEMLFDGEIFRWTRLEN 482

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEA 415
           L+              +  V+  L   +G  LR  + +  I   +A
Sbjct: 483 LVASAASQAQLDLESLIDQVIDFLFSINGGLLREQLVEALINRLDA 528



>gb:AP008231_580517 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 583

 Score =  150 bits (378), Expect = 4e-35
 Identities = 74/153 (48%), Positives = 97/153 (63%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+PD D++PI+PAL +   D +   V + NFKTI D    ++Y YPF VPA +ALI+
Sbjct: 368 LGFLTPDSDLTPIIPALESVLGDIMGEKVRDFNFKTITDRFSELMYDYPFRVPAKFALII 427

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL   EGLAL  +P F+++  +YPY AKRLL   +P LR  L+E+L KDGKFRWNRLEN
Sbjct: 428 RSLVTQEGLALSVNPDFRIVDVAYPYIAKRLLQGESPQLRRRLLEVLVKDGKFRWNRLEN 487

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELR 454
           L+   + D  F      Q  L+ L   +G  LR
Sbjct: 488 LIAIAQNDGGFDLLPTAQMGLQYLFSDEGAYLR 520



>gb:BA000039_727444 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 573

 Score =  146 bits (369), Expect = 5e-34
 Identities = 72/180 (40%), Positives = 111/180 (61%), Gaps = 5/180 (2%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+P+ D+ PI+PAL + F++ + S+V E NFK I D    ++Y YPF VPA +ALI+
Sbjct: 358 LGFLTPETDMRPIIPALESVFEEVIGSSVREFNFKVITDRFSQLMYTYPFRVPAKFALII 417

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL   EG+AL  +P F+++  SYPY A+RLL   +P LR  L+++LFKDG+ +W RLEN
Sbjct: 418 RSLVTQEGIALCLNPNFRIVDVSYPYVARRLLQGESPQLRRRLLDVLFKDGRLQWQRLEN 477

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELR-----VLVTKEAIRVTEAVILGSIIES 388
           L+   ++D+ F+        L+ L   +G+ LR      L   + +   E   L ++++S
Sbjct: 478 LIAIARQDQHFNLAPTATLGLQYLFSEEGQYLRRQIVLALTEDDRLHTEEVQRLWNLVKS 537



>pir|AG1880|AG1880 hypothetical protein all0592 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681584 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 572

 Score =  145 bits (366), Expect = 1e-33
 Identities = 69/153 (45%), Positives = 99/153 (64%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+ D +++PI+PAL     +A+   VS+ NFKTI D    ++Y+YPF VPA +ALI+
Sbjct: 350 LGFLTADTNIAPIIPALETVLGNAIGKNVSDFNFKTITDQFSELMYEYPFRVPAKFALII 409

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL   EG+AL  +  FK++   YPY A+RLLT  +P LR  L+ +LFKDG+F+W RLEN
Sbjct: 410 RSLVTQEGIALSLNRNFKIVDVGYPYVARRLLTGESPELRRRLLNVLFKDGRFQWQRLEN 469

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELR 454
           L+   + D +F      +  L+ LL  +G+ LR
Sbjct: 470 LIAIARSDNNFDVLPTARMGLQFLLSDEGQFLR 502



>gb:BA000045_744487 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 562

 Score =  143 bits (361), Expect = 4e-33
 Identities = 72/153 (47%), Positives = 96/153 (62%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+P  DV+PIVPAL     D +   V + NFKTI D    ++Y+YPF VPA +ALI+
Sbjct: 353 LGFLAPGTDVAPIVPALELVLGDIIGQKVQDFNFKTITDRFSDLVYEYPFRVPAKFALII 412

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL   EG+AL   P FK++  +YPY A+RLLT  +P LR  L+++LFKDG+F+W+RLEN
Sbjct: 413 RSLITQEGIALSLTPDFKIIQVAYPYVARRLLTGESPRLRQRLLDILFKDGRFQWHRLEN 472

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELR 454
           L+        F    A Q  L+ L   DG  +R
Sbjct: 473 LIQIAGTGGSFDLLPAAQYGLESLFSKDGSFIR 505



>gb:AY093113_1575067 Arabidopsis thaliana unknown protein
           (At4g31390) mRNA, complete cds.>gb:BT008424_1639641
           Arabidopsis thaliana At4g31390 gene, complete cds.
          Length = 682

 Score =  129 bits (323), Expect = 1e-28
 Identities = 59/128 (46%), Positives = 85/128 (66%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+ D DVSPIVPAL   + ++    +++ NF+++      ++Y +P  +P  ++L++
Sbjct: 455 LGFLAKDTDVSPIVPALEAIWQNSAGKGLADFNFRSVTGQFNKLVYDFPIRIPERFSLVI 514

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL   EG+     P FK L  +YPY AKRLLTDPNP LR+ LI++LFKDG F+W RLEN
Sbjct: 515 RSLLTQEGICFTLKPDFKFLEVAYPYVAKRLLTDPNPALRERLIQVLFKDGVFQWKRLEN 574

Query: 552 LLVQGKKD 529
           LL   K++
Sbjct: 575 LLSLAKEN 582



>gb:BX569691_775847 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 549

 Score =  124 bits (312), Expect = 2e-27
 Identities = 70/168 (41%), Positives = 101/168 (60%), Gaps = 5/168 (2%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           +L FLSP  D++PIVPAL      +L  +V   NFK I D    +++ YPF VPA +ALI
Sbjct: 344 SLGFLSPSADLTPIVPALEEVLGGSLGDSVGSFNFKAITDRFSELMFDYPFRVPARFALI 403

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRL 559
           +R++   EGLAL  DP F+++A +YPY A+RLL      +RD L++++F  DG+   +RL
Sbjct: 404 IRAVVSQEGLALRLDPNFRIIAVAYPYVARRLLAGDTREMRDKLLDVIFDADGRLSLDRL 463

Query: 558 ENLLVQGKKDRDFSARDALQPV----LKLLLGPDGEELRVLVTKEAIR 427
           E+LL    +D     ++ L PV    L+LLL  DG +LR  +    IR
Sbjct: 464 ESLLAVIGQDAPAPGKELL-PVAGAGLRLLLSRDGADLRKRLLLTLIR 510



>gb:BX572098_798409 Prochlorococcus marinus MIT9313 complete genome;
           segment 4/7.
          Length = 548

 Score =  119 bits (299), Expect = 6e-26
 Identities = 72/159 (45%), Positives = 97/159 (61%), Gaps = 6/159 (3%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FLS   D++ I+PAL      +L  +V   NFK I D    +++ YPF VPA +ALI+
Sbjct: 345 LGFLSLTSDLTTIIPALEEVLGGSLGESVESFNFKAITDRFSELMFDYPFRVPARFALII 404

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRLE 556
           R++   EGLAL  DP FK++A +YPY AKRLL   +  +R+ L+E++F  +G  R  R+E
Sbjct: 405 RAVVSQEGLALRLDPDFKIIAIAYPYVAKRLLAGDSMEMREKLLEVIFDNNGHLRLERIE 464

Query: 555 NLLVQGKKDRDFSARDA-LQPV----LKLLLGPDGEELR 454
           +LL      +D  A DA L PV    LKLLLGPDG  LR
Sbjct: 465 SLL--KVISQDAVAPDAELIPVAGAGLKLLLGPDGSTLR 501



>gb:OSJN00094_1694814 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0003B01, complete sequence.
          Length = 719

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/179 (32%), Positives = 104/179 (58%), Gaps = 12/179 (6%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P      +  AL   F +A++  V  ++F  +   LG  +Y++ F +P+Y++L++
Sbjct: 418 LGLLPPTAQKDEVTKALTGVFQNAVDRGVQNISFGDLSGNLGRTMYKFKFQIPSYFSLVI 477

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL VLEG+A+  +P +KVL +SYP+ A+++LTD +P LR  L  LL+KDG F+ +RLE+
Sbjct: 478 RSLAVLEGIAISFNPNYKVLGSSYPWIARKVLTDSSPKLRSTLQTLLYKDGTFQIDRLES 537

Query: 552 LLVQG------------KKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAV 412
           LL +             +++   S++ A++ VL   L   G  ++ L+ +E  +  +A+
Sbjct: 538 LLTESLRARTEQSLTRDQQEETDSSKFAIKQVLSFTLTEQGAFVKDLLLQEIAKGLDAL 596



>gb:OSJN00015_1693300 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0079B02, complete sequence.
          Length = 720

 Score =  112 bits (280), Expect = 1e-23
 Identities = 59/179 (32%), Positives = 104/179 (58%), Gaps = 12/179 (6%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P      +  AL   F +A++  V  ++F  +   LG  +Y++ F +P+Y++L++
Sbjct: 412 LGLLPPTAQKDEVTKALTGVFQNAVDRGVQNISFGDLSGNLGRTMYKFKFQIPSYFSLVI 471

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL VLEG+A+  +P +KVL +SYP+ A+++LTD +P LR  L  LL+KDG F+ +RLE+
Sbjct: 472 RSLAVLEGIAISFNPNYKVLGSSYPWIARKVLTDSSPKLRSTLQTLLYKDGTFQIDRLES 531

Query: 552 LLVQG------------KKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAV 412
           LL +             +++   S++ A++ VL   L   G  ++ L+ +E  +  +A+
Sbjct: 532 LLTESLRARTEQSLTRDQQEETDSSKFAIKQVLSFTLTEQGAFVKDLLLQEIAKGLDAL 590



>gb:AY039896_1560410 Arabidopsis thaliana At1g71810/F14O23_17 mRNA,
           complete cds.>gb:AY094006_1575512 Arabidopsis thaliana
           At1g71810/F14O23_17 mRNA, complete cds.
          Length = 692

 Score =  110 bits (274), Expect = 5e-23
 Identities = 58/187 (31%), Positives = 108/187 (57%), Gaps = 9/187 (4%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P  + S +  AL + F DA++  V  ++F  ++  LG  +Y++ F +P Y++L++
Sbjct: 398 LGLLPPTAEKSAVTKALTDVFQDAISRGVRNISFGDLLGDLGKTMYRFKFRIPPYFSLVI 457

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL VLEG+A+   P +KVL ++YP+ A+++LTD +P L+ +L  LL+++G FR +RLE+
Sbjct: 458 RSLAVLEGIAIGISPNYKVLGSTYPWIARKILTDSSPQLKSSLQNLLYEEGVFRIDRLES 517

Query: 552 LLVQGKKDR---------DFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGS 400
           LL +  +              +  A++ +L       G  +R ++ +E  +  +A  L +
Sbjct: 518 LLSESLRTETALVQKPVVGTESNIAMKQMLAFTFTEQGSFVREILLREFAKGLDAYGLAT 577

Query: 399 IIESYNF 379
            ++S+ F
Sbjct: 578 -LDSFTF 583



>gb:AE017164_395569 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031238 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 548

 Score =  107 bits (268), Expect = 2e-22
 Identities = 56/157 (35%), Positives = 90/157 (57%), Gaps = 4/157 (2%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FLS + +++ + P L       +N  V+ LN KT+ D    +++ YPF VP+ +ALI+
Sbjct: 345 LGFLSENENINTLAPVLEEVLGSVINKDVNSLNLKTVTDKFSDLMFDYPFRVPSRFALII 404

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRLE 556
           R++   EGLA+  DP+F++L  +YPY AKRLLTD N  L + L++++F K+   R +RLE
Sbjct: 405 RAVVSQEGLAIKLDPEFQILKFAYPYVAKRLLTDENEELIEILMDIIFDKNNNIRIDRLE 464

Query: 555 NLL---VQGKKDRDFSARDALQPVLKLLLGPDGEELR 454
           NLL   +    +            +++L    G E+R
Sbjct: 465 NLLGVVIDSSSNPSIELLPVAGNSIRMLTSSKGSEIR 501



>gb:BX572092_796709 Prochlorococcus marinus MED4 complete genome;
           segment 3/5.
          Length = 552

 Score =  103 bits (258), Expect = 4e-21
 Identities = 60/158 (37%), Positives = 94/158 (59%), Gaps = 5/158 (3%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L FL+ + D+  +V  L+     A  + V   N K + D    ++Y YPF VP+ +ALI+
Sbjct: 350 LGFLTKEQDLEQLVEPLKEVLGGAFGAEVGNFNLKNVTDKFSKLMYSYPFRVPSRFALII 409

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRLE 556
           R++   EGLAL  DP+FK+L  +YPY AK+LLTD +  + + L+E++F  +G+ + ++LE
Sbjct: 410 RAVVSQEGLALRLDPEFKILKIAYPYIAKKLLTDNSDEIVNILLEVVFDNEGRIQIDKLE 469

Query: 555 NLLVQGKKDRDFSARDALQPV----LKLLLGPDGEELR 454
           +LL    KD +    D L PV    LKL++   G E+R
Sbjct: 470 SLLNTLFKDTENINAD-LIPVANAGLKLIVSNKGSEVR 506



>gb:BT004318_1637393 Arabidopsis thaliana clone RAFL15-48-N06
           (R50161) unknown protein (At5g24970) mRNA, complete
           cds.>gb:BT008522_1639739 Arabidopsis thaliana clone
           U50161 unknown protein (At5g24970) mRNA, complete cds.
          Length = 719

 Score = 99.8 bits (247), Expect = 7e-20
 Identities = 64/190 (33%), Positives = 99/190 (52%), Gaps = 24/190 (12%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           +L FL   VD+  +  ALR  F    ++T    +F+ +++ L  V+Y++ F++P  YAL+
Sbjct: 439 SLGFLPEGVDIQAVSNALRTSFG---STTRISQDFQGVMEQLYDVMYEFNFSLPPDYALV 495

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRL 559
           +RSL  LEG A   DP+FKV+ ++YP+   RLL DP+P +R  L EL+   DG  RWNRL
Sbjct: 496 IRSLGSLEGTAKILDPEFKVIESAYPFVIGRLLADPSPDMRKILRELVICNDGSIRWNRL 555

Query: 558 ENLL---------VQGKKDRD--------------FSARDALQPVLKLLLGPDGEELRVL 448
           E L+           G    D               S   A + +L  +L   G+ +RV 
Sbjct: 556 ERLVAAISEQASATSGDSPEDKTLKKSSELKSFDMHSVVSATEDLLLFILSEKGQRVRVF 615

Query: 447 VTKEAIRVTE 418
           + ++ IRV +
Sbjct: 616 LLQDIIRVVD 625



>gb:AY081264_1568610 Arabidopsis thaliana unknown protein
           (At1g71810) mRNA, complete cds.
          Length = 417

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 56/178 (31%), Positives = 101/178 (56%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P  + S +  AL + F DA++  V  ++F  ++  LG  +Y++ F +P Y++L++
Sbjct: 135 LGLLPPTAEKSAVTKALTDVFQDAISRGVRNISFGDLLGDLGKTMYRFKFRIPPYFSLVI 194

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           RSL VLEG+A+   P +KVL ++YP+ A+++LTD +P L+ +L  LL++       R E 
Sbjct: 195 RSLAVLEGIAIGISPNYKVLGSTYPWIARKILTDSSPQLKSSLQNLLYES-----LRTET 249

Query: 552 LLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNF 379
            LVQ K      +  A++ +L       G  +R ++ +E  +  +A  L + ++S+ F
Sbjct: 250 ALVQ-KPVVGTESNIAMKQMLAFTFTEQGSFVREILLREFAKGLDAYGLAT-LDSFTF 305



>gb:AP005111_1848039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0643F09.
          Length = 784

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 50/124 (40%), Positives = 76/124 (61%), Gaps = 2/124 (1%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNST-VSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           L F+   V++ PI+P L   FD AL       +NF+ +   L  + + YPF +P Y+ALI
Sbjct: 470 LGFIPEGVNLDPILPVLAKVFDQALEGGGAKNINFQELAADLAQITFDYPFRIPPYFALI 529

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRL 559
           +R++ VLEG+AL  DP+F ++  +YPY A+RLLTD +P LR AL   ++ K G F   R 
Sbjct: 530 IRAIGVLEGIALVGDPEFAIVDEAYPYIAQRLLTDESPRLRSALRYTIYGKTGVFDAERF 589

Query: 558 ENLL 547
            +++
Sbjct: 590 IDVM 593



>gb:AB028621_1518066 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MUJ8.>gb:AY113003_1578163 Arabidopsis thaliana
           AT3g24190/MUJ8_17 mRNA, complete
           cds.>gb:AF410316_1797130 Arabidopsis thaliana
           AT3g24190/MUJ8_17 mRNA, complete cds.
          Length = 793

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 49/124 (39%), Positives = 78/124 (62%), Gaps = 2/124 (1%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNST-VSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           L F+   V+++PI+P L   FD AL       +NF+ +   L  + + YPF +P Y+ALI
Sbjct: 474 LGFIPDGVNLAPILPVLAKVFDQALEGGGAKNINFQELAADLAQITFDYPFRIPPYFALI 533

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRL 559
           +R++ VLEG+AL  +P+F ++  +YPY A+RLLTD +P LR+AL   ++ K G F   R 
Sbjct: 534 IRAIGVLEGIALVGNPEFAIVDEAYPYIAQRLLTDESPRLREALRYTIYGKTGVFDAERF 593

Query: 558 ENLL 547
            +++
Sbjct: 594 IDVM 597



>gb:AP005642_1855303 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0040K22.
          Length = 722

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 58/194 (29%), Positives = 96/194 (49%), Gaps = 25/194 (12%)
 Frame = -3

Query: 915  ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
            +L F+    D+  +  ALR  F D    +    +F+ ++  L  V+Y++ F++P  YAL+
Sbjct: 433  SLGFVPEGTDLHGVADALRVSFGDGRRQSN---DFQGVMSHLYDVMYEFNFSLPPDYALV 489

Query: 735  LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNRL 559
            +R+L  LEG A   DP FKV+ ++YP+   RLL DP+P +R  L +LL   DG  RWNRL
Sbjct: 490  IRALGSLEGTAKALDPDFKVIESAYPFVIGRLLEDPSPDMRKILRQLLICDDGSIRWNRL 549

Query: 558  ENLLV-------QGKKDRDFSARD-----------------ALQPVLKLLLGPDGEELRV 451
            E L+           K  D S  +                 A + +   +L   G  +RV
Sbjct: 550  ERLIAAISEQSESSNKSEDRSGENAANKPGWRSFDMHSVVAATEDLFHFILSRKGWRVRV 609

Query: 450  LVTKEAIRVTEAVI 409
             + ++ ++ ++A +
Sbjct: 610  FLVQDIVKASDAFL 623



>gb:AP004153_1838264 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1111_C07.>gb:AP004240_1839153 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OJ1548_F12.
          Length = 961

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 43/145 (29%), Positives = 75/145 (51%), Gaps = 2/145 (1%)
 Frame = -3

Query: 915  ALDFLSPDVDVSPIVPALRNFFDDA-LNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYAL 739
            A+D + P  ++  +   L +   +      + ++ F  ++  + +V ++Y F +P YY L
Sbjct: 616  AMDVVPPRTNLRRVTMDLEDALGEVTFEDGIPDIKFSRVLGKIWSVAFKYHFRMPPYYTL 675

Query: 738  ILRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLF-KDGKFRWNR 562
            +LRSL  LEGLA+ AD  FK   A+YPY  ++LL+D +   R  L + +F K  +F+WN+
Sbjct: 676  VLRSLASLEGLAIAADGTFKTFQAAYPYVVRKLLSDNSVATRRLLHQAIFNKRKEFQWNK 735

Query: 561  LENLLVQGKKDRDFSARDALQPVLK 487
            +   L       +F     + P  K
Sbjct: 736  ITVFLKLASARGNFRYNTGVLPERK 760



>pir|T02583|T02583 probable ABC transporter At2g39190 [imported] -
            Arabidopsis thaliana
          Length = 791

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/195 (24%), Positives = 92/195 (47%), Gaps = 12/195 (6%)
 Frame = -3

Query: 912  LDFLSPDVDVSPIVPALRNFFDDA-LNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
            +D ++P V+       L     +  L + + ++ F  ++  +  V  +Y   +P Y+ L+
Sbjct: 500  MDVITPGVNTRRFTLDLEYALGEVKLINGIPDIEFTKVLSKIVNVALKYQLRMPPYFTLV 559

Query: 735  LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDAL-IELLFKDGKFRWNRL 559
            LRSL  LEGLA   DP FK   A+YP+  ++L+T+ +   R  L   +L +  +FRW R+
Sbjct: 560  LRSLACLEGLAAAGDPNFKTFEAAYPFVVQKLITENSAATRKILHSAVLNRKKEFRWERV 619

Query: 558  ENLLVQG---------KKDRDFSARDALQPVLKLLLGPDGEEL-RVLVTKEAIRVTEAVI 409
               L +          K  RD ++ D+   +       +G  L R  +++EA+ + + + 
Sbjct: 620  ALFLSKSSTRKQSPLLKLSRDETSVDSSSNLTDKDADNNGTSLIRTFISREALVIRQKLC 679

Query: 408  LGSIIESYNFIPGPM 364
            +      Y ++ G +
Sbjct: 680  MTIATTMYQWMVGSL 694



>gb:AC069158_1540661 Genomic Sequence for Oryza sativa, Nipponbare
            strain, clone OSJNBa0049O12, from chromosome 2, complete
            sequence.
          Length = 1372

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 32/96 (33%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -3

Query: 915  ALDFLSPDVDVSPIVPALRNFFDDA-LNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYAL 739
            A+D + P  ++  +   L +   +      + ++ F  ++  + +V ++Y F +P YY L
Sbjct: 1010 AMDVVPPRTNLRRVTMDLEDALGEVTFEDGIPDIKFSRVLGKIWSVAFKYHFRMPPYYTL 1069

Query: 738  ILRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTD 631
            +LRSL  LEGLA+ AD  FK   A+YPY  ++LL+D
Sbjct: 1070 VLRSLASLEGLAIAADGTFKTFQAAYPYVVRKLLSD 1105



>gb:AC004697_1532104 Arabidopsis thaliana chromosome 2 clone T16B24
            map CIC10A06, complete sequence.
          Length = 814

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 49/178 (27%), Positives = 84/178 (47%), Gaps = 22/178 (12%)
 Frame = -3

Query: 912  LDFLSPDVDVSPIVPALRNFFDDA-LNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
            +D ++P V+       L     +  L + + ++ F  ++  +  V  +Y   +P Y+ L+
Sbjct: 500  MDVITPGVNTRRFTLDLEYALGEVKLINGIPDIEFTKVLSKIVNVALKYQLRMPPYFTLV 559

Query: 735  LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDAL-IELLFKDGKFRWNRL 559
            LRSL  LEGLA   DP FK   A+YP+  ++L+T+ +   R  L   +L +  +FRW R+
Sbjct: 560  LRSLACLEGLAAAGDPNFKTFEAAYPFVVQKLITENSAATRKILHSAVLNRKKEFRWERV 619

Query: 558  ENLLVQG---------KKDRDFSARDA-----------LQPVLKLLLGPDGEELRVLV 445
               L +          K  RD ++ D+           +  VL+LL   +G  LR L+
Sbjct: 620  ALFLSKSSTRKQSPLLKLSRDETSVDSSSNLTDKDADNVSLVLRLLASKNGVVLRRLL 677



>pir|F96740|F96740 hypothetical protein F14O23.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_894728 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F14O23_1677507 Arabidopsis thaliana
           chromosome 1 BAC F14O23 sequence, complete sequence.
          Length = 649

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 39/124 (31%), Positives = 63/124 (50%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P  + S +  AL + F DA++  V  ++F  ++  LG  +               
Sbjct: 398 LGLLPPTAEKSAVTKALTDVFQDAISRGVRNISFGDLLGDLGKTI--------------- 442

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
             L VLEG+A+   P +KVL ++YP+ A+++LTD +P L+ +L  LL++       R E 
Sbjct: 443 --LAVLEGIAIGISPNYKVLGSTYPWIARKILTDSSPQLKSSLQNLLYES-----LRTET 495

Query: 552 LLVQ 541
            LVQ
Sbjct: 496 ALVQ 499



>pir|T04506|T04506 hypothetical protein F8F16.210 - Arabidopsis
           thaliana>gb:ATCHRIV74_1547060 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 74.>gb:ATF8F16_1551157
           Arabidopsis thaliana DNA chromosome 4, BAC clone F8F16
           (ESSA project).
          Length = 596

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 15/95 (15%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTI------------VDGLG---AVL 778
           L FL+ D DVSPIVPAL   + ++    +++ NF+++            V G G    ++
Sbjct: 456 LGFLAKDTDVSPIVPALEAIWQNSAGKGLADFNFRSVTAPHAHLKKRCHVFGAGQFNKLV 515

Query: 777 YQYPFNVPAYYALILRSLTVLEGLALYADPKFKVL 673
           Y +P  +P  ++L++RSL   EG+     P FK L
Sbjct: 516 YDFPIRIPERFSLVIRSLLTQEGICFTLKPDFKFL 550



>sp|Q55884|Y095_SYNY3 Hypothetical protein
           sll0095.>pir|S76702|S76702 ABC transporter sll0095 -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_690035
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 567

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 28/105 (26%), Positives = 53/105 (50%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           +  + P  D+SPI   +    D+  +  +    F  + + + A+  Q PF +P     IL
Sbjct: 349 MGLVEPKGDLSPIKRIINFLLDNFRDKPIDIKAFDQVGEEVYAMFQQQPFRLPPQMTFIL 408

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIE 598
           +S++ L+G+A   DP++ ++AAS P+     +  P   L  AL++
Sbjct: 409 KSISTLDGIARALDPRYNLIAASQPFIQSITVAQPKRSLAMALLQ 453



>pir|AC2370|AC2370 hypothetical protein alr4515 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_685504 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 589

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 27/96 (28%), Positives = 50/96 (52%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  ++P  D+ P+  +++   D+ ++      +   I D L  + Y  PF  PA +  ++
Sbjct: 378 LGAIAPVDDMGPVRRSVQYMLDNFMDKPFENQSVAAISDDLYEIAYNQPFRFPATFTFVM 437

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPN 625
           R+ + LEG+    DP+F  +  + PY A +L+TD N
Sbjct: 438 RAFSTLEGVGKGLDPEFNFMEVAQPY-AMQLMTDMN 472



>gb:BA000039_728069 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 548

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 33/103 (32%), Positives = 51/103 (49%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P  D +P+   ++   D      V    FK +   + A+  Q PF +PA    IL
Sbjct: 338 LGLLLPVTDRAPLQRIMQLILDRFTERPVDLAAFKELQQDVYALFEQQPFRLPAKMTYIL 397

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDAL 604
           +SLT L+G+A   DP++ + AA+ P F K L+    P  R+ +
Sbjct: 398 KSLTTLDGIARSLDPEYNLSAAAQP-FVKELMRHSRPGWRELI 439



>sp|P73627|YH70_SYNY3 Hypothetical protein
           sll1770.>pir|S77114|S77114 ABC transporter sll1770 -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_688451
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 585

 Score = 52.8 bits (125), Expect = 9e-06
 Identities = 28/99 (28%), Positives = 50/99 (50%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           AL  L    D+ PI  +++   D+ ++    E +   I D L  + Y  PF  PA +  +
Sbjct: 372 ALGALKETEDMGPIRRSVQFLLDNFMDKPFEEQSITKISDDLYEIAYDQPFRFPATFTFV 431

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPY 619
           +R+ + LEG+    DP F  +A + P FA +++ + N +
Sbjct: 432 MRAFSTLEGVGKGLDPDFNFMAVAQP-FALQIMNNSNGF 469



>gb:TACID3_196624 Thermoplasma acidophilum complete genome; segment
           3/5.
          Length = 504

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 50/191 (26%), Positives = 87/191 (45%), Gaps = 2/191 (1%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           AL+ LSP  +   I   +     +    +  +L  + ++D    V++Q+PF +P    L 
Sbjct: 321 ALNALSPGANRGVIRKGIELAISNFYGRSAEDLEIRELLDVANDVIFQFPFRLPRALVLY 380

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 556
           +R  ++LEG+    DP FK +        ++LL D      + LI+ L+K       +L+
Sbjct: 381 MRMSSLLEGVCQQLDPDFKFIRV-----LQKLLYD------EGLIQTLYK------QQLK 423

Query: 555 NLLVQGKKDRDFSARDALQ--PVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYN 382
           N L     D   S   A+Q  P++K  L  + E +R    +   R+  ++ LG I+ S  
Sbjct: 424 NFL----SDTLRSVEKAVQIVPLMKRRLESEDETVR---PQRDYRIPASIFLGFILLSL- 475

Query: 381 FIPGPMRTIIF 349
           FI    R ++F
Sbjct: 476 FIEEKTRPLVF 486



>gb:AP008231_580367 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 582

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 2/99 (2%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P  D+ P+  +++   D+ L+      +   I D +  + Y  PF  PA +  ++
Sbjct: 367 LGALLPTGDLGPVRRSVQYLLDNFLDRPFEGQSISAISDDIYEIAYDQPFRFPATFTFVM 426

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTD--PNP 622
           R+ + LEG+    DP F  +  + PY A  +++D  PNP
Sbjct: 427 RAFSTLEGVGKGLDPDFNFMTVAKPY-ALEIMSDATPNP 464



>gb:ATAC009176_1542831 Arabidopsis thaliana chromosome III P1 MLP3
           genomic sequence, complete sequence.
          Length = 670

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 5/125 (4%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALN-STVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           L+ L P  D+S +  +++ F D+ L+ S   +     I + L A+    PF  P+ +  +
Sbjct: 476 LEALQPTGDLSSVRRSVQFFLDNLLSQSPDQQQTLAAIGEDLFAISQDQPFRFPSTFTFV 535

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPY----LRDALIELLFKDGKFRW 568
           +R+ + LEG+    DP+F  +  + PY   R  T   PY    + + + EL   D K R 
Sbjct: 536 IRAFSTLEGIGYILDPEFSFVKVAAPYAQARSSTLSMPYRVQRIEEFVKELDSGDLKLRV 595

Query: 567 NRLEN 553
             LE+
Sbjct: 596 RVLES 600



>gb:BA000039_728026 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 599

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 27/96 (28%), Positives = 47/96 (48%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  L P  D+ P+  +++   D+ +N +    +   I D L  + Y  PF  PA +  ++
Sbjct: 386 LGALVPTGDLGPVRRSIQYLLDNFMNQSFETQSVAQISDDLYEIAYDQPFRFPATFTFVM 445

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPN 625
           R+ + LEG+    D  F  +  + P FA  L+T+ N
Sbjct: 446 RAFSTLEGVGKGLDKDFNFMQVAQP-FATELMTNGN 480



>pir|F84328|F84328 hypothetical protein Vng1770c [imported] -
           Halobacterium sp. NRC-1>gb:AE005081_63154 Halobacterium
           sp. NRC-1 section 112 of 170 of the complete
           genome.>gb:AE004437_888073 Halobacterium sp. NRC-1
           complete genome.
          Length = 537

 Score = 50.4 bits (119), Expect = 5e-05
 Identities = 24/87 (27%), Positives = 44/87 (50%)
 Frame = -3

Query: 903 LSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSL 724
           LSP+ D + +   +     DA    +     + IV  +   +Y++P  +P   AL+LR  
Sbjct: 294 LSPEADRAVMADVMELAIQDARGENIETYRVQQIVGKVEDTIYEFPLRLPPNLALVLRVA 353

Query: 723 TVLEGLALYADPKFKVLAASYPYFAKR 643
           TV+EG+ +  DP+F  +  +  Y A++
Sbjct: 354 TVVEGVCVTLDPEFDFITVATDYLAEQ 380



>gb:BA000011_665232 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 510

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 43/163 (26%), Positives = 77/163 (47%), Gaps = 2/163 (1%)
 Frame = -3

Query: 867 ALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADP 688
           A+ NF+      T  +L  + ++D    V++Q+PF +P    L +R  ++LEG+    DP
Sbjct: 348 AIANFY----GRTPEDLEIRELLDVANDVIFQFPFRLPRALVLYMRMSSLLEGVCQQLDP 403

Query: 687 KFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLENLLVQGKKDRDFSARD 508
            FK +        ++LL D      + LI+ L+K       RL N L     D   S   
Sbjct: 404 DFKFIRV-----LQKLLYD------EGLIQTLYK------KRLTNFL----DDTLISLEK 442

Query: 507 ALQ--PVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESY 385
           A+Q  P+LK  L  + E ++    ++  ++  ++ LG ++ S+
Sbjct: 443 AVQLVPLLKRKLEYEEEPIK----RKDYKIPASIFLGFLLLSF 481



>gb:AP005905_1859875 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1080A02.
          Length = 716

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 1/93 (1%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELN-FKTIVDGLGAVLYQYPFNVPAYYALI 736
           L+ L    D+SP+  +++ F D+ L+ T  +      I + L A+    PF  P+ +  +
Sbjct: 497 LEALQATGDLSPVRRSIQFFLDNLLSQTPDQQQTLAAIGEDLFAISQDQPFRFPSTFTFV 556

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLL 637
           +R+ + LEG+    DP F  +  + PY A+ LL
Sbjct: 557 IRAFSTLEGIGYILDPDFSFVKVAAPY-AQELL 588



>gb:AY059877_1564721 Arabidopsis thaliana ABC transporter-like
           (At5g64940; MXK3.17) mRNA, complete
           cds.>gb:AY064044_1565982 Arabidopsis thaliana putative
           ABC transporter protein (At5g64940) mRNA, complete
           cds.>gb:AY096382_1575928 Arabidopsis thaliana putative
           ABC transporter protein (At5g64940) mRNA, complete cds.
          Length = 761

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 44/81 (54%)
 Frame = -3

Query: 804 IVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPN 625
           I + L A+    PF  PA +  ++R+ +VL+G+    DP+F +   + PY  + L     
Sbjct: 574 IGEDLLAIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPYALELL----- 628

Query: 624 PYLRDALIELLFKDGKFRWNR 562
              R+A +E++ KD + RW+R
Sbjct: 629 -RFREAGVEVVVKDLRKRWDR 648



>gb:AB019236_1514248 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MXK3.
          Length = 795

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 44/81 (54%)
 Frame = -3

Query: 804 IVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPN 625
           I + L A+    PF  PA +  ++R+ +VL+G+    DP+F +   + PY  + L     
Sbjct: 608 IGEDLLAIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPYALELL----- 662

Query: 624 PYLRDALIELLFKDGKFRWNR 562
              R+A +E++ KD + RW+R
Sbjct: 663 -RFREAGVEVVVKDLRKRWDR 682



>gb:BX572090_795835 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 555

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 26/100 (26%), Positives = 49/100 (49%)
 Frame = -3

Query: 903 LSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSL 724
           +S ++DV P+   +R    +AL    S    + +   L  ++Y+ PF +P     ++R+L
Sbjct: 344 ISKNIDVGPVRRLVRLMLKEALTPPFSPNIIEKLSGDLYELVYETPFQLPVDLIFVMRAL 403

Query: 723 TVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDAL 604
           +  EG+    DP F +++ + PY    L+T  N    D +
Sbjct: 404 STFEGVGRMLDPGFNLVSITKPYLID-LMTSNNQTPNDLI 442



>gb:BA000045_744253 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 595

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 25/76 (32%), Positives = 40/76 (52%)
 Frame = -3

Query: 864 LRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPK 685
           L NF +   N  +   NF  + D +  + Y+ PF  PA +  +LR+++ LEGL    DP 
Sbjct: 401 LTNFVNQPYN--LQSFNFAELTDDIYEMAYEQPFRFPATFTFVLRAVSTLEGLGKGLDPD 458

Query: 684 FKVLAASYPYFAKRLL 637
           F  +  + P FA +L+
Sbjct: 459 FNFMDVAQP-FADQLM 473



>gb:AY088788_1573800 Arabidopsis thaliana clone 95043 mRNA, complete
           sequence.
          Length = 695

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALN-STVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           L+ L P  D+S +  +++ F D+ L+ S   +     I + L A+    PF  P+ +  +
Sbjct: 476 LEALQPTGDLSSVRRSVQFFLDNLLSQSPDQQQTLAAIGEDLFAISQDQPFRFPSTFTFV 535

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLL 637
           +R+ + LEG+    DP+F  +  + PY A+ LL
Sbjct: 536 IRAFSTLEGIGYILDPEFSFVKVAAPY-AQELL 567



>gb:AY080823_1568518 Arabidopsis thaliana unknown protein
           (At3g07700) mRNA, partial cds.
          Length = 566

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALN-STVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           L+ L P  D+S +  +++ F D+ L+ S   +     I + L A+    PF  P+ +  +
Sbjct: 347 LEALQPTGDLSSVRRSVQFFLDNLLSQSPDQQQTLAAIGEDLFAISQDQPFRFPSTFTFV 406

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLL 637
           +R+ + LEG+    DP+F  +  + PY A+ LL
Sbjct: 407 IRAFSTLEGIGYILDPEFSFVKVAAPY-AQELL 438



>gb:AY056806_1563855 Arabidopsis thaliana At3g07700/F17A17.4 mRNA,
           complete cds.
          Length = 695

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALN-STVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           L+ L P  D+S +  +++ F D+ L+ S   +     I + L A+    PF  P+ +  +
Sbjct: 476 LEALQPTGDLSSVRRSVQFFLDNLLSQSPDQQQTLAAIGEDLFAISQDQPFRFPSTFTFV 535

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLL 637
           +R+ + LEG+    DP+F  +  + PY A+ LL
Sbjct: 536 IRAFSTLEGIGYILDPEFSFVKVAAPY-AQELL 567



>gb:ATAC013483_1543532 Arabidopsis thaliana chromosome III BAC
           F17A17 genomic sequence, complete sequence.
          Length = 693

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 27/93 (29%), Positives = 49/93 (52%), Gaps = 1/93 (1%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALN-STVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           L+ L P  D+S +  +++ F D+ L+ S   +     I + L A+    PF  P+ +  +
Sbjct: 476 LEALQPTGDLSSVRRSVQFFLDNLLSQSPDQQQTLAAIGEDLFAISQDQPFRFPSTFTFV 535

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLL 637
           +R+ + LEG+    DP+F  +  + PY A+ LL
Sbjct: 536 IRAFSTLEGIGYILDPEFSFVKVAAPY-AQELL 567



>gb:BX572101_799423 Prochlorococcus marinus MIT9313 complete genome;
           segment 7/7.
          Length = 559

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 39/173 (22%), Positives = 75/173 (43%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           A   ++  +DV P+   +R  F DAL    S    + +   L  ++Y  PF +P     +
Sbjct: 341 AAGLIAYGIDVGPVRRLVRVMFQDALTPPFSANVIEKLSGDLYELVYGQPFRLPVELIFV 400

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLE 556
           +R+L+  EG+    D  F ++A + PY    L+T       D   EL  + G        
Sbjct: 401 MRALSTFEGVGRSLDSGFSLMAIAKPYLLP-LMTSSGSGPNDLFNELGRQVGAI---GSR 456

Query: 555 NLLVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSI 397
              +  + D      +     L++ +G    +LR +++ +   + ++V+LGS+
Sbjct: 457 AAALPRRLDESLERLEQGDLQLQIRMGESDRQLRRMISVQK-ALGQSVLLGSL 508



>gb:BX569695_777251 Synechococcus sp. WH8102 complete genome;
           segment 7/7.
          Length = 550

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 28/107 (26%), Positives = 48/107 (44%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           A   +S ++DV P+   +R   ++AL    S      +   L  ++Y  PF +P     +
Sbjct: 332 AAGVISKEIDVGPVRRLVRLMLNEALTPPFSSNVIDKLSGDLYDLVYGQPFRLPVELIFV 391

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIEL 595
           +R+L+  EG+    DP F ++  + PY    L+T       D   EL
Sbjct: 392 MRALSTFEGVGRSLDPAFSLVGIAKPYLLP-LMTSSGSGSNDLFNEL 437



>gb:AE017282_428605 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 568

 Score = 46.2 bits (108), Expect = 9e-04
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 2/98 (2%)
 Frame = -3

Query: 894 DVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVL 715
           +VD   +V  + N  DD   +T+ +L+   ++  L  ++ Q+   +P    L+ R+L  L
Sbjct: 360 NVDPDLLVADMDNLIDDYHGATLRQLSLTQMLTDLTQLMRQHRLALPPDLTLLFRALITL 419

Query: 714 EGLALYADPKFKVLAASYPYFAKRLLT--DPNPYLRDA 607
           +G+    DP F + A + P+  K L    DP    R+A
Sbjct: 420 DGIGKQNDPDFDIFAQAAPFIEKSLKERYDPEKIARNA 457



>gb:AP005116_1848160 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0703B01.
          Length = 373

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 25/81 (30%), Positives = 43/81 (53%)
 Frame = -3

Query: 804 IVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPN 625
           I + L ++    PF  PA +  ++R+ +VL+G+    DP+F +   + PY A  LL    
Sbjct: 186 IGEDLLSIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPY-AMELLR--- 241

Query: 624 PYLRDALIELLFKDGKFRWNR 562
               +A +E++ KD + RW R
Sbjct: 242 --FNEAGVEVIVKDARKRWER 260



>gb:AP005116_1848159 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0703B01.
          Length = 763

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 25/81 (30%), Positives = 43/81 (53%)
 Frame = -3

Query: 804 IVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPN 625
           I + L ++    PF  PA +  ++R+ +VL+G+    DP+F +   + PY A  LL    
Sbjct: 576 IGEDLLSIAADQPFRFPATFTFVVRAFSVLDGIGKGLDPRFDITEIAKPY-AMELLR--- 631

Query: 624 PYLRDALIELLFKDGKFRWNR 562
               +A +E++ KD + RW R
Sbjct: 632 --FNEAGVEVIVKDARKRWER 650



>gb:AY596297_633072 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 405

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 22/83 (26%), Positives = 40/83 (48%)
 Frame = -3

Query: 903 LSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSL 724
           LSP+ D   +   +     DA    + +   + I+  +   +Y++P  +PA  AL+LR  
Sbjct: 169 LSPEADRQVMGDVMELAIADARGEDIEQYRVQQIIQQVEDTIYEFPLRLPANLALVLRVA 228

Query: 723 TVLEGLALYADPKFKVLAASYPY 655
           TV+EG+ +  D  F  +  +  Y
Sbjct: 229 TVVEGVCVTLDEDFDFIGVATDY 251



>gb:AE017161_394694 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030363 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 559

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 32/169 (18%), Positives = 78/169 (46%)
 Frame = -3

Query: 903 LSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSL 724
           L+ ++D+ P+   +R    + L     +   + +   L  ++Y  PF +P     ++R+L
Sbjct: 346 LAQEIDLGPVRRLVRIMLKERLTPPFDKDVIEKLSVDLYELVYGQPFRLPVELIFVMRAL 405

Query: 723 TVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLENLLV 544
           +  EG+    DP F ++A + PY    ++   N    D + E+  + G+     +    +
Sbjct: 406 STFEGVGRSLDPSFNLIAITKPYLI-TIMNSNNSNPNDLINEIGRQFGELGTKAVG---L 461

Query: 543 QGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSI 397
             + D +    +     L++ LG    +LR +++ +   ++++++LG +
Sbjct: 462 PKRLDENLERLEQGDLQLQIRLGESDRQLRRMISAQQ-SMSQSILLGCL 509



>gb:AE017261_419757 Picrophilus torridus DSM 9790, complete genome.
          Length = 505

 Score = 41.6 bits (96), Expect = 0.022
 Identities = 21/79 (26%), Positives = 43/79 (54%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           +L+ LSP  +   I  A+     +     V+E++ + +++    V++++PF++P    L 
Sbjct: 326 SLNALSPAANRGIIRKAIEISIANFSGRDVNEIDIRELLEVANNVIFEFPFHLPRELVLY 385

Query: 735 LRSLTVLEGLALYADPKFK 679
           +R  ++LEG+    DP FK
Sbjct: 386 IRMSSLLEGICKTLDPNFK 404



>gb:AY596298_634907 Haloarcula marismortui ATCC 43049 chromosome II,
           complete sequence.
          Length = 521

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 28/95 (29%), Positives = 47/95 (49%)
 Frame = -3

Query: 915 ALDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALI 736
           ALD L P V+ + +   L    ++      SE+ ++ I+  L   L  +PF +P    L+
Sbjct: 328 ALDVLEPHVNRAEVGRVLALVIENLEGR--SEITWRMIITELTTNLRAFPFRIPPDVMLL 385

Query: 735 LRSLTVLEGLALYADPKFKVLAASYPYFAKRLLTD 631
           +R  TV EG+    DP+F  LAA   +  ++ L +
Sbjct: 386 IRVGTVGEGVCRQLDPEFDFLAAVRSFLVEQGLIE 420



>gb:BX294141_767644 Pirellula sp. strain 1 complete genome; segment
           9/24.
          Length = 570

 Score = 40.8 bits (94), Expect = 0.037
 Identities = 20/80 (25%), Positives = 38/80 (47%)
 Frame = -3

Query: 894 DVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVL 715
           D D   +V  + +  DD  +  + E +    +  +  ++ ++   +PA  A++L+ L +L
Sbjct: 373 DFDEPSLVSEIHDMLDDYSDQKIREFDVSACLRDVTGIIREHRIYLPAKVAMLLKVLAML 432

Query: 714 EGLALYADPKFKVLAASYPY 655
           EG A   DP F +     PY
Sbjct: 433 EGTAHQLDPNFSLAELLEPY 452



>gb:AY714848_1189650 Uncultured archaeon GZfos27G5 clone GZfos27G5,
           *** SEQUENCING IN PROGRESS ***.
          Length = 575

 Score = 40.4 bits (93), Expect = 0.049
 Identities = 32/159 (20%), Positives = 68/159 (42%), Gaps = 7/159 (4%)
 Frame = -3

Query: 828 VSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYFA 649
           + EL    ++  + +V+ +Y    P  + L+ ++L  +EG+    DP+F  ++ + P+  
Sbjct: 391 LKELEIGHLLHRIASVVVEYQLKAPRNFYLLAKALVTIEGVGKELDPEFNAVSHAEPFAE 450

Query: 648 KRLLTDPNP-------YLRDALIELLFKDGKFRWNRLENLLVQGKKDRDFSARDALQPVL 490
           K + +  +P       YL      LL +D       +   + QG+    F  +  L P+L
Sbjct: 451 KIIWSRMSPRKLIEDFYLSALETRLLLRDLPSEARDILTRVRQGEIKIKFEHK-GLDPML 509

Query: 489 KLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFIP 373
           K L       +  +V    +  +  ++L  +   ++ IP
Sbjct: 510 KTLDQTSNRTVFAIVLASLVIGSALMVLSGVPPKWHEIP 548



>gb:AY741198_1190682 Uncultured archaeon GZfos23H7 clone GZfos23H7,
           *** SEQUENCING IN PROGRESS ***.
          Length = 541

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 35/179 (19%), Positives = 74/179 (41%), Gaps = 7/179 (3%)
 Frame = -3

Query: 888 DVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEG 709
           DV  +   +    +     ++ EL    ++  +G V+ ++    P  + L+ ++L  +EG
Sbjct: 337 DVEELESDIAELIEVYAYGSLKELEIGGVITHMGDVIIEHHLEGPRDFYLLAKALVTIEG 396

Query: 708 LALYADPKFKVLAASYPYFAKRLLTDPNP-------YLRDALIELLFKDGKFRWNRLENL 550
           +    DP+F     + P+  K +L+  +P       YL      LL +D       +   
Sbjct: 397 VGRELDPEFNAAKHAEPFAEKLILSRMSPRKLIEDFYLAALETRLLLRDLPSEARDILAR 456

Query: 549 LVQGKKDRDFSARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIESYNFIP 373
           + QG+    F  +  L+P+LK L       +  +V    +  +  ++L  +   ++ IP
Sbjct: 457 VRQGEIKIKFEHK-GLEPMLKTLDQITNRTVFAIVLASLVIGSALMVLSGVPPKWHEIP 514



>gb:AY596297_631991 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 494

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 22/74 (29%), Positives = 35/74 (47%)
 Frame = -3

Query: 903 LSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSL 724
           L P  D + +  A     +      +SE   + +V      LY++P  +P   AL++R  
Sbjct: 270 LDPMADRNVMREAFDIVIEQFRGEDISEYRIEQLVGQFETQLYEFPMRLPQDLALVVRVT 329

Query: 723 TVLEGLALYADPKF 682
           TVLEG+    DP+F
Sbjct: 330 TVLEGVCRTLDPEF 343



>gb:AE013136_289456 Thermoanaerobacter tengcongensis MB4, section
           163 of 244 of the complete genome.>gb:AE008691_1111521
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 558

 Score = 40.0 bits (92), Expect = 0.063
 Identities = 22/92 (23%), Positives = 49/92 (53%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L+ ++ +V++  +   + N  D  +   + +L    +++G+  +++ Y   +P  + ++ 
Sbjct: 340 LNAVTLNVNMKKLEKDINNLRDRYVEIPLEKLKVGEVLNGIFDLVFSYNIVIPNEFNMLA 399

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLL 637
           +SL  LEG+    DPK  VL  + P  AK+L+
Sbjct: 400 KSLITLEGIVEKLDPKISVLEVAKP-IAKQLI 430



>gb:AE012273_280970 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 181 of 460 of the complete
           genome.>gb:AE008922_914252 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 558

 Score = 38.5 bits (88), Expect = 0.18
 Identities = 21/88 (23%), Positives = 42/88 (47%)
 Frame = -3

Query: 900 SPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLT 721
           S D+D   +   +  F D      + EL    ++  + A+L  +   +P+  AL++++  
Sbjct: 351 SLDIDEPRLQQDIGAFVDAYRGVPLKELRIGAMLGDVTAILRDHGLTLPSDLALMIKAFL 410

Query: 720 VLEGLALYADPKFKVLAASYPYFAKRLL 637
            LEG+    DP F + + + PY  + +L
Sbjct: 411 TLEGMGRQLDPDFDMASEARPYLERVVL 438



>gb:AE011805_276676 Xanthomonas axonopodis pv. citri str. 306,
           section 183 of 469 of the complete
           genome.>gb:AE008923_918451 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 558

 Score = 37.7 bits (86), Expect = 0.31
 Identities = 19/88 (21%), Positives = 43/88 (48%)
 Frame = -3

Query: 900 SPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLT 721
           S ++D + +   +  F D+     + EL    ++  + ++L  +   +P+  AL++++  
Sbjct: 351 SLEIDEARLQQDIGAFVDEYRGVPLKELRIGAMLGDVTSILRDHGLTLPSDLALMIKAFL 410

Query: 720 VLEGLALYADPKFKVLAASYPYFAKRLL 637
            LEG+    DP F +   + PY  + +L
Sbjct: 411 TLEGMGRQLDPDFDMATEARPYLERVVL 438



>gb:BA000016_675568 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 537

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 17/83 (20%), Positives = 38/83 (45%)
 Frame = -3

Query: 891 VDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLE 712
           V+ S +   L+N     +N+++  +    +   +  +  +     P     ++RS+ +LE
Sbjct: 332 VEYSILYDDLKNIVSKYINASLKTIKISDLFKEIFEIAERNNIQFPRELVALVRSIVILE 391

Query: 711 GLALYADPKFKVLAASYPYFAKR 643
           G+    DP  +++   YPY  +R
Sbjct: 392 GVIAKIDPDLEIMECIYPYVKER 414



>gb:AE013598_296644 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 575

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 19/88 (21%), Positives = 42/88 (47%)
 Frame = -3

Query: 900 SPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLT 721
           S ++D   +   +  F D+     + EL    ++  + ++L  +   +P+  AL++++  
Sbjct: 368 SLEIDEPRLQQDIGAFVDEYRGVPLKELRIGAMLGDVTSILRDHGLTLPSDLALMIKAFL 427

Query: 720 VLEGLALYADPKFKVLAASYPYFAKRLL 637
            LEG+    DP F +   + PY  + +L
Sbjct: 428 TLEGMGRQLDPDFDMATEARPYLERLVL 455



>gb:CR522870_99636 Desulfotalea psychrophila LSv54 chromosome.
          Length = 450

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 22/92 (23%), Positives = 42/92 (45%), Gaps = 7/92 (7%)
 Frame = -3

Query: 888 DVSPIVPALRNFFDDALNST-------VSELNFKTIVDGLGAVLYQYPFNVPAYYALILR 730
           DV P +   R+F+ +  + T       +   N   ++     +L ++    P+   L+ +
Sbjct: 235 DVDPALTTTRDFYIELQHLTSQLQSDNLDNFNISEMLSDFFTMLQRFKIRCPSDLLLLTK 294

Query: 729 SLTVLEGLALYADPKFKVLAASYPYFAKRLLT 634
           +LT +EG+A   DP F V+    P   K ++T
Sbjct: 295 ALTTIEGVAEQFDPSFDVINHVRPMIEKVIVT 326



>pir|G90433|G90433 ABC transporter, ABC1 family, probable SSO2605
           [imported] - Sulfolobus solfataricus>gb:AE006856_223340
           Sulfolobus solfataricus P2 section 215 of 272 of the
           complete genome.>gb:AE006641_1109188 Sulfolobus
           solfataricus P2, complete genome.
          Length = 496

 Score = 37.4 bits (85), Expect = 0.41
 Identities = 28/130 (21%), Positives = 51/130 (39%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           L  + P  D   +   LR F        VSEL  +  +     V +++P  +P+   L  
Sbjct: 317 LGAIQPFADRRVLAKGLRLFMQAMQGIEVSELELEDFMKLADQVFFKFPLRMPSKLVLPF 376

Query: 732 RSLTVLEGLALYADPKFKVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWNRLEN 553
           R + VL+G     D  F  + +S  +       +   Y    +IE + +     WNR  +
Sbjct: 377 RMVNVLDGTCREIDKDFDFVKSSITFL------EEEGYTTKVVIEQVRELVNGIWNRFRS 430

Query: 552 LLVQGKKDRD 523
            L+   + ++
Sbjct: 431 FLLSYSQQQE 440



>gb:BA000045_741543 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 545

 Score = 36.2 bits (82), Expect = 0.92
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 6/106 (5%)
 Frame = -3

Query: 837 NSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYP 658
           N +++E+NF  ++  +  VL +    +P    L +++L  LEG+A   DP F ++    P
Sbjct: 365 NRSLAEINFGALLYDMLRVLRENGIRLPGNIGLYVKALANLEGVARSLDPDFNMVETVKP 424

Query: 657 ----YFAKRLL-TDPNPYLRDALIELL-FKDGKFRWNRLENLLVQG 538
                F +RL  T P   L++AL   L  ++   ++ R  +LL+QG
Sbjct: 425 LITELFRRRLFGTAP---LQEALRSALDLRELLLKFPRRLDLLLQG 467



>gb:AY302592_1943028 Homo sapiens putative ubiquinone biosynthesis
           protein AarF (AARF) mRNA, complete cds.
          Length = 626

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 831 TVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYF 652
           T+ +L+  +++  +  +L  +   + + +A I+ ++ VLEGL    DPK  +L A+ P+ 
Sbjct: 559 TLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKLDILEAARPF- 617

Query: 651 AKRLLTDP 628
              LLT P
Sbjct: 618 ---LLTGP 622



>gb:AC006344_1875132 Homo sapiens PAC clone RP4-726N20 from
           7q32-q34, complete sequence.
          Length = 191

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 20/68 (29%), Positives = 38/68 (55%)
 Frame = -3

Query: 831 TVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYF 652
           T+ +L+  +++  +  +L  +   + + +A I+ ++ VLEGL    DPK  +L A+ P+ 
Sbjct: 124 TLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKLDILEAARPF- 182

Query: 651 AKRLLTDP 628
              LLT P
Sbjct: 183 ---LLTGP 187



>gb:BX842648_823923 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 3/11.
          Length = 780

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 6/77 (7%)
 Frame = +2

Query: 335 AALPLKIIVLIGPGMKLYDSIIEPRMTASVTRIASLVTKTLNSSPSGP------NNNFRT 496
           A L L + VL     +++  + E     ++T  A  V K L +SP GP      +   RT
Sbjct: 279 ARLALNVYVLPSVVNEVHRQLKEKADQDAITVFAENVRKLLLASPYGPKCVLGVDPGLRT 338

Query: 497 GCKASLAEKSRSFFPWT 547
           GCK +L +KS +F   T
Sbjct: 339 GCKVALIDKSGAFISHT 355



>gb:AE017279_426098 Bacillus cereus ATCC 10987, section 16 of 18 of
           the complete genome.>gb:AE017194_1064517 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 558

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 21/77 (27%), Positives = 41/77 (53%)
 Frame = -3

Query: 861 RNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKF 682
           +N++D  L    S+L+    V  L  + Y++   +P+   L+ ++L  +EGL    DP+ 
Sbjct: 364 QNYYDVPL----SQLSLGKAVQELFNIAYKHHIQIPSDITLLGKTLLTIEGLVEKLDPEL 419

Query: 681 KVLAASYPYFAKRLLTD 631
            +L  + P F ++LL +
Sbjct: 420 SILKVAEP-FGRQLLKE 435



>gb:AY523972S1_625180 Azospirillum brasilense plasmid 90 MDa, partial
            sequence.
          Length = 1439

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 32/120 (26%), Positives = 45/120 (37%), Gaps = 17/120 (14%)
 Frame = +2

Query: 56   ESTTGILRYNYLTVGEGARRTCCSNR---------------AARRW--LIPPTTRPPMLR 184
            E T G LR    T+  GARR     R                 R W  + PP  RPP  R
Sbjct: 896  ELTVGALRRRTRTLAAGARRVTAPTRDVAARLLRHIAPRLIEVRPWEDVAPPPARPPRHR 955

Query: 185  ASGSWSICKIGCRRLGSKLSEDRKRPHILNTCALRSIMLSCSAGFITRGPAALPLKIIVL 364
                W +C IG   +G +   +              ++L+C+     RG   LPL+ +V+
Sbjct: 956  NGRRWRVCTIGA--VGIQKGYE--------------VLLACARDAAARG---LPLEFVVV 996



>gb:AE008692_240927 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.>gb:AF088896_478301 Zymomonas mobilis fosmid
           clone 42C11, complete sequence.
          Length = 512

 Score = 35.0 bits (79), Expect = 2.0
 Identities = 17/89 (19%), Positives = 43/89 (48%)
 Frame = -3

Query: 888 DVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEG 709
           D++    ALR   +     +V +++   ++DGL ++  ++      +  L+ +++ V+EG
Sbjct: 348 DIAEFTTALRTIGEPIRGLSVRDISISHMLDGLFSITREFEMQTQPHLLLLQKTMVVVEG 407

Query: 708 LALYADPKFKVLAASYPYFAKRLLTDPNP 622
           +A    P   +   + P+  + L ++  P
Sbjct: 408 VATSLYPDINLWDTAEPFVREWLRSELGP 436



>gb:AE016920_357928 Chromobacterium violaceum ATCC 12472 section 11
           of 16 of the complete genome.>gb:AE016825_1043082
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 560

 Score = 34.7 bits (78), Expect = 2.7
 Identities = 19/93 (20%), Positives = 43/93 (46%)
 Frame = -3

Query: 900 SPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLT 721
           S  VD+      +  F     +  +  LN   ++  + A++  +   +P   A++ ++L 
Sbjct: 351 SAPVDMQKFADEVGEFMFQYEHLPLKGLNISQLISDIMALIRNHGIVLPPDMAMLFKALV 410

Query: 720 VLEGLALYADPKFKVLAASYPYFAKRLLTDPNP 622
            LEGL    +P F+++A   P+  + ++   +P
Sbjct: 411 TLEGLGRQLNPDFQLVAHITPFVKELIVARYHP 443



>gb:BA000043_738331 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 558

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 15/66 (22%), Positives = 39/66 (59%)
 Frame = -3

Query: 828 VSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYFA 649
           + E++    V+ L +V +++   +P+   L+ ++L  +EG+    DP+F+++  + P F 
Sbjct: 371 LGEISLGEAVEDLLSVAFRHGIRIPSDLTLLGKALLTVEGVVETLDPQFRIMDVAEP-FG 429

Query: 648 KRLLTD 631
           ++L+ +
Sbjct: 430 RKLMKE 435



>gb:AE017197_402570 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 612

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 6/96 (6%)
 Frame = -3

Query: 609 ALIELLFKDGKFRWNRLENLLVQGKKDRDFSARDALQ----PVLKLLLGPDGEELRVLVT 442
           AL   ++   KF   ++EN+L Q   + DFS   A++     +L  LL  D  +++    
Sbjct: 254 ALTLEVYNFNKFSLRKIENMLNQKGLNTDFSIDQAIEQENFELLISLLNYDNTKIQFYTV 313

Query: 441 KEAIRVTEAVILGSIIE--SYNFIPGPMRTIIFNGN 340
            +AI      IL +++E  + N IP  +  +I  GN
Sbjct: 314 NKAIEKGNLDILKAVLEHSTTNIIPYNIERVIEKGN 349



>gb:AB186503_16810 Uncultured bacterium genes for hypothetical
           protein, putative methyl-accepting chemotaxis protein,
           transcriptional regulator TetR family, hypothetical
           protein, 2-octaprenylphenol hydroxylase of ubiquinone
           biosynthetic pathway, complete cds, clone: NAP3.
          Length = 580

 Score = 33.9 bits (76), Expect = 4.5
 Identities = 16/78 (20%), Positives = 39/78 (50%)
 Frame = -3

Query: 891 VDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLE 712
           +D   ++  ++ F D      + +L   +++  L A++ Q+   +P+  +L++++   LE
Sbjct: 372 IDEDGLMLEIQAFVDQYHGVALKQLRLGSMLSDLMAIVRQHRLALPSDLSLLVKAFITLE 431

Query: 711 GLALYADPKFKVLAASYP 658
           G+    DP F +   + P
Sbjct: 432 GMGRELDPDFDMAGEAMP 449



>gb:D86371_2399060 Sweet potato feathery mottle virus genomic RNA,
           complete genome.
          Length = 3493

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 23/74 (31%), Positives = 37/74 (50%)
 Frame = +2

Query: 332 PAALPLKIIVLIGPGMKLYDSIIEPRMTASVTRIASLVTKTLNSSPSGPNNNFRTGCKAS 511
           PA +PL  I    P +KL  +I+EP  T +V   +S + K   ++P+          KAS
Sbjct: 329 PAIVPLPTI----PLLKLESTIVEPIATPTVVVTSSEIVKVPIATPTEVE-------KAS 377

Query: 512 LAEKSRSFFPWTSR 553
            A   +  +PWT++
Sbjct: 378 KAPLPKHLYPWTAK 391



>gb:AE017315_440269 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 7 of 12 of the complete
           genome.>gb:AE017285_1073430 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 1158

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 2/92 (2%)
 Frame = -3

Query: 912 LDFLSPDVDVSPIVPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALIL 733
           +DF+  D+  +P+   LR F ++A N         T VDG+  +L     NV     + +
Sbjct: 384 MDFVGRDLFTAPLQTTLRQF-EEADNFGSLIRPDVTDVDGMLRILESK--NVSGQLFISM 440

Query: 732 RSLTVLEGL--ALYADPKFKVLAASYPYFAKR 643
               VL+ L  A Y  PK+ V+ A+ PY  KR
Sbjct: 441 THQKVLQALRQADYLSPKYHVVIANPPYMGKR 472



>pir|D83988|D83988 ABC transporter BH2708 [imported] - Bacillus
           halodurans  (strain C-125)>gb:BA000004_656654 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 526

 Score = 33.5 bits (75), Expect = 5.9
 Identities = 23/91 (25%), Positives = 47/91 (51%), Gaps = 3/91 (3%)
 Frame = -3

Query: 894 DVDVSPI---VPALRNFFDDALNSTVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSL 724
           DVD+  +   +  LR  FDD     +S+++    V+ L A+  ++   +PA   L+ ++L
Sbjct: 317 DVDMQLLQWDIDELREKFDDV---PLSQVSLGEAVNDLFAIANRHRIQIPADLTLLGKTL 373

Query: 723 TVLEGLALYADPKFKVLAASYPYFAKRLLTD 631
             +E +    DP+  ++  + P F ++LL +
Sbjct: 374 LTMEQMVEKLDPELSIVKVAEP-FGRQLLKE 403



>gb:BC069944_2106210 Mus musculus aarF domain containing kinase 2,
           mRNA (cDNA clone MGC:78248 IMAGE:30446117), complete
           cds.
          Length = 617

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 16/62 (25%), Positives = 34/62 (54%)
 Frame = -3

Query: 831 TVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYF 652
           T+ +L+  +++  +  +L  +   + + +A I+ ++ VLEGL    DP   +L A+ P+ 
Sbjct: 550 TLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVVAIMVLEGLGRSLDPTLDILEAAKPFL 609

Query: 651 AK 646
            K
Sbjct: 610 FK 611



>gb:AK028557_1161051 Mus musculus 0 day neonate skin cDNA, RIKEN
           full-length enriched library, clone:4632433A20
           product:hypothetical ABC1 family containing protein,
           full insert sequence.>gb:AK028568_1161056 Mus musculus
           10 days neonate skin cDNA, RIKEN full-length enriched
           library, clone:4732401K03 product:hypothetical ABC1
           family containing protein, full insert sequence.
          Length = 617

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 16/62 (25%), Positives = 34/62 (54%)
 Frame = -3

Query: 831 TVSELNFKTIVDGLGAVLYQYPFNVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYF 652
           T+ +L+  +++  +  +L  +   + + +A I+ ++ VLEGL    DP   +L A+ P+ 
Sbjct: 550 TLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVVAIMVLEGLGRSLDPTLDILEAAKPFL 609

Query: 651 AK 646
            K
Sbjct: 610 FK 611



>gb:CP000025_877989 Campylobacter jejuni RM1221, complete genome.
          Length = 66

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = -3

Query: 762 NVPAYYALILRSLTVLEGLALYADPKFKVLAASYPYFAKRLLT 634
           ++  Y   + +++T+LEG   + D KFK+ A  YP F + L+T
Sbjct: 6   SIRKYKNTLSKNVTILEGKKHFWDIKFKIKARVYPSFKQHLIT 48



>gb:AP006878_575612 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 740

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 6/103 (5%)
 Frame = -3

Query: 681 KVLAASYPYFAKRLLTDPNPYLRDALIELLFKDGKFRWN--RLENLLVQGK-KDRD---F 520
           +V+  S       +LT+P P   DALI+   +  +  W   R+E++ V  K  D D   +
Sbjct: 527 QVVEVSLDLSFSTILTEPAPL--DALIQRFGRVNRQGWKEGRIEDVYVLTKGADADRKIY 584

Query: 519 SARDALQPVLKLLLGPDGEELRVLVTKEAIRVTEAVILGSIIE 391
           +  D ++  LK+L   DG+ELR  +  E +    A +   ++E
Sbjct: 585 NPYDVVEESLKILQDFDGKELRESLIPELVSEAYAPVSDELVE 627



>gb:AE017237_413510 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 11 of 16 of the complete
           genome.>gb:AE016958_1056914 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 429

 Score = 33.1 bits (74), Expect = 7.7
 Identities = 16/49 (32%), Positives = 28/49 (57%)
 Frame = +2

Query: 260 PHILNTCALRSIMLSCSAGFITRGPAALPLKIIVLIGPGMKLYDSIIEP 406
           P +L TC +  ++L+  A FI  GP  L   ++ L+G G+ +  S ++P
Sbjct: 222 PRLLVTCGV--VLLAVFAAFIAHGPLHLEPSLVALLGAGILVVASRLQP 268


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 941,576,284
Number of Sequences: 1806583
Number of extensions: 19577276
Number of successful extensions: 49166
Number of sequences better than 10.0: 94
Number of HSP's better than 10.0 without gapping: 47454
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49137
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 64780204623
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)