BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13989
         (1684 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB104727_1526539 Arabidopsis thaliana At-SPS2 mRNA for solane...   484   e-135   
gb:AB071514_1522883 Arabidopsis thaliana At SPS mRNA for solanes...   481   e-134   
pir|C86306|C86306 prenyl transferase homolog [imported] - Arabid...   479   e-134   Arabidopsis thaliana [mouse-ear cress]
pir|F96813|F96813 hypothetical protein T30F21.15 [imported] - Ar...   468   e-130   Arabidopsis thaliana [mouse-ear cress]
gb:AC098573_1736770 Oryza sativa (japonica cultivar-group) chrom...   461   e-128   
gb:BT004246_1637328 Arabidopsis thaliana clone RAFL15-37-G01 (R5...   455   e-126   
gb:BA000039_727541 Thermosynechococcus elongatus BP-1 DNA, compl...   325   2e-87   
sp|P31171|PREA_CYAPA|PREA_CYAPA Prenyl transferase (EC 2.5.1.-).>pir|A40433...   318   3e-85   Cyanophora paradoxa
pir|AH1818|AH1818 solanesyl diphosphate synthase [imported] - No...   315   2e-84   Nostoc sp. PCC 7120
sp|P72580|PREA_SYNY3|PREA_SYNY3 Prenyl transferase (EC 2.5.1.-).>pir|S76966...   313   5e-84   Synechocystis sp.
gb:AP008231_581436 Synechococcus elongatus PCC 6301 DNA, complet...   302   1e-80   
sp|P51268|PREA_PORPU|PREA_PORPU Prenyl transferase (EC 2.5.1.-).>pir|S73189...   291   3e-77   Porphyra purpurea
gb:AY673996_1621471 Gracilaria tenuistipitata var. liui chloropl...   289   1e-76   
gb:BA000045_740828 Gloeobacter violaceus PCC 7421 DNA, complete ...   287   4e-76   
gb:BX569691_775913 Synechococcus sp. WH8102 complete genome; seg...   281   4e-74   
gb:AE017164_395498 Prochlorococcus marinus subsp. marinus str. C...   277   5e-73   
gb:BX572096_797734 Prochlorococcus marinus MIT9313 complete geno...   276   1e-72   
gb:BX572091_796244 Prochlorococcus marinus MED4 complete genome;...   275   2e-72   
sp|Q9TLS1|PREA_CYACA|PREA_CYACA Prenyl transferase (EC 2.5.1.-).>gb:AF02218...   254   4e-66   Cyanidium caldarium
gb:AB002583_1508844 Cyanidioschyzon merolae chloroplast DNA, com...   231   3e-59   
gb:AP003728_1832568 Oryza sativa (japonica cultivar-group) genom...   208   3e-52   
gb:QRO298245_1703204 Quercus robur mRNA for geranyl diphosphat s...   206   9e-52   
gb:AY166797_1586229 Citrus unshiu geranylgeranyl diphosphate syn...   203   1e-50   
gb:BT020524_1642918 Arabidopsis thaliana At2g34630 gene, complet...   197   7e-49   
gb:AY093006_1574960 Arabidopsis thaliana putative trans-prenyltr...   197   7e-49   
gb:CQ793418_1452999 Sequence 121 from Patent WO2004017749.>gb:CQ...   197   7e-49   
gb:AE012386_281964 Xanthomonas campestris pv. campestris str. AT...   192   1e-47   
gb:AE013598_295139 Xanthomonas oryzae pv. oryzae KACC10331, comp...   191   3e-47   
gb:BC049211_1984207 Homo sapiens trans-prenyltransferase, mRNA (...   190   9e-47   
gb:AL390961_1926747 Human DNA sequence from clone RP13-16H11 on ...   190   9e-47   
gb:BA000028_696175 Oceanobacillus iheyensis HTE831 DNA, complete...   190   9e-47   
gb:CSP243739_1674010 Citrus sinensis mRNA for geranyl diphosphat...   189   1e-46   
gb:AF118395_1884699 Homo sapiens trans-prenyltransferase mRNA, c...   189   2e-46   
gb:CR382129_1662064 Yarrowia lipolytica chromosome C of strain C...   189   2e-46   
gb:MCI496300_1685767 Mucor circinelloides f. lusitanicus isoB ge...   188   3e-46   
gb:AL646072_547751 Ralstonia solanacearum GMI1000 chromosome, co...   188   3e-46   
gb:AE011933_277822 Xanthomonas axonopodis pv. citri str. 306, se...   188   3e-46   
gb:AY351862_1601742 Vitis vinifera geranyl diphosphate synthase ...   188   3e-46   
gb:AE014297_1142308 Drosophila melanogaster chromosome 3R, compl...   186   1e-45   
gb:AF118855_2055136 Mus musculus trans-prenyltransferase (Tpt) m...   185   3e-45   
gb:AE017002_376450 Bacillus cereus ATCC 14579 section 5 of 18 of...   184   6e-45   
gb:AE017269_422869 Bacillus cereus ATCC 10987, section 6 of 18 o...   183   1e-44   
sp|P55785|HEP2_BACST|HEP2_BACST Heptaprenyl diphosphate synthase component ...   182   1e-44   Geobacillus stearothermophilus
gb:AP006840_567379 Symbiobacterium thermophilum DNA, complete ge...   181   3e-44   
gb:AF282771_1258696 Trypanosoma cruzi putative farnesyl syntheta...   181   4e-44   
gb:CP000001_852014 Bacillus cereus ZK, complete genome.               181   4e-44   
gb:BA000043_738787 Geobacillus kaustophilus HTA426 DNA, complete...   181   4e-44   
gb:AE017225_406820 Bacillus anthracis str. Sterne, complete geno...   181   4e-44   
gb:AE017028_381714 Bacillus anthracis str. Ames section 5 of 18 ...   181   4e-44   
gb:BX950851_839440 Erwinia carotovora subsp. atroseptica SCRI104...   180   7e-44   
gb:AE017340_456239 Idiomarina loihiensis L2TR, complete genome.       180   7e-44   
gb:BX640437_812968 Bordetella bronchiseptica strain RB50, comple...   178   3e-43   
gb:BX640413_805185 Bordetella pertussis strain Tohama I, complet...   178   3e-43   
gb:BX640423_808567 Bordetella parapertussis strain 12822, comple...   177   4e-43   
sp|P31114|HEP2_BACSU|HEP2_BACSU Heptaprenyl diphosphate synthase component ...   177   4e-43   Bacillus subtilis
gb:AE017333_448251 Bacillus licheniformis DSM 13, complete genom...   177   6e-43   
gb:CR382125_1657987 Kluyveromyces lactis strain NRRL Y-1140 chro...   177   8e-43   
gb:AY142889_592072 Heliobacillus mobilis Farnesyl pyrophosphate ...   177   8e-43   
pir|E83856|E83856 heptaprenyl diphosphate synthase component II ...   177   8e-43   Bacillus halodurans
gb:CR382134_1667061 Debaryomyces hansenii chromosome B of strain...   176   2e-42   
gb:AF153713_483851 Pseudomonas sp. BG33R strain BG33R octylpreny...   176   2e-42   
pir|AB1316|AB1316 heptaprenyl diphosphate synthase component II ...   176   2e-42   Listeria monocytogenes
gb:CR555306_107964 Azoarcus sp. EbN1 complete genome.                 175   2e-42   
gb:BX571874_789398 Photorhabdus luminescens subsp. laumondii TTO...   175   3e-42   
gb:SME591785_184864 Sinorhizobium meliloti 1021 complete chromos...   175   3e-42   
pir|AB1688|AB1688 heptaprenyl diphosphate synthase component II ...   174   4e-42   Listeria innocua
gb:BA000031_705787 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   174   5e-42   
gb:AP006627_564208 Bacillus clausii KSM-K16 DNA, complete genome.     174   5e-42   
gb:AE017328_444380 Listeria monocytogenes str. 4b F2365, section...   174   6e-42   
gb:CR380949_1649593 Candida glabrata strain CBS138 chromosome C ...   173   8e-42   
gb:CP000010_866684 Burkholderia mallei ATCC 23344 chromosome 1, ...   173   8e-42   
gb:AP008226_579112 Thermus thermophilus HB8 genomic DNA, complet...   173   1e-41   
gb:AE015800_317978 Shewanella oneidensis MR-1 section 349 of 457...   173   1e-41   
sp|P18900|COQ1_YEAST|COQ1_YEAST Hexaprenyl pyrophosphate synthetase, mitoch...   172   1e-41   Saccharomyces cerevisiae [brewer's yeast]
gb:BX571965_792805 Burkholderia pseudomallei strain K96243, chro...   172   2e-41   
gb:BX936398_835108 Yersinia pseudotuberculosis IP32953 genome, c...   172   2e-41   
gb:BFU61168_748532 Bacillus firmus spore germination proteins C2...   171   3e-41   
gb:AE016912_355808 Chromobacterium violaceum ATCC 12472 section ...   171   3e-41   
gb:AE016858_350250 Pseudomonas syringae pv. tomato str. DC3000 s...   171   4e-41   
pir|AB0427|AB0427 octaprenyl-diphosphate synthase (EC 2.5.1.-) [...   171   4e-41   Yersinia pestis
gb:CP000020_870453 Vibrio fischeri ES114 chromosome I, complete ...   170   7e-41   
gb:AE017305_436925 Thermus thermophilus HB27 section 5 of 7 of t...   170   9e-41   
gb:CP000027_79395 Dehalococcoides ethenogenes 195, complete genome.   169   2e-40   
gb:AE017349_1758668 Cryptococcus neoformans var. neoformans JEC2...   168   3e-40   
gb:AY075463_1296258 Drosophila melanogaster RE18374 full length ...   168   3e-40   
gb:AE016767_327923 Escherichia coli CFT073 section 13 of 18 of t...   168   3e-40   
gb:AB001997_498 Rhodobacter capsulatus DNA for solanesyl diphosp...   168   4e-40   
gb:BA000037_721295 Vibrio vulnificus YJ016 DNA, chromosome I, co...   167   5e-40   
pir|E85982|E85982 octaprenyl diphosphate synthase [imported] - E...   167   6e-40   Escherichia coli O157:H7
pir|AH0903|AH0903 octaprenyl-diphosphate synthase [imported] - S...   167   6e-40   Salmonella enterica subsp. enterica serovar Typhi
sp|P19641|ISPB_ECOLI|ISPB_ECOLI Octaprenyl-diphosphate synthase (EC 2.5.1.-...   167   6e-40   Escherichia coli [E. coli]
pir|AD2654|AD2654 octaprenyl-diphosphate synthase [imported] - A...   167   8e-40   Agrobacterium tumefaciens
pir|A82322|A82322 octaprenyl-diphosphate synthase VC0434 [import...   167   8e-40   Vibrio cholerae
pir|H97435|H97435 decaprenyl diphosphate synthase (AB006850) [im...   167   8e-40   Agrobacterium tumefaciens
gb:AY224190_599143 Agrobacterium tumefaciens BNQ0605 decaprenyl ...   166   1e-39   
gb:AE017152_392225 Haemophilus ducreyi strain 35000HP section 2 ...   166   1e-39   
gb:BX321862_774243 Nitrosomonas europaea ATCC 19718, complete ge...   166   1e-39   
gb:CR543861_104751 Acinetobacter sp. ADP1 complete genome.            166   2e-39   
gb:AE016827_343229 Mannheimia succiniciproducens MBEL55E, comple...   165   2e-39   
sp|O43091|DPS1_SCHPO|DPS1_SCHPO Decaprenyl-diphosphate synthase (EC 2.5.1.-...   163   9e-39   Schizosaccharomyces pombe
gb:AE012555_284045 Xylella fastidiosa Temecula1, section 3 of 9 ...   162   1e-38   
gb:CR628336_112826 Legionella pneumophila str. Paris complete ge...   162   1e-38   
pir|A82688|A82688 octaprenyl-diphosphate synthase XF1391 [import...   162   3e-38   Xylella fastidiosa
gb:AE016818_1748152 Ashbya gossypii (= Eremothecium gossypii) AT...   161   3e-38   
gb:AE008692_240302 Zymomonas mobilis subsp. mobilis ZM4, complet...   161   3e-38   
gb:BX897699_827047 Bartonella henselae strain Houston-1, complet...   161   4e-38   
sp|P44916|ISPB_HAEIN|ISPB_HAEIN Octaprenyl-diphosphate synthase (EC 2.5.1.-...   161   4e-38   Haemophilus influenzae
gb:AE016747_322807 Staphylococcus epidermidis ATCC 12228, sectio...   160   6e-38   
gb:CP000029_81643 Staphylococcus epidermidis RP62A, complete gen...   160   7e-38   
gb:AE016776_330126 Pseudomonas putida KT2440 section 3 of 21 of ...   159   1e-37   
gb:CR628337_115787 Legionella pneumophila str. Lens complete gen...   159   1e-37   
gb:CR378664_93802 Photobacterium profundum SS9; segment 2/12.         159   1e-37   
pir|H87510|H87510 polyprenyl synthetase family protein [imported...   159   1e-37   Caulobacter vibrioides
gb:BX897700_828561 Bartonella quintana str. Toulouse, complete g...   159   2e-37   
gb:AE017354_461000 Legionella pneumophila subsp. pneumophila str...   159   2e-37   
gb:AY658845_2147855 Synthetic construct Peudomonas aeruginosa cl...   158   3e-37   
pir|AF3443|AF3443 geranyltranstransferase (EC 2.5.1.10) [importe...   158   3e-37   Brucella melitensis
pir|C83075|C83075 octaprenyl-diphosphate synthase PA4569 [import...   158   3e-37   Pseudomonas aeruginosa
gb:BX571856_780921 Staphylococcus aureus subsp. aureus strain MR...   158   4e-37   
gb:BA000033_711651 Staphylococcus aureus subsp. aureus MW2 DNA, ...   158   4e-37   
gb:AE016961_367625 Coxiella burnetii strain RSA 493, section 2 o...   158   4e-37   
pir|F89925|F89925 heptaprenyl diphosphate syntase component II [...   158   4e-37   Staphylococcus aureus subsp. aureus Mu50
gb:AE014291_307855 Brucella suis 1330 chromosome I, complete seq...   157   5e-37   
pir|T43193|T43193 trans-pentaprenyltranstransferase homolog - fi...   157   5e-37   Schizosaccharomyces pombe
gb:AP006618_561523 Nocardia farcinica IFM 10152 DNA, complete ge...   157   6e-37   
gb:BA000012_671818 Mesorhizobium loti MAFF303099 DNA, complete g...   157   8e-37   
gb:U80443_1406255 Caenorhabditis elegans cosmid C24A11, complete...   156   1e-36   
pir|G87775|G87775 protein C24A11.9 [imported] - Caenorhabditis e...   156   1e-36   Caenorhabditis elegans [roundworm]
gb:AE017180_399615 Geobacter sulfurreducens PCA, complete genome.     155   2e-36   
gb:AE016799_335437 Vibrio vulnificus CMCP6 chromosome I section ...   155   2e-36   
gb:AJ749949_531501 Francisella tularensis subsp. tularensis comp...   154   4e-36   
gb:AE004969_61329 Neisseria gonorrhoeae FA 1090, complete genome.     154   4e-36   
gb:BX572596_800655 Rhodopseudomonas palustris CGA009 complete ge...   154   5e-36   
gb:CP000009_863976 Gluconobacter oxydans 621H, complete genome.       153   1e-35   
gb:CR767821_116403 Ehrlichia ruminantium strain Welgevonden, com...   152   2e-35   
pir|A81213|A81213 octaprenyl-diphosphate synthase (EC 2.5.1.-) N...   152   2e-35   Neisseria meningitidis serogroup B
pir|A84759|A84759 probable trans-prenyltransferase [imported] - ...   151   3e-35   Arabidopsis thaliana [mouse-ear cress]
gb:BX248584_763717 Blochmannia floridanus complete genome; segme...   151   4e-35   
gb:AP006841_570618 Bacteroides fragilis YCH46 DNA, complete genome.   150   6e-35   
gb:AE006071_215234 Pasteurella multocida subsp. multocida str. P...   150   6e-35   
gb:CP000030_83961 Anaplasma marginale str. St. Maries, complete ...   149   2e-34   
gb:AB006850_1017 Gluconobacter suboxydans ddsA gene for decapren...   149   2e-34   
pir|T45152|T45152 bifunctional short chain isoprenyl diphosphate...   148   4e-34   Methanothermobacter thermautotrophicus
sp|Q53479|IDSA_METTM|IDSA_METTM Bifunctional short chain isoprenyl diphosph...   148   4e-34   Methanothermobacter marburgensis
gb:AE017320_441421 Desulfovibrio vulgaris subsp. vulgaris str. H...   147   5e-34   
sp|O26156|IDSA_METTH|IDSA_METTH Bifunctional short chain isoprenyl diphosph...   147   5e-34   Methanothermobacter thermautotrophicus
gb:AE013189_290038 Thermoanaerobacter tengcongensis MB4, section...   147   6e-34   
gb:BA000040_730791 Bradyrhizobium japonicum USDA 110 DNA, comple...   147   8e-34   
gb:AB003188_614 Micrococcus luteus hexs-a, menG, hexs-b gene, co...   146   1e-33   
pir|F86792|F86792 hypothetical protein ispB [imported] - Lactoco...   146   1e-33   Lactococcus lactis subsp. lactis
gb:AE017258_418539 Wolbachia endosymbiont of Drosophila melanoga...   145   2e-33   
gb:AE016957_367188 Enterococcus faecalis V583, section 11 of 11 ...   145   2e-33   
gb:CQ867548_1454561 Sequence 16 from Patent WO2004074487.             144   4e-33   
gb:BA000021_687224 Wigglesworthia glossinidia endosymbiont of Gl...   144   4e-33   
gb:AE017241_414763 Mycobacterium avium subsp. paratuberculosis s...   144   4e-33   
gb:BA000030_702751 Streptomyces avermitilis MA-4680 genomic DNA,...   144   5e-33   
gb:AE017282_429681 Methylococcus capsulatus str. Bath, complete ...   142   2e-32   
gb:AE017261_420216 Picrophilus torridus DSM 9790, complete genome.    142   2e-32   
gb:CP000031_84380 Silicibacter pomeroyi DSS-3, complete genome.       142   2e-32   
gb:AY847292_647531 Rhodobacter sphaeroides strain 2.4.1 decapren...   142   2e-32   
gb:AE017321_442164 Wolbachia endosymbiont strain TRS of Brugia m...   142   2e-32   
gb:PZE431695_162199 Paracoccus zeaxanthinifaciens phaA gene, pha...   142   3e-32   
gb:AB027705_1517527 Daucus carota mRNA for GGPP synthase, comple...   140   6e-32   
pir|F69535|F69535 geranylgeranyl diphosphate synthase [validated...   140   6e-32   Archaeoglobus fulgidus
gb:AE012881_286680 Chlorobium tepidum TLS section 102 of 194 of ...   140   1e-31   
pir|B75457|B75457 polyprenyl synthase - Deinococcus radiodurans ...   140   1e-31   Deinococcus radiodurans
gb:AE016939_362628 Bacteroides thetaiotaomicron VPI-5482, sectio...   139   2e-31   
gb:CQ793218_1452960 Sequence 34 from Patent WO2004018694.>gb:CQ7...   139   2e-31   
gb:BX294145_769015 Pirellula sp. strain 1 complete genome; segme...   139   2e-31   
gb:AF120272_480639 Archaeoglobus fulgidus geranylgeranyl diphosp...   139   2e-31   
gb:AY534687_1612249 Antirrhinum majus geranyl diphosphate syntha...   137   7e-31   
gb:CR522870_100588 Desulfotalea psychrophila LSv54 chromosome.        137   7e-31   
gb:AL935255_551000 Lactobacillus plantarum strain WCFS1 complete...   137   9e-31   
pir|D97790|D97790 octaprenyl-diphosphate synthase (EC 2.5.1.-) [...   136   1e-30   Rickettsia conorii
gb:SCO939120_178255 Streptomyces coelicolor A3(2) complete genom...   136   1e-30   
gb:AY661706_1620418 Adonis palaestina geranylgeranyl diphosphate...   135   2e-30   
gb:ATHGERPYRS_1553195 Arabidopsis thaliana geranylgeranyl pyroph...   135   2e-30   
sp|P34802|GGPP_ARATH|GGPP_ARATH Geranylgeranyl pyrophosphate synthetase, ch...   135   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AE017197_402446 Rickettsia typhi str. Wilmington complete gen...   134   4e-30   
pir|A70377|A70377 octoprenyl-diphosphate synthase - Aquifex aeol...   134   4e-30   Aquifex aeolicus
gb:AY661707_1620419 Adonis palaestina geranylgeranyl diphosphate...   133   1e-29   
gb:AE014270_307034 Streptococcus agalactiae 2603V/R section 80 o...   133   1e-29   
pir|D71651|D71651 octaprenyl-diphosphate synthase (ispB) RP479 -...   133   1e-29   Rickettsia prowazekii
gb:AL935254_550946 Lactobacillus plantarum strain WCFS1 complete...   132   2e-29   
pir|AH1780|AH1780 heptaprenyl diphosphate synthase component II ...   132   2e-29   Listeria innocua
gb:AE016953_366051 Enterococcus faecalis V583, section 7 of 11 o...   132   2e-29   
sp|Q43133|GGPP_SINAL|GGPP_SINAL Geranylgeranyl pyrophosphate synthetase, ch...   132   2e-29   Sinapis alba [bai jie]
gb:AY372454_614059 Uncultured marine gamma proteobacterium EB000...   132   3e-29   
gb:AY087565_1572595 Arabidopsis thaliana clone 36701 mRNA, compl...   131   4e-29   
gb:SAG766853_171311 Streptococcus agalactiae NEM316 complete gen...   131   4e-29   
sp|Q58270|IDSA_METJA|IDSA_METJA Bifunctional short chain isoprenyl diphosph...   131   4e-29   Methanocaldococcus jannaschii
gb:AE013412_292097 Methanosarcina mazei strain Goe1, section 194...   131   5e-29   
gb:AB028617_1518025 Arabidopsis thaliana genomic DNA, chromosome...   130   6e-29   
pir|E70549|E70549 probable heptaprenyl diphosphate syntetase - M...   130   8e-29   Mycobacterium tuberculosis
gb:AE017331_445030 Listeria monocytogenes str. 4b F2365, section...   130   1e-28   
pir|AI1404|AI1404 heptaprenyl diphosphate synthase component II ...   130   1e-28   Listeria monocytogenes
sp|P80042|GGPP_CAPAN|GGPP_CAPAN Geranylgeranyl pyrophosphate synthetase, ch...   130   1e-28   Capsicum annuum
gb:AY552545_627880 Uncultured marine gamma proteobacterium EBAC2...   129   2e-28   
pir|A87194|A87194 polyprenyl diphosphate synthase component [imp...   129   2e-28   Mycobacterium leprae
pir|E71101|E71101 probable geranylgeranyl pyrophosphate syntheta...   129   2e-28   Pyrococcus horikoshii
pir|E86647|E86647 prenyl transferase [imported] - Lactococcus la...   128   3e-28   Lactococcus lactis subsp. lactis
gb:AB055496_1521476 Hevea brasiliensis ggps mRNA for geranylgera...   128   4e-28   
sp|P39464|GGPP_SULAC|GGPP_SULAC Geranylgeranyl pyrophosphate synthetase (GG...   128   4e-28   Sulfolobus acidocaldarius
gb:AF020041_1761615 Helianthus annuus geranylgeranyl pyrophospha...   127   5e-28   
gb:AE010463_263368 Fusobacterium nucleatum subsp. nucleatum ATCC...   127   5e-28   
pir|E84566|E84566 probable geranylgeranyl pyrophosphate synthase...   127   5e-28   Arabidopsis thaliana [mouse-ear cress]
gb:BT015110_1642080 Arabidopsis thaliana At3g32040 gene, complet...   127   7e-28   
gb:AY515700_1610755 Plectranthus barbatus geranylgeranyl pyropho...   127   7e-28   
pir|C75139|C75139 bifunctional short chain isoprenyl diphosphate...   127   7e-28   Pyrococcus abyssi
pir|T11021|T11021 farnesyltranstransferase (EC 2.5.1.29) - white...   127   7e-28   Lupinus albus
pir|G84566|G84566 probable geranylgeranyl pyrophosphate synthase...   127   7e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AP004185_1838690 Oryza sativa (japonica cultivar-group) genom...   127   9e-28   
gb:AF251012_1780932 Tagetes erecta GGDP synthase mRNA, complete ...   126   1e-27   
gb:AE010369_262406 Methanopyrus kandleri AV19 section 68 of 157 ...   126   1e-27   
gb:AB034249_1518858 Croton sublyratus mRNA for geranylgeranyl py...   126   2e-27   
gb:BX248355_761725 Corynebacterium diphtheriae gravis NCTC13129,...   126   2e-27   
gb:BX957219_843298 Methanococcus maripaludis S2 complete genome;...   125   2e-27   
gb:AY596297_631624 Haloarcula marismortui ATCC 43049 chromosome ...   125   2e-27   
gb:AE016822_339475 Leifsonia xyli subsp. xyli str. CTCB07, compl...   125   2e-27   
gb:AF492022_1804889 Cistus incanus subsp. creticus geranylgerany...   125   3e-27   
gb:CP000025_878413 Campylobacter jejuni RM1221, complete genome.      125   3e-27   
gb:BA000011_665526 Thermoplasma volcanium GSS1 DNA, complete gen...   125   3e-27   
pir|E81400|E81400 polyprenyl synthetase (EC 2.5.1.-) Cj0541 [imp...   125   3e-27   Campylobacter jejuni
gb:AP001309_1821137 Arabidopsis thaliana genomic DNA, chromosome...   125   3e-27   
gb:AF513111_1807389 Abies grandis geranyl diphosphate synthase (...   125   3e-27   
sp|Q42698|GGPP_CATRO|GGPP_CATRO Geranylgeranyl pyrophosphate synthetase, ch...   125   3e-27   Catharanthus roseus [chatas]
gb:AK117933_1815940 Arabidopsis thaliana At3g14550 mRNA for puta...   124   5e-27   
gb:AB023038_1515398 Arabidopsis thaliana genomic DNA, chromosome...   124   5e-27   
gb:AE017178_398109 Porphyromonas gingivalis W83 section 7 of 8 o...   124   5e-27   
gb:TACID2_196208 Thermoplasma acidophilum complete genome; segme...   124   5e-27   
pir|B72560|B72560 probable geranyltranstransferase APE1764 - Aer...   124   5e-27   Aeropyrum pernix
gb:AE017201_403786 Lactobacillus johnsonii NCC 533, section 2 of...   124   8e-27   
gb:AB052679_1521219 Eucommia ulmoides EUGGPS mRNA for putative G...   123   1e-26   
gb:AB034250_1518859 Scoparia dulcis mRNA for geranylgeranyl pyro...   123   1e-26   
gb:AP008231_580455 Synechococcus elongatus PCC 6301 DNA, complet...   123   1e-26   
gb:AE016934_361426 Bacteroides thetaiotaomicron VPI-5482, sectio...   123   1e-26   
gb:AE010220_260669 Pyrococcus furiosus DSM 3638, section 95 of 1...   123   1e-26   
gb:AB025791_4341 Aeropyrum pernix fgs gene for farnesylgeranyl d...   123   1e-26   
gb:AB027706_1517528 Daucus carota mRNA for GGPP synthase, comple...   122   2e-26   
gb:AE017283_431673 Propionibacterium acnes KPA171202, complete g...   122   2e-26   
gb:AB023038_1515396 Arabidopsis thaliana genomic DNA, chromosome...   122   2e-26   
gb:AY086932_1571970 Arabidopsis thaliana clone 29678 mRNA, compl...   122   3e-26   
gb:BA000039_725805 Thermosynechococcus elongatus BP-1 DNA, compl...   122   3e-26   
pir|H84270|H84270 geranylgeranyl diphosphate synthase [imported]...   122   3e-26   Halobacterium salinarum
pir|AE1833|AE1833 geranylgeranyl diphosphate synthase [imported]...   122   3e-26   Nostoc sp. PCC 7120
gb:AF425235_1799057 Abies grandis geranylgeranyl diphosphate syn...   121   5e-26   
gb:AE017164_395585 Prochlorococcus marinus subsp. marinus str. C...   121   5e-26   
gb:AE017149_391477 Helicobacter hepaticus ATCC 51449 section 6 o...   121   5e-26   
gb:AE017290_433137 Leptospira interrogans serovar Copenhageni st...   120   7e-26   
gb:AE017180_400061 Geobacter sulfurreducens PCA, complete genome.     120   7e-26   
gb:AE011483_273451 Leptospira interrogans serovar lai str. 56601...   120   7e-26   
gb:AB016093_2689 Synechococcus elongatus crtE gene for geranylge...   120   7e-26   
sp|P48368|CRTE_CYAPA|CRTE_CYAPA Geranylgeranyl pyrophosphate synthetase hom...   120   7e-26   Cyanophora paradoxa
gb:AY866498_1631127 Picrorhiza kurrooa geranyl diphosphate synth...   120   9e-26   
gb:AL390961_1926749 Human DNA sequence from clone RP13-16H11 on ...   120   1e-25   
gb:AE016850_348578 Tropheryma whipplei str. Twist, section 1 of ...   120   1e-25   
gb:BX251410_764278 Tropheryma whipplei TW08/27, complete genome;...   119   1e-25   
gb:AE010721_265986 Methanosarcina acetivorans str. C2A, section ...   119   1e-25   
gb:BX572098_798451 Prochlorococcus marinus MIT9313 complete geno...   119   2e-25   
gb:BX572092_796696 Prochlorococcus marinus MED4 complete genome;...   119   2e-25   
gb:BA000036_718200 Corynebacterium glutamicum ATCC 13032 DNA, co...   118   3e-25   
gb:AP006841_574264 Bacteroides fragilis YCH46 DNA, complete genome.   118   3e-25   
gb:BX569691_775644 Synechococcus sp. WH8102 complete genome; seg...   118   4e-25   
pir|S74538|S74538 geranylgeranyl pyrophosphate synthase - Synech...   118   4e-25   Synechocystis sp. PCC 6803
gb:AP000383_1819911 Arabidopsis thaliana genomic DNA, chromosome...   117   7e-25   
gb:AF492023_1804890 Cistus incanus subsp. creticus geranylgerany...   117   7e-25   
gb:BX571661_778877 Wolinella succinogenes, complete genome; segm...   117   7e-25   
gb:AY168649_594386 Sulfolobus shibatae carotenoid biosynthetic E...   117   7e-25   
gb:MPI249453_1686795 Mentha x piperita mRNA for gpp synthase lar...   117   9e-25   
gb:AY453404_1606942 Taxus x media geranylgeranyl diphosphate syn...   117   9e-25   
gb:AB109219_13347 Thermococcus kodakaraensis idsA gene for isopr...   117   9e-25   
gb:AY371321_1603059 Ginkgo biloba geranylgeranyl diphosphate syn...   116   1e-24   
pir|S75427|S75427 farnesyltranstransferase (EC 2.5.1.29) - Sulfo...   116   2e-24   Saccharolobus solfataricus
sp|P95999|GGPP_SULSO|GGPP_SULSO Geranylgeranyl pyrophosphate synthetase (GG...   116   2e-24   Saccharolobus solfataricus
gb:BC082488_2562723 Xenopus tropicalis MGC88978 protein, mRNA (c...   115   4e-24   
gb:AK012307_1156882 Mus musculus 11 days embryo whole body cDNA,...   115   4e-24   
gb:BC063635_1986299 Homo sapiens trans-prenyltransferase, mRNA (...   114   6e-24   
gb:BA000045_740491 Gloeobacter violaceus PCC 7421 DNA, complete ...   114   6e-24   
sp|Q50727|GGPP_MYCTU|GGPP_MYCTU Probable geranylgeranyl pyrophosphate synth...   114   6e-24   Mycobacterium tuberculosis
gb:AF513112_1807390 Abies grandis geranyl diphosphate synthase (...   114   8e-24   
gb:AY661708_1620420 Adonis palaestina geranylgeranyl diphosphate...   114   8e-24   
gb:AX066677_1460241 Sequence 259 from Patent WO0100805.               114   8e-24   
gb:AE017174_397085 Porphyromonas gingivalis W83 section 3 of 8 o...   114   8e-24   
pir|F71622|F71622 prenyl transferase PFB0130w - malaria parasite...   112   2e-23   
gb:AF513113_1807391 Abies grandis geranyl diphosphate synthase (...   112   2e-23   
gb:D85029_1674871 Arabidopsis thaliana mRNA for geranylgeranyl p...   111   5e-23   
pir|T02429|T02429 geranylgeranyl pyrophosphate synthase (EC 2.5....   111   5e-23   
gb:AE013304_291119 Methanosarcina mazei strain Goe1, section 86 ...   110   9e-23   
gb:AE017313_439600 Desulfovibrio vulgaris subsp. vulgaris str. H...   110   1e-22   
gb:AY544994_1612879 Taxus chinensis geranylgeranyl pyrophosphate...   109   2e-22   
gb:BA000035_715268 Corynebacterium efficiens YS-314 DNA, complet...   109   2e-22   
gb:AE017333_448435 Bacillus licheniformis DSM 13, complete genom...   108   3e-22   
gb:AE017277_425451 Bacillus cereus ATCC 10987, section 14 of 18 ...   108   3e-22   
gb:AP006627_564782 Bacillus clausii KSM-K16 DNA, complete genome.     108   4e-22   
gb:AE011126_269434 Methanosarcina acetivorans str. C2A, section ...   108   4e-22   
gb:AB126617_15494 Geobacillus stearothermophilus genomic DNA, cl...   108   4e-22   
sp|Q08291|ISPA_BACST|ISPA_BACST Geranyltranstransferase (EC 2.5.1.10) (Farn...   108   4e-22   
gb:BA000023_692739 Sulfolobus tokodaii str. 7 DNA, complete genome.   107   6e-22   
pir|S71230|S71230 geranylgeranyl pyrophosphate synthase (EC 2.5....   107   6e-22   
gb:ATU44877_1557022 Arabidopsis thaliana geranylgeranyl pyrophos...   107   7e-22   
gb:BA000016_674860 Clostridium perfringens str. 13 DNA, complete...   107   7e-22   
gb:AE013090_288945 Thermoanaerobacter tengcongensis MB4, section...   107   7e-22   
pir|G95139|G95139 geranyltranstransferase [imported] - Streptoco...   107   7e-22   
pir|S71231|S71231 geranylgeranyl pyrophosphate synthase (EC 2.5....   107   7e-22   
gb:AE017011_379048 Bacillus cereus ATCC 14579 section 14 of 18 o...   107   1e-21   
gb:CR522870_101544 Desulfotalea psychrophila LSv54 chromosome.        106   2e-21   
pir|F98007|F98007 geranyltranstransferase (EC 2.5.1.10) [importe...   105   3e-21   
pir|H64549|H64549 octaprenyl-diphosphate synthase - Helicobacter...   105   3e-21   
gb:BC085898_2109457 Rattus norvegicus cDNA clone MGC:94721 IMAGE...   104   6e-21   
gb:AE017037_384358 Bacillus anthracis str. Ames section 14 of 18...   104   6e-21   
gb:AB126620_15541 Geobacillus kaustophilus genomic DNA, clone:GK...   104   6e-21   
gb:AB016095_2691 Synechococcus elongatus gene for farnesyl, gera...   104   6e-21   
pir|T35403|T35403 probable polyprenyl synthatase - Streptomyces ...   104   6e-21   
pir|F69443|F69443 octaprenyl-diphosphate synthase (ispB) homolog...   103   8e-21   
gb:BX908798_831252 Parachlamydia-related symbiont UWE25, complet...   103   1e-20   
gb:BA000030_699538 Streptomyces avermitilis MA-4680 genomic DNA,...   103   1e-20   
gb:AE010637_265224 Fusobacterium nucleatum subsp. nucleatum ATCC...   103   1e-20   
gb:AB037907_5915 Kitasatospora griseola mevalonate pathway gene ...   103   1e-20   
gb:AL646068_547150 Ralstonia solanacearum GMI1000 chromosome, co...   102   2e-20   
pir|E83997|E83997 geranyltranstransferase BH2781 [imported] - Ba...   102   2e-20   
sp|P54383|ISPA_BACSU|ISPA_BACSU Geranyltranstransferase (EC 2.5.1.10) (Farn...   102   2e-20   
pir|D71959|D71959 probable octaprenyl-diphosphate synthase - Hel...   102   2e-20   
pir|AG1607|AG1607 geranyltranstransferase homolog lin1400 [impor...   102   2e-20   
pir|B81261|B81261 geranyltranstransferase (EC 2.5.1.10) Cj1644 [...   101   4e-20   
gb:BC039906_1982686 Homo sapiens chromosome 6 open reading frame...   101   5e-20   
pir|AC1245|AC1245 geranyltranstransferase homolog lmo1363 [impor...   101   5e-20   
gb:AL355586_1924010 Human DNA sequence from clone RP11-59I9 on c...   100   7e-20   
gb:AC007789_1536209 Oryza sativa BAC OSJNBa0049B20 genomic seque...   100   7e-20   
gb:BA000028_696264 Oceanobacillus iheyensis HTE831 DNA, complete...   100   7e-20   
gb:CP000025_879539 Campylobacter jejuni RM1221, complete genome.      100   9e-20   
gb:AE017326_443806 Listeria monocytogenes str. 4b F2365, section...   100   9e-20   
gb:CP000029_81687 Staphylococcus epidermidis RP62A, complete gen...   100   1e-19   
pir|F70973|F70973 probable transferase - Mycobacterium tuberculo...   100   1e-19   
pir|A64636|A64636 geranyltranstransferase - Helicobacter pylori ...   100   1e-19   
sp|O66126|ISPA_MICLU|ISPA_MICLU Geranyltranstransferase (EC 2.5.1.10) (Farn...   100   1e-19   
gb:AF254956_1893125 Homo sapiens candidate tumor suppressor prot...   100   2e-19   
gb:AE006583_220422 Streptococcus pyogenes M1 GAS, section 112 of...   100   2e-19   
gb:AB028667_1518114 Gentiana lutea GENGGPS mRNA for geranylgeran...    99   2e-19   
gb:AE012804_285744 Chlorobium tepidum TLS section 25 of 194 of t...    99   3e-19   
gb:CP000033_89571 Lactobacillus acidophilus NCFM, complete genome.     99   3e-19   
gb:AB055653_1521600 Lactuca indica var. laciniata LivlGGPPS mRNA...    99   3e-19   
gb:BX571856_781038 Staphylococcus aureus subsp. aureus strain MR...    99   3e-19   
gb:BA000033_711766 Staphylococcus aureus subsp. aureus MW2 DNA, ...    98   5e-19   
gb:BA000030_699015 Streptomyces avermitilis MA-4680 genomic DNA,...    98   5e-19   
gb:AE016950_365048 Enterococcus faecalis V583, section 4 of 11 o...    98   5e-19   
gb:AE016748_322852 Staphylococcus epidermidis ATCC 12228, sectio...    98   5e-19   
gb:AE015941_320686 Clostridium tetani E88, section 6 of 10 of th...    98   5e-19   
pir|D97156|D97156 probable geranylgeranyl pyrophosphate synthase...    98   5e-19   
gb:AE017204_404704 Lactobacillus johnsonii NCC 533, section 5 of...    98   6e-19   
gb:AE014159_304631 Streptococcus pyogenes MGAS315, section 24 of...    98   6e-19   
gb:AE010066_258973 Streptococcus pyogenes strain MGAS8232, secti...    98   6e-19   
pir|A89932|A89932 hypothetical protein ispA [imported] - Staphyl...    98   6e-19   
pir|C72242|C72242 hypothetical protein TM1535 - Thermotoga marit...    98   6e-19   
pir|G71878|G71878 geranyltranstransferase - Helicobacter pylori ...    98   6e-19   
sp|P17060|CRTE_RHOCA|CRTE_RHOCA Geranylgeranyl pyrophosphate synthetase (EC...    98   6e-19   
gb:BC075908_2558798 Danio rerio zgc:92156, mRNA (cDNA clone MGC:...    97   8e-19   
gb:CP000023_875098 Streptococcus thermophilus LMG 18311, complet...    97   8e-19   
gb:CP000003_861176 Streptococcus pyogenes MGAS10394, complete ge...    97   8e-19   
gb:BX248345_760772 Mycobacterium bovis subsp. bovis AF2122/97 co...    97   8e-19   
gb:AY596297_634317 Haloarcula marismortui ATCC 43049 chromosome ...    97   8e-19   
gb:AE009799_255823 Pyrobaculum aerophilum strain IM2 section 54 ...    97   8e-19   
gb:CP000046_91686 Staphylococcus aureus subsp. aureus COL, compl...    97   8e-19   
gb:AE000516_23597 Mycobacterium tuberculosis CDC1551, complete g...    97   8e-19   
pir|A86732|A86732 geranyltranstransferase (EC 2.5.1.10) [importe...    97   8e-19   
gb:AC007504_1535850 Arabidopsis thaliana chromosome I BAC F13F21...    97   1e-18   
gb:AF408846_507930 Xanthobacter sp. Py2 farnesyl diphosphate syn...    97   1e-18   
gb:AB083108_10440 Streptomyces argenteolus gene for farnesyl dip...    97   1e-18   
gb:BX640419_807200 Bordetella pertussis strain Tohama I, complet...    96   2e-18   
gb:AE014291_309189 Brucella suis 1330 chromosome I, complete seq...    96   2e-18   
gb:CR543861_104775 Acinetobacter sp. ADP1 complete genome.             96   2e-18   
gb:CP000020_870888 Vibrio fischeri ES114 chromosome I, complete ...    96   2e-18   
gb:BX842646_823232 Bdellovibrio bacteriovorus complete genome, s...    96   2e-18   
gb:AE013598_297000 Xanthomonas oryzae pv. oryzae KACC10331, comp...    96   2e-18   
pir|AI3285|AI3285 geranyltranstransferase (EC 2.5.1.10) [importe...    96   2e-18   
gb:BX640442_814562 Bordetella bronchiseptica strain RB50, comple...    95   4e-18   
gb:BX571872_788741 Photorhabdus luminescens subsp. laumondii TTO...    95   4e-18   
gb:AY671989_639610 Uncultured proteobacterium eBACred25D05, comp...    95   4e-18   
gb:BX294136_766109 Pirellula sp. strain 1 complete genome; segme...    95   5e-18   
gb:AY234384S1_601132 Rubrivivax gelatinosus strain S1 5' region ...    95   5e-18   
pir|T50879|T50879 phytoene synthase [imported] - Rubrivivax gela...    95   5e-18   
gb:BX897700_829416 Bartonella quintana str. Toulouse, complete g...    94   7e-18   
gb:AE014902_312994 Streptococcus mutans UA159 section 50 of 185 ...    94   7e-18   
gb:SAG766846_170071 Streptococcus agalactiae NEM316 complete gen...    94   7e-18   
gb:CR378665_94196 Photobacterium profundum SS9; segment 3/12.          94   7e-18   
pir|G72410|G72410 geranyltranstransferase - Thermotoga maritima ...    94   7e-18   
gb:AB000835_1508437 Arabidopsis thaliana gene for geranyl gerany...    94   9e-18   
gb:AY714867_1190377 Uncultured archaeon GZfos37B2 clone GZfos37B...    94   9e-18   
gb:AY714845_1189524 Uncultured archaeon GZfos27B6 clone GZfos27B...    94   9e-18   
gb:AE017145_390087 Helicobacter hepaticus ATCC 51449 section 2 o...    94   9e-18   
gb:BX897699_828106 Bartonella henselae strain Houston-1, complet...    94   1e-17   
gb:BX640430_810710 Bordetella parapertussis strain 12822, comple...    94   1e-17   
gb:BA000012_668887 Mesorhizobium loti MAFF303099 DNA, complete g...    94   1e-17   
gb:ATHGGPS_1553201 Arabidopsis thaliana geranylgeranyl pyrophosp...    93   1e-17   
gb:BA000030_700883 Streptomyces avermitilis MA-4680 genomic DNA,...    93   1e-17   
gb:AE017340_457891 Idiomarina loihiensis L2TR, complete genome.        92   2e-17   
gb:AE016858_350153 Pseudomonas syringae pv. tomato str. DC3000 s...    92   2e-17   
pir|F84365|F84365 probable isopentenyl pyrophosphate isomerase [...    92   2e-17   
gb:BX842647_823558 Bdellovibrio bacteriovorus complete genome, s...    92   4e-17   
gb:BA000030_700892 Streptomyces avermitilis MA-4680 genomic DNA,...    92   4e-17   
gb:AF203881_488189 Zymomonas mobilis strain ZM4 clone 43F4, comp...    91   7e-17   
gb:AE011916_277678 Xanthomonas axonopodis pv. citri str. 306, se...    91   7e-17   
gb:AB076662_10105 Pantoea agglomerans pv. milletiae crtE, crtX, ...    91   7e-17   
sp|P45204|ISPA_HAEIN|ISPA_HAEIN Geranyltranstransferase (EC 2.5.1.10) (Farn...    91   7e-17   
gb:AE012371_281828 Xanthomonas campestris pv. campestris str. AT...    91   9e-17   
gb:CR555306_107918 Azoarcus sp. EbN1 complete genome.                  91   9e-17   
pir|F97685|F97685 geranyltransferase (AF203881) [imported] - Agr...    91   9e-17   
pir|AH2910|AH2910 geranyltranstransferase [imported] - Agrobacte...    91   9e-17   
gb:AY166713_594231 Pantoea stewartii zeaxanthin-diglucoside bios...    90   1e-16   
gb:AP006840_569033 Symbiobacterium thermophilum DNA, complete ge...    90   1e-16   
gb:AE015598_315926 Shewanella oneidensis MR-1 section 147 of 457...    90   1e-16   
gb:SCO939123_178922 Streptomyces coelicolor A3(2) complete genom...    90   1e-16   
gb:AY659048_2148058 Synthetic construct Peudomonas aeruginosa cl...    90   2e-16   
pir|F83139|F83139 geranyltranstransferase PA4043 [imported] - Ps...    90   2e-16   
gb:BX572594_800140 Rhodopseudomonas palustris CGA009 complete ge...    89   2e-16   
gb:AE017251_416581 Treponema denticola ATCC 35405, section 6 of ...    89   2e-16   
gb:AE016756_324579 Escherichia coli CFT073 section 2 of 18 of th...    89   2e-16   
pir|S49625|S49625 geranylgeranyl pyrophosphate synthase - Rhodob...    89   2e-16   
sp|P22939|ISPA_ECOLI|ISPA_ECOLI Geranyltranstransferase (EC 2.5.1.10) (Farn...    89   2e-16   
sp|P21684|CRTE_PANAN|CRTE_PANAN Geranylgeranyl pyrophosphate synthetase (EC...    89   2e-16   
gb:CP000011_867750 Burkholderia mallei ATCC 23344 chromosome 2, ...    89   3e-16   
gb:BX571966_795026 Burkholderia pseudomallei strain K96243, chro...    89   4e-16   
gb:BA000031_706147 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    89   4e-16   
gb:AE016776_329969 Pseudomonas putida KT2440 section 3 of 21 of ...    89   4e-16   
gb:AE005674_69940 Shigella flexneri 2a str. 301, complete genome...    89   4e-16   
pir|AG0554|AG0554 geranyltranstransferase [imported] - Salmonell...    89   4e-16   
sp|P54976|CRTE_RHOSH|CRTE_RHOSH Geranylgeranyl pyrophosphate synthetase (EC...    89   4e-16   
gb:AY458639_619483 Uncultured bacterium 442 clone EBAC000-63A02 ...    88   5e-16   
gb:AE008919_246192 Uncultured proteobacterium BAC EBAC000-65D09 ...    88   5e-16   
gb:AE008692_240593 Zymomonas mobilis subsp. mobilis ZM4, complet...    88   5e-16   
gb:SCHISTRE_1708474 S.cerevisiae genes for histone H2A and H2B, ...    88   6e-16   
gb:BX571661_778961 Wolinella succinogenes, complete genome; segm...    88   6e-16   
gb:AE008920_246258 Uncultured proteobacterium clone EBAC000-29C0...    88   6e-16   
pir|C90688|C90688 geranyltranstransferase [imported] - Escherich...    88   6e-16   
gb:BX248337_758372 Mycobacterium bovis subsp. bovis AF2122/97 co...    87   8e-16   
gb:AE016798_335097 Vibrio vulnificus CMCP6 chromosome I section ...    87   8e-16   
pir|H70600|H70600 probable transferase - Mycobacterium tuberculo...    87   8e-16   
gb:AF528191_519391 Thiocapsa roseopersicina strain BBS BchB (bch...    87   1e-15   
gb:AE017282_427614 Methylococcus capsulatus str. Bath, complete ...    87   1e-15   
gb:AE008921_246313 Uncultured proteobacterium clone EBAC000-60D0...    87   1e-15   
gb:BX950851_839879 Erwinia carotovora subsp. atroseptica SCRI104...    87   1e-15   
gb:AJ749949_532019 Francisella tularensis subsp. tularensis comp...    87   1e-15   
gb:BA000037_721695 Vibrio vulnificus YJ016 DNA, chromosome I, co...    86   2e-15   
gb:SME591793_187285 Sinorhizobium meliloti 1021 complete chromos...    86   2e-15   
gb:AE012558_284903 Xylella fastidiosa Temecula1, section 6 of 9 ...    85   4e-15   
gb:AE017283_430521 Propionibacterium acnes KPA171202, complete g...    85   5e-15   
gb:AE017154_392747 Haemophilus ducreyi strain 35000HP section 4 ...    85   5e-15   
gb:REU80928_163181 Rhizobium etli strain CFN42 symbiotic plasmid...    85   5e-15   
gb:BA000012_670965 Mesorhizobium loti MAFF303099 DNA, complete g...    84   7e-15   
gb:MLO672112_148426 Mesorhizobium loti R7A symbiosis island; seg...    84   7e-15   
gb:AE017354_460678 Legionella pneumophila subsp. pneumophila str...    84   9e-15   
gb:AE016919_357652 Chromobacterium violaceum ATCC 12472 section ...    84   9e-15   
gb:CR628336_112395 Legionella pneumophila str. Paris complete ge...    84   9e-15   
gb:AE000516_21037 Mycobacterium tuberculosis CDC1551, complete g...    84   9e-15   
gb:BX936398_835585 Yersinia pseudotuberculosis IP32953 genome, c...    84   1e-14   
gb:CR628337_115454 Legionella pneumophila str. Lens complete gen...    84   1e-14   
gb:AE004969_61385 Neisseria gonorrhoeae FA 1090, complete genome.      84   1e-14   
pir|S32168|S32168 dimethylallyltranstransferase (EC 2.5.1.1) - M...    84   1e-14   
gb:AE014296_1137277 Drosophila melanogaster chromosome 3L, compl...    83   2e-14   
gb:AE016827_342689 Mannheimia succiniciproducens MBEL55E, comple...    83   2e-14   
pir|F81217|F81217 geranyltranstransferase NMB0261 [imported] - N...    83   2e-14   
sp|P55539|ISPA_RHISN|ISPA_RHISN Probable geranyltranstransferase (EC 2.5.1....    83   2e-14   
gb:BA000021_686891 Wigglesworthia glossinidia endosymbiont of Gl...    83   2e-14   
gb:AY150801_592605 Rhodospirillum rubrum strain S1 carotenoid ge...    83   2e-14   
gb:AE017261_419865 Picrophilus torridus DSM 9790, complete genome.     83   2e-14   
pir|E81796|E81796 geranyltranstransferase (EC 2.5.1.10) NMA2226 ...    83   2e-14   
gb:AE016822_340595 Leifsonia xyli subsp. xyli str. CTCB07, compl...    82   3e-14   
pir|D82778|D82778 geranyltranstransferase (farnesyl-diphosphate ...    82   3e-14   
gb:AF182374_486275 Bradyrhizobium sp. ORS278 photosynthetic gene...    82   3e-14   
pir|AH0385|AH0385 geranyltranstransferase (EC 2.5.1.10) [importe...    82   4e-14   
gb:AE017241_414551 Mycobacterium avium subsp. paratuberculosis s...    81   7e-14   
pir|D87505|D87505 geranyltranstransferase [imported] - Caulobact...    81   7e-14   
pir|A82267|A82267 geranyltranstransferase VC0890 [imported] - Vi...    81   7e-14   
pir|C71295|C71295 probable octaprenyl-diphosphate synthase - syp...    81   7e-14   
pir|A70139|A70139 octaprenyl-diphosphate synthase (ispB) homolog...    81   7e-14   
pir|S52584|S52584 crtE protein - Erwinia herbicola>gb:ERWCRTA_13...    81   7e-14   
gb:BX572597_801133 Rhodopseudomonas palustris CGA009 complete ge...    80   1e-13   
gb:BX321860_773488 Nitrosomonas europaea ATCC 19718, complete ge...    80   1e-13   
gb:AE006088_215421 Pasteurella multocida subsp. multocida str. P...    80   2e-13   
gb:CP000013_869550 Borrelia garinii PBi, complete genome.              79   2e-13   
gb:BA000040_730408 Bradyrhizobium japonicum USDA 110 DNA, comple...    79   3e-13   
sp|Q45220|ISPA_BRAJA|ISPA_BRAJA Probable geranyltranstransferase (EC 2.5.1....    79   3e-13   
gb:BX248358_762883 Corynebacterium diphtheriae gravis NCTC13129,...    79   4e-13   
gb:AB183750_16617 Streptomyces sp. KO-3988 p450, syn-cdps, ggdps...    79   4e-13   
sp|P57537|ISPA_BUCAI|ISPA_BUCAI Geranyltranstransferase (EC 2.5.1.10) (Farn...    78   5e-13   
gb:AF272737_494498 Streptomyces griseus strain IFO13350 carotino...    78   6e-13   
gb:AY705710_642894 Rhodococcus erythropolis geranylgeranyl pyrop...    77   8e-13   
gb:AB113568_13830 Actinoplanes sp. A40644 mevalonate pathway gen...    77   8e-13   
gb:AE017234_412616 Mycobacterium avium subsp. paratuberculosis s...    76   2e-12   
sp|Q92236|GGPP_GIBFU|GGPP_GIBFU Geranylgeranyl pyrophosphate synthetase (GG...    75   4e-12   
gb:AF324662_1786374 Arabidopsis thaliana AT4g38460 (AT4g38460/F2...    75   5e-12   
gb:BA000011_664706 Thermoplasma volcanium GSS1 DNA, complete gen...    75   5e-12   
gb:AF104994_479438 Streptomyces coelicolor A3(2) periplasmic bin...    75   5e-12   
pir|T05674|T05674 farnesyltranstransferase homolog F20M13.20 - A...    75   5e-12   
sp|O66952|ISPA_AQUAE|ISPA_AQUAE Geranyltranstransferase (EC 2.5.1.10) (Farn...    75   5e-12   
gb:BX927154_833707 Corynebacterium glutamicum ATCC 13032, IS fin...    74   7e-12   
gb:BA000036_719899 Corynebacterium glutamicum ATCC 13032 DNA, co...    74   7e-12   
gb:AB028044_4580 Rhodobacter sphaeroides gene for farnesyl dipho...    74   7e-12   
pir|T51127|T51127 GGPP synthase [imported] - Brevibacterium line...    74   7e-12   
gb:AX066665_1460235 Sequence 247 from Patent WO0100805.                74   9e-12   
gb:BA000035_716850 Corynebacterium efficiens YS-314 DNA, complet...    74   9e-12   


>gb:AB104727_1526539 Arabidopsis thaliana At-SPS2 mRNA for solanesyl
            diphosphate synthase, complete cds.>gb:AB188498_1529362
            Arabidopsis thaliana SPS2 mRNA solanesyl diphosphate
            synthase 2, complete cds.
          Length = 417

 Score =  484 bits (1247), Expect = e-135
 Identities = 262/424 (61%), Positives = 311/424 (73%), Gaps = 5/424 (1%)
 Frame = -1

Query: 1423 MSAAYHNLEFGRTRLNSAACGCSSYSSIDRHSANKFLLRNVKK-----GGGFRARRLLCC 1259
            M  +  N++ G + L+ +   CSS S+     + +FL  N  K     GG      L+  
Sbjct: 1    MMMSCRNIDLGTSVLDHS---CSSSST-----SRRFLFGNSSKTVCMIGGRSCVGNLVFL 52

Query: 1258 RREIGRCHVFSTKAPESFLNGVTPASSSPMLDLKKDSGSPISVASLFEVVTDDLLTLNKN 1079
            RR++  C     K+ E+ L        + ML+L+++S  PIS+ +LFEVV DDL  LN N
Sbjct: 53   RRDLATCRAVPAKSKENSLVNGIGQDQTVMLNLRQESRKPISLETLFEVVADDLQRLNDN 112

Query: 1078 LQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIE 899
            L SIVGAENPVL+SAAEQIFSAGGKRMRP LVFLVSR           T EHRRL EIIE
Sbjct: 113  LLSIVGAENPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAGLKELTVEHRRLGEIIE 172

Query: 898  MIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKL 719
            MIHTASLIHDDVLDESDMRRG+ETVH+++GTRVAVLAGDFMFAQ+SWYLANLEN+EVIKL
Sbjct: 173  MIHTASLIHDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKL 232

Query: 718  ISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISE 539
            ISQVIKDFASGEIKQASSLFDCDV ++DY++KSYYKTASL+AASTKGAAIFS V+S ++E
Sbjct: 233  ISQVIKDFASGEIKQASSLFDCDVKLDDYMLKSYYKTASLVAASTKGAAIFSKVESKVAE 292

Query: 538  QMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDII 359
            QMYQ+G+NLGLSFQ+VDDILDFTQS EQLGKPA +DLAKGN+TAPVIFALE EP+LR+II
Sbjct: 293  QMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPAANDLAKGNITAPVIFALENEPRLREII 352

Query: 358  ESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYN 179
            ESEFC           V+  GGI             A++NL CLP S FR A E+MV +N
Sbjct: 353  ESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCLPRSGFRSALEDMVMFN 412

Query: 178  LERV 167
            LER+
Sbjct: 413  LERI 416



>gb:AB071514_1522883 Arabidopsis thaliana At SPS mRNA for solanesyl
            diphosphate synthase, complete cds.>gb:AB188497_1529361
            Arabidopsis thaliana SPS1 mRNA solanesyl diphosphate
            synthase 1, complete cds.
          Length = 406

 Score =  481 bits (1239), Expect = e-134
 Identities = 264/420 (62%), Positives = 307/420 (73%), Gaps = 1/420 (0%)
 Frame = -1

Query: 1423 MSAAYHNLEFGRTRLNSAACGCSSYSSIDRHSANKFLLRNVKKGGGFRARRLLCCRREIG 1244
            M  +  N++ G T + +  CG   + S+ + +  KF   N   GG             +G
Sbjct: 1    MMTSCRNIDLG-TMMMACGCGRRQFPSLAK-TVCKFTSSNRSYGG------------LVG 46

Query: 1243 RCHVFSTKAPE-SFLNGVTPASSSPMLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSI 1067
             C    TK+ E S LNG+   S +   DLK++S  PIS+ +LFE+V  DL TLN NL SI
Sbjct: 47   SCKAVPTKSKEISLLNGIGQ-SQTVSFDLKQESKQPISLVTLFELVAVDLQTLNDNLLSI 105

Query: 1066 VGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHT 887
            VGAENPVL+SAAEQIF AGGKRMRP LVFLVS            T EHRRLAEIIEMIHT
Sbjct: 106  VGAENPVLISAAEQIFGAGGKRMRPGLVFLVSHATAELAGLKELTTEHRRLAEIIEMIHT 165

Query: 886  ASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQV 707
            ASLIHDDVLDESDMRRGKETVH+++GTRVAVLAGDFMFAQ+SWYLANLEN+EVIKLISQV
Sbjct: 166  ASLIHDDVLDESDMRRGKETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQV 225

Query: 706  IKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQ 527
            IKDFASGEIKQASSLFDCD  +++YL+KS+YKTASL+AASTKGAAIFS V+  ++EQMY+
Sbjct: 226  IKDFASGEIKQASSLFDCDTKLDEYLLKSFYKTASLVAASTKGAAIFSRVEPDVTEQMYE 285

Query: 526  YGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEF 347
            +G+NLGLSFQIVDDILDFTQS EQLGKPAGSDLAKGNLTAPVIFALE EP+LR+IIESEF
Sbjct: 286  FGKNLGLSFQIVDDILDFTQSTEQLGKPAGSDLAKGNLTAPVIFALEREPRLREIIESEF 345

Query: 346  CXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
            C           V + GGI             AI+NL+CLP S FR A E+MV YNLER+
Sbjct: 346  CEAGSLEEAIEAVTKGGGIKRAQELAREKADDAIKNLQCLPRSGFRSALEDMVLYNLERI 405



>pir|C86306|C86306 prenyl transferase homolog [imported] - Arabidopsis
            thaliana>gb:AE005172_890680 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007651_1536025 Arabidopsis thaliana
            chromosome I BAC F20D23 genomic sequence, complete
            sequence.
          Length = 379

 Score =  479 bits (1233), Expect = e-134
 Identities = 250/376 (66%), Positives = 290/376 (77%)
 Frame = -1

Query: 1294 GGGFRARRLLCCRREIGRCHVFSTKAPESFLNGVTPASSSPMLDLKKDSGSPISVASLFE 1115
            GG      L+  RR++  C     K+ E+ L        + ML+L+++S  PIS+ +LFE
Sbjct: 3    GGRSCVGNLVFLRRDLATCRAVPAKSKENSLVNGIGQDQTVMLNLRQESRKPISLETLFE 62

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            VV DDL  LN NL SIVGAENPVL+SAAEQIFSAGGKRMRP LVFLVSR           
Sbjct: 63   VVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAGLKEL 122

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
            T EHRRL EIIEMIHTASLIHDDVLDESDMRRG+ETVH+++GTRVAVLAGDFMFAQ+SWY
Sbjct: 123  TVEHRRLGEIIEMIHTASLIHDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQASWY 182

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            LANLEN+EVIKLISQVIKDFASGEIKQASSLFDCDV ++DY++KSYYKTASL+AASTKGA
Sbjct: 183  LANLENLEVIKLISQVIKDFASGEIKQASSLFDCDVKLDDYMLKSYYKTASLVAASTKGA 242

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
            AIFS V+S ++EQMYQ+G+NLGLSFQ+VDDILDFTQS EQLGKPA +DLAKGN+TAPVIF
Sbjct: 243  AIFSKVESKVAEQMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPAANDLAKGNITAPVIF 302

Query: 394  ALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSP 215
            ALE EP+LR+IIESEFC           V+  GGI             A++NL CLP S 
Sbjct: 303  ALENEPRLREIIESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCLPRSG 362

Query: 214  FRVAXEEMVQYNLERV 167
            FR A E+MV +NLER+
Sbjct: 363  FRSALEDMVMFNLERI 378



>pir|F96813|F96813 hypothetical protein T30F21.15 [imported] -
            Arabidopsis thaliana>gb:AE005173_895370 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC007260_1535712 Arabidopsis thaliana
            chromosome I BAC T30F21 genomic sequence, complete
            sequence.
          Length = 390

 Score =  468 bits (1203), Expect = e-130
 Identities = 243/339 (71%), Positives = 274/339 (80%)
 Frame = -1

Query: 1183 SSSPMLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGK 1004
            S +   DLK++S  PIS+ +LFE+V  DL TLN NL SIVGAENPVL+SAAEQIF AGGK
Sbjct: 51   SQTVSFDLKQESKQPISLVTLFELVAVDLQTLNDNLLSIVGAENPVLISAAEQIFGAGGK 110

Query: 1003 RMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETV 824
            RMRP LVFLVS            T EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETV
Sbjct: 111  RMRPGLVFLVSHATAELAGLKELTTEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETV 170

Query: 823  HQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVG 644
            H+++GTRVAVLAGDFMFAQ+SWYLANLEN+EVIKLISQVIKDFASGEIKQASSLFDCD  
Sbjct: 171  HELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDTK 230

Query: 643  MEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQS 464
            +++YL+KS+YKTASL+AASTKGAAIFS V+  ++EQMY++G+NLGLSFQIVDDILDFTQS
Sbjct: 231  LDEYLLKSFYKTASLVAASTKGAAIFSRVEPDVTEQMYEFGKNLGLSFQIVDDILDFTQS 290

Query: 463  AEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXX 284
             EQLGKPAGSDLAKGNLTAPVIFALE EP+LR+IIESEFC           V + GGI  
Sbjct: 291  TEQLGKPAGSDLAKGNLTAPVIFALEREPRLREIIESEFCEAGSLEEAIEAVTKGGGIKR 350

Query: 283  XXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                       AI+NL+CLP S FR A E+MV YNLER+
Sbjct: 351  AQELAREKADDAIKNLQCLPRSGFRSALEDMVLYNLERI 389



>gb:AC098573_1736770 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1651_G11, complete
            sequence.>gb:AC134929_1741923 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone OSJNBb0035N21,
            complete sequence.
          Length = 403

 Score =  461 bits (1185), Expect = e-128
 Identities = 237/324 (73%), Positives = 268/324 (82%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            ISV+SL EVV+DDLL LN NL+S+VGAENPVL+SAAEQIF AGGKR+RPALVFLVSR   
Sbjct: 79   ISVSSLLEVVSDDLLKLNNNLKSLVGAENPVLVSAAEQIFGAGGKRLRPALVFLVSRATA 138

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                    T EH+RLAEIIEMIHTASLIHDDV+D+S MRRGKET+HQ+YGTRVAVLAGDF
Sbjct: 139  ELAGLLELTTEHQRLAEIIEMIHTASLIHDDVIDDSGMRRGKETIHQLYGTRVAVLAGDF 198

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            MFAQSSW+LANLENIEVIKLISQVIKDFASGEIKQAS+LFDCDV ++DYL+KSYYKTASL
Sbjct: 199  MFAQSSWFLANLENIEVIKLISQVIKDFASGEIKQASTLFDCDVTLDDYLLKSYYKTASL 258

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            +A+ST+ AAIFSGV + I EQMY+YGRNLGLSFQ+VDDILDFTQSAEQLGKPAGSDLAKG
Sbjct: 259  LASSTRSAAIFSGVSTTICEQMYEYGRNLGLSFQVVDDILDFTQSAEQLGKPAGSDLAKG 318

Query: 418  NLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQN 239
            NLTAPVIFAL+ EPKLR+II+SEF            V R GGI             A+QN
Sbjct: 319  NLTAPVIFALQDEPKLREIIDSEFSESDSLATAIDLVHRSGGIRRAQELAKEKGDLALQN 378

Query: 238  LECLPPSPFRVAXEEMVQYNLERV 167
            L+CLP S FR   E +V+YNL+R+
Sbjct: 379  LQCLPKSQFRSTLENVVKYNLQRI 402



>gb:BT004246_1637328 Arabidopsis thaliana clone RAFL15-37-G01 (R50196)
            putative geranyl diphosphate synthase (GPPS)
            (dimethylallyltransferase) (At1g17050) mRNA, partial cds.
          Length = 322

 Score =  455 bits (1170), Expect = e-126
 Identities = 234/320 (73%), Positives = 263/320 (82%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            +LFEVV DDL  LN NL SIVGAENPVL+SAAEQIFSAGGKRMRP LVFLVSR       
Sbjct: 2    TLFEVVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAG 61

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                T EHRRL EIIEMIHTASLIHDDVLDESDMRRG+ETVH+++GTRVAVLAGDFMFAQ
Sbjct: 62   LKELTVEHRRLGEIIEMIHTASLIHDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQ 121

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            +SWYLANLEN+EVIKLISQVIKDFASGEIKQASSLFDCDV ++DY++KSYYKTASL+AAS
Sbjct: 122  ASWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDVKLDDYMLKSYYKTASLVAAS 181

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            TKGAAIFS V+S ++EQMYQ+G+NLGLSFQ+VDDILDFTQS EQLGKPA +DLAKGN+TA
Sbjct: 182  TKGAAIFSKVESKVAEQMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPAANDLAKGNITA 241

Query: 406  PVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECL 227
            PVIFALE EP+LR+IIESEFC           V+  GGI             A++NL CL
Sbjct: 242  PVIFALENEPRLREIIESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCL 301

Query: 226  PPSPFRVAXEEMVQYNLERV 167
            P S FR A E+MV +NLER+
Sbjct: 302  PRSGFRSALEDMVMFNLERI 321



>gb:BA000039_727541 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 323

 Score =  325 bits (833), Expect = 2e-87
 Identities = 171/323 (52%), Positives = 219/323 (67%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            SV SLF  V  DL  L +NL++++GA++ VL +AAE +F+A GKR+RPA+VFLVSR    
Sbjct: 3    SVTSLFSPVEADLCVLTENLKALIGAQHAVLSAAAEHLFAASGKRIRPAIVFLVSRATLP 62

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                      H RLAEI EMIHTASL HDDV+D++ +RRG  TV+ ++G RVA+ AGDF+
Sbjct: 63   DQGIT---PRHCRLAEITEMIHTASLFHDDVVDQAQLRRGVPTVNSVFGNRVAIQAGDFL 119

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
            FAQ+SWYLA+L+N++V+KL+SQVIKDFA GEI+Q  + FD  + ++DYL+K+YYKTASLI
Sbjct: 120  FAQASWYLADLDNLQVVKLLSQVIKDFAEGEIRQGFNRFDTSITLDDYLLKTYYKTASLI 179

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            A S K AA+ S       E MY YG+NLGL+FQIVDDILDFT+S  +LGKPAGSDL  GN
Sbjct: 180  ANSAKAAAVLSEAPPETIEAMYTYGKNLGLAFQIVDDILDFTRSTAELGKPAGSDLRDGN 239

Query: 415  LTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            LTAPV+FAL   P L  +IE EF            V++ G I             A+  L
Sbjct: 240  LTAPVLFALPKAPYLHTLIEREFSEEGDLETALNLVRQSGAIEDARNLAKEYAQAALPAL 299

Query: 235  ECLPPSPFRVAXEEMVQYNLERV 167
            E LPPS  R A  ++  Y LER+
Sbjct: 300  EVLPPSEPRQALSQLTDYVLERL 322



>sp|P31171|PREA_CYAPA Prenyl transferase (EC
            2.5.1.-).>pir|A40433|A40433 prephytoene pyrophosphatase
            dehydrogenase (crtE) homolog - Cyanophora
            paradoxa>pir|T06874|T06874 probable prenyl transferase
            (EC 2.5.1.-) - Cyanophora paradoxa
            cyanelle>gb:CPACYNADA_1648515 Cyanophora paradoxa
            cyanelle quinolinate synthetase (nadA) and prephytoene
            pyrophosphate dehydrogenase (crtE) genes, complete cds,
            and Ser-tRNA gene.>gb:CPU30821_1648785 Cyanophora
            paradoxa cyanelle, complete genome.
          Length = 323

 Score =  318 bits (814), Expect = 3e-85
 Identities = 167/323 (51%), Positives = 224/323 (69%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            S+ ++   V ++L  L KNL+ +VG+ +P+L +A+E +FSA GKR RPA+V L+S+    
Sbjct: 3    SITNILAPVENELDLLTKNLKKLVGSGHPILSAASEHLFSASGKRPRPAIVLLISKATME 62

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                      HRRLAEI E+IHTASL+HDD+LDESD+RRG  TVH  +GT++A+LAGDF+
Sbjct: 63   NEIITS---RHRRLAEITEIIHTASLVHDDILDESDVRRGIPTVHSDFGTKIAILAGDFL 119

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
            FAQSSWYLANLE++EV+KLIS+VI DFA GEI++  + F  D+ +E+YL KS+YKTASL+
Sbjct: 120  FAQSSWYLANLESLEVVKLISKVITDFAEGEIRRGLNQFKVDLTLEEYLEKSFYKTASLL 179

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            AAS+K AA+ S VD  ++  +Y YGR+LGL+FQIVDDILDFT S E+LGKP+ SDL KGN
Sbjct: 180  AASSKAAALLSHVDLTVANDLYNYGRHLGLAFQIVDDILDFTSSTEELGKPSCSDLKKGN 239

Query: 415  LTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            LTAPV+FALE   +L  +I+ +F            V+    I             AIQ L
Sbjct: 240  LTAPVLFALEQNSELIPLIQRQFSEPKDFEYTLQIVEETKAIEKTRELAMEHAQVAIQCL 299

Query: 235  ECLPPSPFRVAXEEMVQYNLERV 167
            E LPPS  + A + + +Y LER+
Sbjct: 300  ENLPPSSSKEALKLITKYVLERL 322



>pir|AH1818|AH1818 solanesyl diphosphate synthase [imported] - Nostoc
            sp.  (strain PCC 7120)>gb:BA000019_681088 Nostoc sp. PCC
            7120 DNA, complete genome.
          Length = 323

 Score =  315 bits (806), Expect = 2e-84
 Identities = 162/320 (50%), Positives = 214/320 (66%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            SLF  V  DL  L  NL+ +VG  +P+L +AAE +F AGGKR+RPA+V L+SR       
Sbjct: 6    SLFTPVEADLRILADNLKQLVGNRHPILFAAAEHLFGAGGKRIRPAIVLLISRATMLDQG 65

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                   HRRLAEI EMIHTASL+HDDV+DES++RRG  TVH ++G R+A+LAGDF+FAQ
Sbjct: 66   IT---PRHRRLAEITEMIHTASLVHDDVVDESEVRRGVPTVHSLFGNRIAILAGDFLFAQ 122

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            SSWYLANL+N++V+KL+S+VI D A+GEI+Q  + FD  + +E Y+ KSYYKTASL+A S
Sbjct: 123  SSWYLANLDNLQVVKLLSEVIMDLATGEIQQGLNRFDASISIETYIEKSYYKTASLVANS 182

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            +K A + S V    +E +Y YGR+LG++FQIVDDILDFT + + LGKP GSDL  GNLTA
Sbjct: 183  SKAAGLLSEVSPETAEHLYAYGRHLGIAFQIVDDILDFTSTTDTLGKPVGSDLKSGNLTA 242

Query: 406  PVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECL 227
            PV+FAL  +P L  +IE EF            ++   GI             AI++L  L
Sbjct: 243  PVLFALAEKPYLEVLIEREFAQEGDLEQALELIQDSQGIQQSRELAAHHTKLAIEHLATL 302

Query: 226  PPSPFRVAXEEMVQYNLERV 167
            PPS    A  ++ +Y + R+
Sbjct: 303  PPSESHQALIKIAEYAISRL 322



>sp|P72580|PREA_SYNY3 Prenyl transferase (EC
            2.5.1.-).>pir|S76966|S76966 geranylgeranyl pyrophosphate
            synthase crtE homolog - Synechocystis sp. (strain PCC
            6803)>gb:BA000022_687358 Synechocystis sp. PCC 6803 DNA,
            complete genome.
          Length = 323

 Score =  313 bits (803), Expect = 5e-84
 Identities = 169/324 (52%), Positives = 213/324 (65%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            IS  SLF  V  DL  L  NL+ +VGA +P+L +AAE +F AGGKR+RPA+V LVSR   
Sbjct: 2    ISTTSLFAPVDQDLRLLTDNLKRLVGARHPILGAAAEHLFEAGGKRVRPAIVLLVSRATL 61

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       HRRLAEI EMIHTASL+HDDV+DE+D+RR   TV+ ++  RVAVLAGDF
Sbjct: 62   LDQELTA---RHRRLAEITEMIHTASLVHDDVVDEADLRRNVPTVNSLFDNRVAVLAGDF 118

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +FAQSSWYLANL+N+EV+KL+S+VI+DFA GEI Q+ + FD D  +E YL KSY+KTASL
Sbjct: 119  LFAQSSWYLANLDNLEVVKLLSEVIRDFAEGEILQSINRFDTDTDLETYLEKSYFKTASL 178

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IA S K A + S     + + +Y+YG++LGL+FQIVDDILDFT   E LGKPAGSDL  G
Sbjct: 179  IANSAKAAGVLSDAPRDVCDHLYEYGKHLGLAFQIVDDILDFTSPTEVLGKPAGSDLISG 238

Query: 418  NLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQN 239
            N+TAP +FA+E  P L  +IE EF            V++  GI             A Q+
Sbjct: 239  NITAPALFAMEKYPLLGKLIEREFAQAGDLEQALELVEQGDGIRRSRELAANQAQLARQH 298

Query: 238  LECLPPSPFRVAXEEMVQYNLERV 167
            L  L  S  R +  E+V Y L R+
Sbjct: 299  LSVLEMSAPRESLLELVDYVLGRL 322



>gb:AP008231_581436 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 323

 Score =  302 bits (774), Expect = 1e-80
 Identities = 161/323 (49%), Positives = 207/323 (64%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            SV SLF  V  DL  L   L+ ++GA +P+L +AA+ +F AGGKR+RPA+V L+SR    
Sbjct: 3    SVTSLFAPVEADLQLLTDTLKQLIGARHPILYAAADHLFGAGGKRLRPAVVLLLSRATMP 62

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                      HRRLAEI EMIHTASL+HDDV+DES +RRG  TVH  +  RVAVLAGDF+
Sbjct: 63   GQEIT---PRHRRLAEITEMIHTASLVHDDVVDESSLRRGIPTVHSSFSNRVAVLAGDFL 119

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
            FAQ+SW+LA+L+++ V+KL+SQVI D A GEI Q  + FD  + +E YL KSYYKTASL+
Sbjct: 120  FAQASWHLAHLDSLTVVKLLSQVIMDLAEGEILQGLNRFDSSLSIEVYLDKSYYKTASLL 179

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            A S + A++ SG    + + +Y YGR+LGL+FQIVDDILDFT S E LGKPAGSDLA GN
Sbjct: 180  ANSARAASVLSGSSETVCDALYDYGRSLGLAFQIVDDILDFTGSEEVLGKPAGSDLASGN 239

Query: 415  LTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            LTAP ++A+E  P L  +IE EF            V    G+             A+Q L
Sbjct: 240  LTAPALYAIEEHPALVPLIEREFSQAQDFEQAIALVHNSQGLARTRALAAEHAQKAVQAL 299

Query: 235  ECLPPSPFRVAXEEMVQYNLERV 167
            + LP S  +     +  Y L R+
Sbjct: 300  DVLPASDCKETLISLTSYVLSRL 322



>sp|P51268|PREA_PORPU Prenyl transferase (EC
            2.5.1.-).>pir|S73189|S73189 prenyl transferase A - red
            alga (Porphyra purpurea) chloroplast>gb:PPU38804_1701584
            Porphyra purpurea chloroplast, complete genome.
          Length = 323

 Score =  291 bits (745), Expect = 3e-77
 Identities = 145/321 (45%), Positives = 215/321 (66%)
 Frame = -1

Query: 1129 ASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXX 950
            +SLF  +  +L ++  NL+S+ G  +P+L +AA+ +F AGGKR+RPA+V LV++      
Sbjct: 5    SSLFHPIEKELYSVEHNLKSVAGTRHPILYAAAKHLFEAGGKRLRPAIVLLVAKSTSEQQ 64

Query: 949  XXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFA 770
                     RRLAEI E+IHTASL+HDDV+DE   RRG++TVH+++ T++AVLAGDF+FA
Sbjct: 65   EIKPG---QRRLAEITEIIHTASLVHDDVIDECSTRRGEKTVHKLFNTKIAVLAGDFLFA 121

Query: 769  QSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
            QSSWYLAN+ N+EV+K+I++VI DFA GEI+Q    FD  + ++DY+ KS+YKTASL+AA
Sbjct: 122  QSSWYLANIGNLEVVKVITKVITDFAEGEIRQGLVHFDPSISIDDYIEKSFYKTASLVAA 181

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S +GAA+ + ++S +   +Y YG+++GL+FQI+DD+LD   S + LGKP+G+D   GNLT
Sbjct: 182  SCRGAAMLNDLNSQMHNDLYLYGKHMGLAFQIMDDVLDIAGSTKSLGKPSGADFMNGNLT 241

Query: 409  APVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            AP++FAL  E KL  +I+ EF            +K+ GGI             A+  L+ 
Sbjct: 242  APILFALTQEGKLDQLIQREFSDERDISLALFLIKKSGGITKAKDLAKEQVQAALCCLQF 301

Query: 229  LPPSPFRVAXEEMVQYNLERV 167
            LP S    + +E+  + + R+
Sbjct: 302  LPKSAPVSSLKELTHFIITRL 322



>gb:AY673996_1621471 Gracilaria tenuistipitata var. liui chloroplast,
            complete genome.
          Length = 323

 Score =  289 bits (739), Expect = 1e-76
 Identities = 150/293 (51%), Positives = 193/293 (65%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            +  DLL L  NL+ +VGA++P+L +AAE +F AGGKR+RP ++ LV+             
Sbjct: 11   IEQDLLILENNLKRMVGAKHPILYAAAEHLFKAGGKRIRPTIILLVA---LSTTQALHIL 67

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
             EH+RLAEI E+IHTASL+HDDV+DE ++RRG  TVH  + T+VAVLAGDF+FAQSSWYL
Sbjct: 68   PEHKRLAEITEIIHTASLVHDDVIDECEIRRGVNTVHNAFSTKVAVLAGDFLFAQSSWYL 127

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
            ANL N+EV+K IS+VI DFA GEI+Q  + FD  + M +Y+ KS+YKTASLIA+S K AA
Sbjct: 128  ANLNNLEVVKTISKVITDFAEGEIRQGLTCFDETISMNNYIEKSFYKTASLIASSCKAAA 187

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            I S   +    Q Y YG++LGL+FQIVDDILD   S   LGKPAGSDL  GNLTAP++FA
Sbjct: 188  ILSDTTTNTQNQFYLYGKHLGLAFQIVDDILDIVGSTVSLGKPAGSDLKNGNLTAPLLFA 247

Query: 391  LETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLE 233
            LE   +L  +I  EF            +K   GI             ++Q L+
Sbjct: 248  LEENSELYKLIAREFQHNKDIDKAIEIIKSTNGIQKSYDLAQEHMQASVQALK 300



>gb:BA000045_740828 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 325

 Score =  287 bits (735), Expect = 4e-76
 Identities = 148/326 (45%), Positives = 215/326 (65%)
 Frame = -1

Query: 1144 SPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRX 965
            S +S A+   +V DDL  + +NL++++G ++PVL +AAE +F+AGGKR+RPALV LVSR 
Sbjct: 2    SVVSAANWSALVEDDLSQMTRNLKNLLGTKHPVLYAAAEHLFNAGGKRIRPALVLLVSRA 61

Query: 964  XXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAG 785
                       + HRRLAEI EMIHTASL+HDDV+D S +RRG +TV+  +G RVAVLAG
Sbjct: 62   TAAYGEPT---ERHRRLAEITEMIHTASLVHDDVIDTSAVRRGIDTVNSRFGNRVAVLAG 118

Query: 784  DFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTA 605
            D++F  +S YLA L ++EV++L+  VI  F  GE+ Q++  FD D+  E Y+ KS+YKTA
Sbjct: 119  DYLFGMASAYLARLGSLEVVELLGIVISHFGEGELLQSTLQFDSDLTFEQYIDKSFYKTA 178

Query: 604  SLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLA 425
            SL+A +++ AA+ S   + + E +Y+YGR+LG++FQ++DD+LDFT S  +LGKPAGSDL 
Sbjct: 179  SLMAGTSRAAAVLSESPAAVCEALYEYGRHLGIAFQVIDDLLDFTGSTAKLGKPAGSDLR 238

Query: 424  KGNLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAI 245
             GNLTAPV++ALE  P L  +IE +F            +     +             A+
Sbjct: 239  DGNLTAPVLYALEESPHLSGLIERQFEQKGDLEKALSLIHASRALERTRELAETHARRAV 298

Query: 244  QNLECLPPSPFRVAXEEMVQYNLERV 167
             +L+ L PSP R A +++V + + R+
Sbjct: 299  TSLDTLSPSPAREALKDLVGHTVSRL 324



>gb:BX569691_775913 Synechococcus sp. WH8102 complete genome; segment
            3/7.
          Length = 323

 Score =  281 bits (718), Expect = 4e-74
 Identities = 153/324 (47%), Positives = 203/324 (62%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            I+V  L + V  DL TL  +L+S++GA +P+L +AAE +FSAGGKR+RP +V L+SR   
Sbjct: 2    ITVTELLQPVETDLETLLGDLRSLIGAGHPILQAAAEHLFSAGGKRLRPGIVLLLSRALS 61

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       HRRLAEI EMIHTASL+HDDV+DE+  RRG +TVH  +  RVAVLAGDF
Sbjct: 62   ADGQLT---PRHRRLAEITEMIHTASLVHDDVVDEASTRRGVDTVHSRFDARVAVLAGDF 118

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +FAQ+SW+LANL+++EV+KL+S+VI D A GE+KQ    FD     E YL KSY KTASL
Sbjct: 119  LFAQASWHLANLDDLEVVKLLSRVIMDLADGEVKQGLFRFDTAQSFETYLEKSYCKTASL 178

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IA S + A + S       + +Y++GR LGL+FQ+VDDILDFT S +QLGKPA SDLA G
Sbjct: 179  IANSARAAGVLSDCSPSELDGLYRFGRQLGLAFQVVDDILDFTGSDQQLGKPAASDLASG 238

Query: 418  NLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQN 239
             LTAP  +A+E +P L+ +I  EF            V+    I             +   
Sbjct: 239  YLTAPTFYAMEEQPGLQALIAREFAEPGDLDQALEMVRSSRAIPRTRELAETFARESRDA 298

Query: 238  LECLPPSPFRVAXEEMVQYNLERV 167
            +  +  SP + A  E+  + L R+
Sbjct: 299  ISWMSDSPCKRALLELPDFVLSRL 322



>gb:AE017164_395498 Prochlorococcus marinus subsp. marinus str.
            CCMP1375 section 4 of 6 of the complete
            genome.>gb:AE017126_1031167 Prochlorococcus marinus
            subsp. marinus str. CCMP1375 complete genome.
          Length = 323

 Score =  277 bits (708), Expect = 5e-73
 Identities = 145/323 (44%), Positives = 206/323 (63%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            +V  L + +  DL  L K+L+ ++GA +P+L +AAE +FSAGGKR+RP +V L+S+    
Sbjct: 3    TVTELLQPIEIDLEHLLKDLRDLIGAGHPILQAAAEHLFSAGGKRIRPGIVLLISKALSA 62

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                     +HRRLAEI EMIHTASL+HDDVLDE+  RRG +TVH  +  +VAVLAGDF+
Sbjct: 63   EGELSS---KHRRLAEITEMIHTASLVHDDVLDEASTRRGVDTVHNRFDHKVAVLAGDFL 119

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
            FAQ+SW+LANL+N++V+KL+S+VI D A GE+KQ    FD +  ++ YL KSY KTASLI
Sbjct: 120  FAQASWHLANLDNLDVVKLLSRVIMDLAEGEVKQGIYRFDPNQSLDVYLEKSYCKTASLI 179

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            A S +   + S       + +Y +G+ LGL+FQ+VDDILDFT   +QLGKPA SDL+ G 
Sbjct: 180  ANSAQAVGVLSNESDYHLKCLYNFGKQLGLAFQVVDDILDFTSDDKQLGKPAASDLSAGY 239

Query: 415  LTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            LTAP ++ALE  P  +++I  EF            V+    I             + +++
Sbjct: 240  LTAPALYALEENPSFKELIIREFSNEGDLDHAMELVRESNAIIRSRKLAENFAKNSYESI 299

Query: 235  ECLPPSPFRVAXEEMVQYNLERV 167
            + +P SP + A  ++ +Y L R+
Sbjct: 300  KWMPDSPSKRALLDLPEYVLGRL 322



>gb:BX572096_797734 Prochlorococcus marinus MIT9313 complete genome;
            segment 2/7.
          Length = 323

 Score =  276 bits (705), Expect = 1e-72
 Identities = 152/323 (47%), Positives = 200/323 (61%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            +V  L + V  DL TL  +L+S++GA +P+L +AAE +FSAGGKR+RP +V L+SR    
Sbjct: 3    TVTELLQPVELDLETLLTDLRSLIGAGHPILQAAAEHLFSAGGKRLRPGIVLLISRALSA 62

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                      HRRLAEI EMIHTASL+HDDV+DE+  RRG  TVH  +  RVAVLAGDF+
Sbjct: 63   DGDLSA---RHRRLAEITEMIHTASLVHDDVVDEAATRRGVATVHSRFNHRVAVLAGDFL 119

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
            FAQ+SW+LANL+N+ V+KL+S+VI D A GE+KQ    +D       YL KSY KTASL+
Sbjct: 120  FAQASWHLANLDNLAVVKLLSRVIMDLADGEVKQGLYRYDTGQSFATYLEKSYCKTASLM 179

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            A S + A + SG      + ++ +GR LGL+FQ+VDDILDFT S +QLGKPA SDLA G 
Sbjct: 180  ANSVQAAGVLSGESVEHQKLLHHFGRQLGLAFQVVDDILDFTGSEQQLGKPAASDLASGY 239

Query: 415  LTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            LTAP ++ALE    L  +IE EF            V+    I             + + +
Sbjct: 240  LTAPALYALEEHLALARLIEREFSEEDDLDQALELVRNSQAISRSRQLAEDFARESREAI 299

Query: 235  ECLPPSPFRVAXEEMVQYNLERV 167
              LP SP + A  E+  + L R+
Sbjct: 300  AWLPDSPCQRALMELPDFVLSRL 322



>gb:BX572091_796244 Prochlorococcus marinus MED4 complete genome;
            segment 2/5.
          Length = 323

 Score =  275 bits (704), Expect = 2e-72
 Identities = 148/323 (45%), Positives = 204/323 (63%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            +V  L + V +DL  L   L++++GA +P+L +AAE +FSAGGKR+RP +V L+S+    
Sbjct: 3    TVTELLQPVENDLDDLINELKNLIGAGHPILQAAAEHLFSAGGKRLRPGIVLLISKAISQ 62

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                     +H+RLAEI EMIHTASL+HDDV+DE+  RRG +TVH  + TRVAVLAGDF+
Sbjct: 63   DFTLTT---KHKRLAEITEMIHTASLVHDDVVDEASTRRGVDTVHSRFNTRVAVLAGDFL 119

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
            FAQ+SW+LANL+N++V+KL+S+VI D A GEIKQ  + FD       Y+ KSY KTASLI
Sbjct: 120  FAQASWHLANLDNVKVVKLLSRVIMDLAEGEIKQNLNRFDSAQTFSKYINKSYCKTASLI 179

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            A STK A +   ++      +Y++G+N+GL+FQ+VDDILDFT + +QLGKPA SDLA G 
Sbjct: 180  ANSTKAAGVLCNLEDDKLNHLYEFGKNIGLAFQVVDDILDFTGNDKQLGKPAVSDLASGY 239

Query: 415  LTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            LTAPV++ALE    L  +I  E             V     I             + + L
Sbjct: 240  LTAPVLYALEENENLSVLINRELVEKEDLNNALNIVMNSQAIKRSRKLAEDFALHSKEAL 299

Query: 235  ECLPPSPFRVAXEEMVQYNLERV 167
              LP S ++ A   + ++ L R+
Sbjct: 300  LWLPDSEYKRALLSLPEFVLSRL 322



>sp|Q9TLS1|PREA_CYACA Prenyl transferase (EC
            2.5.1.-).>gb:AF022186_1761962 Cyanidium caldarium strain
            RK1 chloroplast, complete genome.
          Length = 323

 Score =  254 bits (649), Expect = 4e-66
 Identities = 137/316 (43%), Positives = 192/316 (60%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            V +DLL + + L  ++   NP+L +AA+ +     K++RPA+V LV++            
Sbjct: 11   VKEDLLNIEQTLNKLIKVNNPILSAAAKHLLIVESKKIRPAIVLLVAKAIDKNKKIKTS- 69

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
               +RLAE+ E+IHTA+L+HDDV+DES +RRG ++V++ +G ++AV AGDF+FAQSSWYL
Sbjct: 70   --QQRLAEVTEIIHTATLLHDDVVDESIIRRGTKSVNKTFGNKIAVFAGDFLFAQSSWYL 127

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
            AN+ N+EV+K IS+VI D A GE++Q  + F+    +  YL KS+ KTASLIAAS K   
Sbjct: 128  ANINNLEVVKAISKVITDLAEGELQQNLTQFNTYYSIIKYLEKSFNKTASLIAASCKSCC 187

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            + S  D  ++ + Y YG+NLGL+FQI+DDILD T S+  LGK   SDL  GNLTAPV+FA
Sbjct: 188  LLSDFDQSLNSKFYNYGKNLGLAFQIIDDILDITSSSTALGKMTTSDLKLGNLTAPVLFA 247

Query: 391  LETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPF 212
            L    KL  IIE EFC           +K    I             AI +++ LP S  
Sbjct: 248  LTKNSKLFKIIEREFCEKSDISEAINIIKETNAIEESFDLAYEHIEAAINSIKDLPTSSE 307

Query: 211  RVAXEEMVQYNLERVK 164
            + +  E+    L R K
Sbjct: 308  KDSLIEIAYDLLNRYK 323



>gb:AB002583_1508844 Cyanidioschyzon merolae chloroplast DNA, complete
            genome, strain:10D.
          Length = 315

 Score =  231 bits (590), Expect = 3e-59
 Identities = 129/318 (40%), Positives = 186/318 (58%), Gaps = 2/318 (0%)
 Frame = -1

Query: 1117 EVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXX 938
            +++++ L    +++Q ++ + + +L +AA  +F AGGKR+RP  V LVS+          
Sbjct: 2    KLISELLAQNERHIQRLIQSRHALLSAAAAHLFQAGGKRIRPTFVLLVSQALGGIS---- 57

Query: 937  XTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSW 758
              +  +RLAEI EMIHTASL+HDDV+DE+  RRG +TV+  +  R+AVLAGDF+FAQSSW
Sbjct: 58   --QSQQRLAEITEMIHTASLLHDDVVDEASKRRGIDTVNTRFSNRIAVLAGDFLFAQSSW 115

Query: 757  YLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKG 578
            YLANL N+EV+K IS++I D A GE++Q S+ F     +  YL KS+YKTASL A S K 
Sbjct: 116  YLANLNNLEVVKFISKLISDLAEGEMRQTSTQFSTQFELWAYLEKSFYKTASLFACSAKA 175

Query: 577  AAIFSG--VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
              + S    D+   + MY  G++LG++FQI+DD+LD +    Q+GK   +D   GNLTAP
Sbjct: 176  TCMLSNDHEDNHHHKNMYLLGQHLGIAFQIMDDVLDISGDISQMGKTLSADFVSGNLTAP 235

Query: 403  VIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLP 224
            ++FAL  E  L  ++E E C           V    GI             A+  L  L 
Sbjct: 236  ILFALTQEAGLVTLLERECCYTQDAYQVRQMVWDTYGIEQAKDLAFEHMQAALACLASLA 295

Query: 223  PSPFRVAXEEMVQYNLER 170
            PS  + A  ++    + R
Sbjct: 296  PSEAKDALYDLANQMISR 313



>gb:AP003728_1832568 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0710B08.>gb:AP004989_1846785 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, BAC
            clone:B1153E06.
          Length = 430

 Score =  208 bits (529), Expect = 3e-52
 Identities = 124/314 (39%), Positives = 182/314 (57%), Gaps = 13/314 (4%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAG--GKRMRP--------ALVFLVS 971
            FE+V D+L  L   L+S+V AE P L SAAE  F  G  GKR RP        AL F +S
Sbjct: 93   FELVADELSLLANRLRSMVAAEVPKLASAAEYFFKVGAEGKRFRPTVLLLMASALKFPLS 152

Query: 970  RXXXXXXXXXXXTKEHRR---LAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRV 800
                         K   R   +AEI EMIH ASL+HDDVLD++D RRG  +++ I G ++
Sbjct: 153  DSTEVGVLTILANKLRTRQQNIAEITEMIHVASLLHDDVLDDADTRRGVSSLNCIMGNKL 212

Query: 799  AVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKS 620
            +VLAGDF+ +++   LA L N EV+ L++  ++   +GE  Q S+  +    M+ YL K+
Sbjct: 213  SVLAGDFLLSRACVALAALGNTEVVSLMATAVEHLVTGETMQISTSREQRRSMDYYLQKT 272

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
            YYKTASLI+ S K  AI +G  + +S   Y+YGRNLGL+FQ++DD+LDFT ++  LGK +
Sbjct: 273  YYKTASLISNSCKAVAILAGHTADVSMLAYEYGRNLGLAFQLIDDVLDFTGTSASLGKGS 332

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXX 260
             +D+  G +TAP+++A+E  P+L ++++  F            +++  GI          
Sbjct: 333  LTDIRHGIITAPMLYAMEEFPQLHEVVDRGFDNPANVELALDYLQKSRGIEKTKELAREH 392

Query: 259  XXXAIQNLECLPPS 218
               AI+ +E LP S
Sbjct: 393  ANRAIKAIEALPDS 406



>gb:QRO298245_1703204 Quercus robur mRNA for geranyl diphosphat
            synthase (gppS gene).
          Length = 416

 Score =  206 bits (525), Expect = 9e-52
 Identities = 115/314 (36%), Positives = 182/314 (57%), Gaps = 13/314 (4%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXXXXX-- 953
            F +V D+L  +   L+S+V  E P L SAAE  F  G  GKR RP ++ L++        
Sbjct: 79   FSLVADELSMVANRLRSMVVTEVPKLASAAEYFFKMGVEGKRFRPTVLLLMATAMNISIL 138

Query: 952  ---------XXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRV 800
                               +R+AEI EMIH ASL+HDDVLD++D RRG  +++ + G ++
Sbjct: 139  EPSLRGPGDALTTELRARQQRIAEITEMIHVASLLHDDVLDDADTRRGIGSLNFVMGNKL 198

Query: 799  AVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKS 620
            AVLAGDF+ +++   LA+L+N EV+ L+++V++   +GE  Q ++  +    ME Y+ K+
Sbjct: 199  AVLAGDFLLSRACVALASLKNTEVVSLLAKVVEHLVTGETMQMTTTCEQRCSMEYYMQKT 258

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
            YYKTASLI+ S K  A+  G  S ++   Y+YG+NLGL++Q++DD+LDFT ++  LGK +
Sbjct: 259  YYKTASLISNSCKAIALLGGQTSEVAMLAYEYGKNLGLAYQLIDDVLDFTGTSASLGKGS 318

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXX 260
             SD+  G +TAP++FA+E  P+LR++++  F            + +  GI          
Sbjct: 319  LSDIRHGIITAPILFAMEEFPQLREVVDRGFDDPANVDVALDYLGKSRGIQRARELAKKH 378

Query: 259  XXXAIQNLECLPPS 218
               A + ++ LP S
Sbjct: 379  ANIAAEAIDSLPES 392



>gb:AY166797_1586229 Citrus unshiu geranylgeranyl diphosphate synthase
            (Ggps) mRNA, complete cds.
          Length = 426

 Score =  203 bits (516), Expect = 1e-50
 Identities = 110/271 (40%), Positives = 170/271 (62%), Gaps = 13/271 (4%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXXXXX-- 953
            F +V D+L  L K L+S+V AE P L SAAE  F  G  GKR RP ++ L++        
Sbjct: 89   FSLVADELSILAKRLRSMVVAEVPKLASAAEYFFKMGVEGKRFRPTVLLLMATALNVRVP 148

Query: 952  ---------XXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRV 800
                               + +AEI EMIH ASL+HDDVLD++D RRG  +++ + G ++
Sbjct: 149  EPLHDGVEDALATELRTRQQCIAEITEMIHVASLLHDDVLDDADTRRGIGSLNFVMGNKL 208

Query: 799  AVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKS 620
            AVLAGDF+ +++   LA+L+N EV+ L++ V++   +GE  Q ++  D    M+ Y+ K+
Sbjct: 209  AVLAGDFLLSRACVALASLKNTEVVTLLATVVEHLVTGETMQMTTSSDQRCSMDYYMQKT 268

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
            YYKTASLI+ S K  A+ +G  + ++   + YG+NLGL++Q++DD+LDFT ++  LGK +
Sbjct: 269  YYKTASLISNSCKAIALLAGQTAEVAILAFDYGKNLGLAYQLIDDVLDFTGTSASLGKGS 328

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIESEF 347
             SD+  G +TAP++FA+E  P+LR ++E  F
Sbjct: 329  LSDIQHGIITAPILFAMEEFPQLRTVVEQGF 359



>gb:BT020524_1642918 Arabidopsis thaliana At2g34630 gene, complete
            cds.
          Length = 422

 Score =  197 bits (500), Expect = 7e-49
 Identities = 105/268 (39%), Positives = 167/268 (62%), Gaps = 13/268 (4%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXX----- 962
            F +V D+L  L+  L+ +V AE P L SAAE  F  G  GK+ R  ++ L++        
Sbjct: 85   FSLVADELSLLSNKLREMVLAEVPKLASAAEYFFKRGVQGKQFRSTILLLMATALNVRVP 144

Query: 961  ------XXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRV 800
                               R +AEI EMIH ASL+HDDVLD++D RRG  +++ + G ++
Sbjct: 145  EALIGESTDIVTSELRVRQRGIAEITEMIHVASLLHDDVLDDADTRRGVGSLNVVMGNKM 204

Query: 799  AVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKS 620
            +VLAGDF+ +++   LA L+N EV+ L++  ++   +GE  + +S  +    M+ Y+ K+
Sbjct: 205  SVLAGDFLLSRACGALAALKNTEVVALLATAVEHLVTGETMEITSSTEQRYSMDYYMQKT 264

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
            YYKTASLI+ S K  A+ +G  + ++   ++YGRNLGL+FQ++DDILDFT ++  LGK +
Sbjct: 265  YYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLGLAFQLIDDILDFTGTSASLGKGS 324

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIE 356
             SD+  G +TAP++FA+E  P+LR++++
Sbjct: 325  LSDIRHGVITAPILFAMEEFPQLREVVD 352



>gb:AY093006_1574960 Arabidopsis thaliana putative
            trans-prenyltransferase (At2g34630) mRNA, complete cds.
          Length = 423

 Score =  197 bits (500), Expect = 7e-49
 Identities = 105/268 (39%), Positives = 167/268 (62%), Gaps = 13/268 (4%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXX----- 962
            F +V D+L  L+  L+ +V AE P L SAAE  F  G  GK+ R  ++ L++        
Sbjct: 86   FSLVADELSLLSNKLREMVLAEVPKLASAAEYFFKRGVQGKQFRSTILLLMATALNVRVP 145

Query: 961  ------XXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRV 800
                               R +AEI EMIH ASL+HDDVLD++D RRG  +++ + G ++
Sbjct: 146  EALIGESTDIVTSELRVRQRGIAEITEMIHVASLLHDDVLDDADTRRGVGSLNVVMGNKM 205

Query: 799  AVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKS 620
            +VLAGDF+ +++   LA L+N EV+ L++  ++   +GE  + +S  +    M+ Y+ K+
Sbjct: 206  SVLAGDFLLSRACGALAALKNTEVVALLATAVEHLVTGETMEITSSTEQRYSMDYYMQKT 265

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
            YYKTASLI+ S K  A+ +G  + ++   ++YGRNLGL+FQ++DDILDFT ++  LGK +
Sbjct: 266  YYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLGLAFQLIDDILDFTGTSASLGKGS 325

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIE 356
             SD+  G +TAP++FA+E  P+LR++++
Sbjct: 326  LSDIRHGVITAPILFAMEEFPQLREVVD 353



>gb:CQ793418_1452999 Sequence 121 from Patent
            WO2004017749.>gb:CQ793587_1453038 Sequence 109 from
            Patent WO2004018693.>gb:ATH17376_1552028 Arabidopsis
            thaliana mRNA for geranyl diphosphate synthase.
          Length = 422

 Score =  197 bits (500), Expect = 7e-49
 Identities = 105/268 (39%), Positives = 167/268 (62%), Gaps = 13/268 (4%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXX----- 962
            F +V D+L  L+  L+ +V AE P L SAAE  F  G  GK+ R  ++ L++        
Sbjct: 85   FSLVADELSLLSNKLREMVLAEVPKLASAAEYFFKRGVQGKQFRSTILLLMATALDVRVP 144

Query: 961  ------XXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRV 800
                               R +AEI EMIH ASL+HDDVLD++D RRG  +++ + G ++
Sbjct: 145  EALIGESTDIVTSELRVRQRGIAEITEMIHVASLLHDDVLDDADTRRGVGSLNVVMGNKM 204

Query: 799  AVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKS 620
            +VLAGDF+ +++   LA L+N EV+ L++  ++   +GE  + +S  +    M+ Y+ K+
Sbjct: 205  SVLAGDFLLSRACGALAALKNTEVVALLATAVEHLVTGETMEITSSTEQRYSMDYYMQKT 264

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
            YYKTASLI+ S K  A+ +G  + ++   ++YGRNLGL+FQ++DDILDFT ++  LGK +
Sbjct: 265  YYKTASLISNSCKAVAVLTGQTAEVAVLAFEYGRNLGLAFQLIDDILDFTGTSASLGKGS 324

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIE 356
             SD+  G +TAP++FA+E  P+LR++++
Sbjct: 325  LSDIRHGVITAPILFAMEEFPQLREVVD 352



>gb:AE012386_281964 Xanthomonas campestris pv. campestris str. ATCC
            33913, section 294 of 460 of the complete
            genome.>gb:AE008922_915246 Xanthomonas campestris pv.
            campestris str. ATCC 33913, complete genome.
          Length = 332

 Score =  192 bits (489), Expect = 1e-47
 Identities = 110/338 (32%), Positives = 178/338 (52%), Gaps = 5/338 (1%)
 Frame = -1

Query: 1168 LDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPA 989
            + + +D  + + +  +  +   D+  ++  ++  + ++  ++   A+ I SAGGKR+RP 
Sbjct: 1    MTIAQDLPTVLGLPQIQSLAAPDMAAVDALIRRRLASDVVLINQIADHIISAGGKRLRPM 60

Query: 988  LVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYG 809
            LV L                EH +LA IIE IHT++L+HDDV+DESD+RRG+ T + ++G
Sbjct: 61   LVMLAGHAAGGSG------PEHHQLAAIIEFIHTSTLLHDDVVDESDLRRGRSTANALWG 114

Query: 808  TRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYL 629
               +VL GDF++++S   +  L+ +EV+++++      A GE+ Q   + + D     YL
Sbjct: 115  NAPSVLVGDFLYSRSFQLMVELDRMEVMQILADTTNRIAEGEVLQLLHVHNPDTDEAAYL 174

Query: 628  IKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLG 449
                 KTA L AA T+  A+ SG D+ + + +Y YG  LG +FQI DD+LD+   A  LG
Sbjct: 175  RVIERKTAVLFAAGTRLGALASGADAQVQQCLYDYGMQLGFAFQIADDVLDYAADATDLG 234

Query: 448  KPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXX 284
            K  G DLA+G  T P+I A+      T+ +LR I+E               ++  GG+  
Sbjct: 235  KNLGDDLAEGKATLPLIHAIAHSDAATQQRLRQIVEQG--DAEAMPEVLTAIRATGGLDY 292

Query: 283  XXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                       A Q L+ LPPSP   A   + +Y +ER
Sbjct: 293  SRQRAAEYAAAAEQALDGLPPSPAVAALRGLARYAVER 330



>gb:AE013598_295139 Xanthomonas oryzae pv. oryzae KACC10331, complete
            genome.
          Length = 408

 Score =  191 bits (486), Expect = 3e-47
 Identities = 110/338 (32%), Positives = 177/338 (52%), Gaps = 5/338 (1%)
 Frame = -1

Query: 1168 LDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPA 989
            + + +D  + + +  +  +   D+  ++  ++  + ++  ++   A+ I SAGGKR+RP 
Sbjct: 77   MTIAEDLPTVLGLPQIQSLAAPDMAAVDAVIRRRLASDVMLINQIADHIISAGGKRLRPM 136

Query: 988  LVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYG 809
            LV L                EH +LA IIE IHT++L+HDDV+DESD+RRG+ T + ++G
Sbjct: 137  LVILAGHAAGGSG------PEHHQLAAIIEFIHTSTLLHDDVVDESDLRRGRSTANALWG 190

Query: 808  TRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYL 629
               +VL GDF++++S   +  L+ +EV+++++      A GE+ Q   + + D     YL
Sbjct: 191  NAPSVLVGDFLYSRSFQLMVELDRMEVMQILADTTNRIAEGEVLQLLHVHNPDTDEAAYL 250

Query: 628  IKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLG 449
                 KTA L AA T+  A+ SG D+ + +Q+Y YG  LG +FQI DD+LD+   A +LG
Sbjct: 251  RVIERKTAVLFAAGTRLGALASGADAQVQQQLYDYGMQLGFAFQIADDVLDYAAEAAELG 310

Query: 448  KPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXX 284
            K  G DLA+G  T P+I A+      T  +LR I+E               +   GG+  
Sbjct: 311  KNLGDDLAEGKATLPLIHAMAHSDATTRERLRQIVEQG--DAAAMPDVLAAIHATGGLDY 368

Query: 283  XXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                       A Q L+ LP SP   A   + +Y +ER
Sbjct: 369  SRQRAGEYAAAAEQALDTLPYSPAVAALRGLARYAVER 406



>gb:BC049211_1984207 Homo sapiens trans-prenyltransferase, mRNA (cDNA
            clone IMAGE:5241998), partial cds.
          Length = 414

 Score =  190 bits (482), Expect = 9e-47
 Identities = 114/320 (35%), Positives = 174/320 (54%), Gaps = 1/320 (0%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            F++   DL  L ++++  +      L   +E  F   GK  RP +V L++R         
Sbjct: 95   FKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNS 154

Query: 940  XXTKEHRR-LAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
               +  +R +A I EMIHTASL+HDDV+D++  RRGK TV++I+G + AVLAGD + + +
Sbjct: 155  RHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAA 214

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
            S  LA + N  VI +++QVI+D   GE  Q  S  + +     YL K++ KTASLIA S 
Sbjct: 215  SIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSC 274

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            K  ++    D  + E  YQYG+N+G++FQ++DD+LDFT  ++Q+GKP  +DL  G  T P
Sbjct: 275  KAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGP 334

Query: 403  VIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLP 224
            V+FA +  P++  +I   F            V +  G+             AI+ +  L 
Sbjct: 335  VLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLR 394

Query: 223  PSPFRVAXEEMVQYNLERVK 164
            PSP R A  ++ +  L R K
Sbjct: 395  PSPERDALIQLSEIVLTRDK 414



>gb:AL390961_1926747 Human DNA sequence from clone RP13-16H11 on
            chromosome 10 Contains three novel genes, the gene for
            trans-prenyltransferase (TPT), the 3' end of the SSH3BP
            gene for spectrin SH3 domain binding protein 1, a heat
            shock protein pseudogene and a CpG island, complete
            sequence.
          Length = 415

 Score =  190 bits (482), Expect = 9e-47
 Identities = 114/320 (35%), Positives = 174/320 (54%), Gaps = 1/320 (0%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            F++   DL  L ++++  +      L   +E  F   GK  RP +V L++R         
Sbjct: 96   FKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNS 155

Query: 940  XXTKEHRR-LAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
               +  +R +A I EMIHTASL+HDDV+D++  RRGK TV++I+G + AVLAGD + + +
Sbjct: 156  RHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAA 215

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
            S  LA + N  VI +++QVI+D   GE  Q  S  + +     YL K++ KTASLIA S 
Sbjct: 216  SIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSC 275

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            K  ++    D  + E  YQYG+N+G++FQ++DD+LDFT  ++Q+GKP  +DL  G  T P
Sbjct: 276  KAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGP 335

Query: 403  VIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLP 224
            V+FA +  P++  +I   F            V +  G+             AI+ +  L 
Sbjct: 336  VLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLR 395

Query: 223  PSPFRVAXEEMVQYNLERVK 164
            PSP R A  ++ +  L R K
Sbjct: 396  PSPERDALIQLSEIVLTRDK 415



>gb:BA000028_696175 Oceanobacillus iheyensis HTE831 DNA, complete
            genome.
          Length = 323

 Score =  190 bits (482), Expect = 9e-47
 Identities = 96/251 (38%), Positives = 160/251 (63%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + +  ++  +  D+ ++   LQ  + A +PVL  A+ ++  AGGKR+RP  V L S+   
Sbjct: 1    MKLPKIYGFLKKDMESIESALQDSIQANHPVLRDASTELLHAGGKRIRPVFVLLSSQLGN 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                        +++A  +E+IH A+L+HDDV+DE+++RRGK T   IYG RVA+  GD+
Sbjct: 61   YDLSKI------KKVAVTLELIHMATLVHDDVIDEAELRRGKPTTASIYGNRVAMYTGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            + A++   +  + +  V +L+S+ + + + GEI+Q    F+ +    DYL +   KTA L
Sbjct: 115  ILARALEEITEIPDPRVHQLLSKTLVEVSIGEIEQIEYKFNWEQNFRDYLRRIKRKTALL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IA+S K  AI  G++   + ++YQYG  +G+S+QI+DDILDFT ++++LGKPAG+DL +G
Sbjct: 175  IASSCKLGAIVGGLNDYQTNKLYQYGYYIGMSYQIIDDILDFTSTSKELGKPAGNDLLQG 234

Query: 418  NLTAPVIFALE 386
            N+T PV++A+E
Sbjct: 235  NITLPVLYAME 245



>gb:CSP243739_1674010 Citrus sinensis mRNA for geranyl diphosphate
            synthase (gpps gene).
          Length = 321

 Score =  189 bits (480), Expect = 1e-46
 Identities = 102/254 (40%), Positives = 159/254 (62%), Gaps = 13/254 (5%)
 Frame = -1

Query: 1069 IVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXXXXX-----------XXXXXXTK 929
            +V AE P L SAAE  F  G  GKR RP ++ L++                         
Sbjct: 1    MVIAEVPKLASAAEYFFKMGVEGKRFRPTVLLLMATALNVRVPEPLHDGVEDASATELRT 60

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
              + +AEI EMIH ASL+HDDVLD++D RRG  +++ + G ++AVLAGDF+ +++   LA
Sbjct: 61   RQQCIAEITEMIHVASLLHDDVLDDADTRRGIGSLNFVMGNKLAVLAGDFLLSRACVALA 120

Query: 748  NLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAI 569
            +L+N EV+ L++ V++   +GE  Q ++  D    M+ Y+ K+YYKTASLI+ S K  A+
Sbjct: 121  SLKNTEVVTLLATVVEHLVTGETMQMTTSSDQRCSMDYYMQKTYYKTASLISNSCKAIAL 180

Query: 568  FSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
             +G  + ++   + YG+NLGL++Q++DD+LDFT ++  LGK + SD+  G +TAP++FA+
Sbjct: 181  LAGQTAEVAILAFDYGKNLGLAYQLIDDVLDFTGTSASLGKGSLSDIRHGIITAPILFAM 240

Query: 388  ETEPKLRDIIESEF 347
            E  P+LR ++E  F
Sbjct: 241  EEFPQLRTVVEQGF 254



>gb:AF118395_1884699 Homo sapiens trans-prenyltransferase mRNA,
            complete cds.
          Length = 376

 Score =  189 bits (479), Expect = 2e-46
 Identities = 110/295 (37%), Positives = 163/295 (55%), Gaps = 1/295 (0%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR-LAEIIEMIHTASLIHD 869
            L   +E  F   GK  RP +V L++R            +  +R +A I EMIHTASL+HD
Sbjct: 82   LKEISEYYFDVKGKAFRPIIVVLMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHD 141

Query: 868  DVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFAS 689
            DV+D++  RRGK TV++I+G + AVLAGD + + +S  LA + N  VI +++QVI+D   
Sbjct: 142  DVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVR 201

Query: 688  GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLG 509
            GE  Q  S  + +     YL K++ KTASLIA S K  ++    D  + E  YQYG+N+G
Sbjct: 202  GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVG 261

Query: 508  LSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXX 329
            ++FQ++DD+LDFT  ++Q+GKP  +DL  G  T PV+FA +  P++  +I   F      
Sbjct: 262  IAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDV 321

Query: 328  XXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                  V +  G+             AI+ +  L PSP R A  ++ +  L R K
Sbjct: 322  DRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK 376



>gb:CR382129_1662064 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 452

 Score =  189 bits (479), Expect = 2e-46
 Identities = 105/261 (40%), Positives = 154/261 (59%), Gaps = 6/261 (2%)
 Frame = -1

Query: 928 EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
           + RRLAEI+EMIHTASL+HDDV+D S  RRG  T +  +G ++A+LAGDF+  ++S  +A
Sbjct: 192 KQRRLAEIVEMIHTASLLHDDVIDNSATRRGSPTGNVAFGNKMAILAGDFLLGRASVAIA 251

Query: 748 NLENIEVIKLISQVIKDFASGEIKQASSLF--DCDVG----MEDYLIKSYYKTASLIAAS 587
            L N EVI+L+S  I +   GE  Q  +    + ++      E Y+ K+Y KTASL++ S
Sbjct: 252 RLRNAEVIELLSTTIANLVEGEFMQLKNTIVDNSEIANKATFEYYIHKTYLKTASLMSKS 311

Query: 586 TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            + AA+ SG  + I +  Y++G+NLGL FQ+VDD+LD+++    LGKPAG+DL  G  TA
Sbjct: 312 CRAAAVLSGARNPIVDASYKFGKNLGLCFQVVDDMLDYSEGESHLGKPAGADLKLGLATA 371

Query: 406 PVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECL 227
           PV+FA E  P+L D+I+ +F            V++  G+             A+ NL+ L
Sbjct: 372 PVLFAWEKYPELGDMIKRKFDGPGDVERARFLVQQADGLSRTRELAQKYCDEAVANLDLL 431

Query: 226 PPSPFRVAXEEMVQYNLERVK 164
           P S  R A   +    + R K
Sbjct: 432 PYSESREALRNLTMKMMNRSK 452



>gb:MCI496300_1685767 Mucor circinelloides f. lusitanicus isoB gene
            for solanesyl pyrophosphate synthase, exons 1-3.
          Length = 471

 Score =  188 bits (478), Expect = 3e-46
 Identities = 121/365 (33%), Positives = 177/365 (48%), Gaps = 49/365 (13%)
 Frame = -1

Query: 1117 EVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXX 938
            ++V DDL  +  N+  ++G+ +P L + A   FS  GK +RP LV L+++          
Sbjct: 105  KLVGDDLKEIKANISKLLGSGHPFLNTVARHYFSGEGKHVRPLLVLLIAQATSIADKKSL 164

Query: 937  XTK------------------------------------------EHRRLAEIIEMIHTA 884
             +                                             RRLAEI EMIHTA
Sbjct: 165  ASNIDYKSIDTPISHGLKNITTNDVFDRKLHYTPSVTDQGCIILPTQRRLAEISEMIHTA 224

Query: 883  SLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVI 704
            SL+HDDV+D S  RR   + +  +G ++AVL GDF+ A++S  LA L N E I+L++  I
Sbjct: 225  SLLHDDVIDASMTRRNLPSANASFGNKMAVLGGDFLLARASLALARLRNAECIELMATCI 284

Query: 703  KDFASGEIKQASSLFDCDVG-------MEDYLIKSYYKTASLIAASTKGAAIFSGVDSGI 545
             +   GE  Q  +  + + G        + Y+ K+Y KT SLIA S K +A+  G    +
Sbjct: 285  ANLVEGEFMQLRNTKEGESGKVKKLSTFDHYMEKTYMKTGSLIAQSCKASAVLGGSTKEV 344

Query: 544  SEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRD 365
            +   Y +G+NLGL+FQ+VDD+LDFT +A +LGKPAG+DL  G  TAPV+FA E  P+L  
Sbjct: 345  ANIAYDFGKNLGLAFQLVDDMLDFTVTAAELGKPAGADLKLGLATAPVLFAWEEYPELEP 404

Query: 364  IIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQ 185
            +I+ +F            V +  G+             A   L  LP S  R A  ++ +
Sbjct: 405  LIKRKFSVKGDEEKARDLVYQSDGLKKTLDLAQIHCKLATDALYKLPASDARSALVQITE 464

Query: 184  YNLER 170
              L R
Sbjct: 465  KLLTR 469



>gb:AL646072_547751 Ralstonia solanacearum GMI1000 chromosome,
            complete sequence; segment 16/19.
          Length = 322

 Score =  188 bits (478), Expect = 3e-46
 Identities = 108/329 (32%), Positives = 180/329 (54%), Gaps = 5/329 (1%)
 Frame = -1

Query: 1141 PISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXX 962
            P SV  L   V +D+  ++  ++  +G+E  ++    E I SAGGKR+RP ++ L++   
Sbjct: 2    PASV--LLAPVAEDMHAVDAVIRRRLGSEVALINQIGEYIISAGGKRLRPVILLLMANAL 59

Query: 961  XXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGD 782
                      + H  LA ++E IHTA+L+HDDV+DES++RRG++T + ++G   +VL GD
Sbjct: 60   GYRG------QHHYELAAVVEFIHTATLLHDDVVDESELRRGRQTANAVFGNAASVLVGD 113

Query: 781  FMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTAS 602
            F+++++   +   +++ V+++++      + GE+ Q  ++ D DV  E YL    YKTA 
Sbjct: 114  FLYSRAFQMMVQADSMRVMQILADATNVISEGEVLQLLNMHDPDVTEERYLQVIRYKTAK 173

Query: 601  LIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAK 422
            L  A+ +  A+ SG D+       +YGR +G +FQIVDD+LD+T +A+Q+GK AG DL +
Sbjct: 174  LFEAAAQIGAVLSGADAATEAAAAEYGRRIGTAFQIVDDLLDYTATADQMGKNAGDDLRE 233

Query: 421  GNLTAPVIFAL----ETEPKL-RDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXX 257
            G  T P+I+ L    ET+  L R  IE               ++  G +           
Sbjct: 234  GKPTLPLIYLLSHGTETQRALARQAIEQG--GTEHFDAIFAAIQASGALEYTRKAAEHEA 291

Query: 256  XXAIQNLECLPPSPFRVAXEEMVQYNLER 170
              A + +  LPPS FR    E+  ++L+R
Sbjct: 292  SAAAEAIIALPPSQFRQTLIELCAFSLQR 320



>gb:AE011933_277822 Xanthomonas axonopodis pv. citri str. 306, section
            311 of 469 of the complete genome.>gb:AE008923_919597
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 332

 Score =  188 bits (478), Expect = 3e-46
 Identities = 109/338 (32%), Positives = 175/338 (51%), Gaps = 5/338 (1%)
 Frame = -1

Query: 1168 LDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPA 989
            + + +D  + + +  +  +   D+  ++  ++  + ++  ++   A+ I SAGGKR+RP 
Sbjct: 1    MTIAEDLPTVLGLPQIQSLAAPDMAAVDALIRRRLASDVVLINQIADHIISAGGKRLRPM 60

Query: 988  LVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYG 809
            LV L                EH +LA IIE IHT++L+HDDV+DESD+RRG+ T + ++G
Sbjct: 61   LVMLAGHAAGGSG------PEHHQLAAIIEFIHTSTLLHDDVVDESDLRRGRSTANALWG 114

Query: 808  TRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYL 629
               +VL GDF++++S   +  L+ +EV+++++      A GE+ Q   + + D     YL
Sbjct: 115  NAPSVLVGDFLYSRSFQLMVELDRMEVMQILADTTNRIAEGEVLQLLHVHNPDTDEAAYL 174

Query: 628  IKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLG 449
                 KTA L AA T+  A+ SG  + + +Q+Y YG  LG +FQI DD+LD+   A  LG
Sbjct: 175  RVIERKTAVLFAAGTRLGALASGASAQVQQQLYDYGMQLGFAFQIADDVLDYAAEAADLG 234

Query: 448  KPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXX 284
            K  G DLA+G  T P+I A+      T  +LR I+E               ++  GG+  
Sbjct: 235  KNLGDDLAEGKATLPLIHAMAHSDATTRERLRQIVEQG--DAAAMPEVLAAIRATGGLDY 292

Query: 283  XXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                       A Q LE LP S    A   + +Y +ER
Sbjct: 293  SRQRAAEYAAAAEQALETLPHSAAVAALRGLARYAVER 330



>gb:AY351862_1601742 Vitis vinifera geranyl diphosphate synthase
            (GPPS) mRNA, complete cds.
          Length = 321

 Score =  188 bits (477), Expect = 3e-46
 Identities = 111/297 (37%), Positives = 169/297 (56%), Gaps = 13/297 (4%)
 Frame = -1

Query: 1069 IVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXXXX-----------XXXXXXXTK 929
            +V AE P L SAAE  F  G  GKR RP ++ L++                         
Sbjct: 1    MVVAEVPKLASAAEYFFKMGVEGKRXRPTVLLLMATALNVPLPRPALAEVPETLSTELRT 60

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
              + +AEI EMIH ASL+HDDVLD+++ RRG  +++ + G +VAVLAGDF+ +++   LA
Sbjct: 61   RQQCIAEITEMIHVASLLHDDVLDDAETRRGIGSLNIMMGNKVAVLAGDFLLSRACVALA 120

Query: 748  NLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAI 569
            +L+N EV+ L++ V++   +GE  Q +S  +  V ME YL K+YYKTASLI+ S K  A+
Sbjct: 121  SLKNTEVVSLLATVVEHLVTGETMQMTSTSEQRVSMEYYLQKTYYKTASLISNSCKAIAL 180

Query: 568  FSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
             +G  + +S   ++YG+NLGL+FQ++DD LDFT ++  LGK + SD+  G +TAP++FA+
Sbjct: 181  LAGQTAEVSMLAFEYGKNLGLAFQLIDDXLDFTGTSASLGKGSLSDIRHGIITAPILFAI 240

Query: 388  ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPS 218
            E  P+L  +++               + R  GI             A + ++ LP S
Sbjct: 241  EEFPQLDAVVKRGLDNPADIDLALDYLGRSRGIQRTRELAMKHANLAAEAIDSLPES 297



>gb:AE014297_1142308 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003777_1224301 Drosophila melanogaster
            chromosome 3R, section 115 of 118 of the complete
            sequence.
          Length = 436

 Score =  186 bits (472), Expect = 1e-45
 Identities = 106/321 (33%), Positives = 171/321 (53%), Gaps = 4/321 (1%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIV--GAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            ++ DDL     +++ ++  G   P L + A   F   GK +RP +  L+++         
Sbjct: 116  ILDDDLKYFYDDVRYLLKSGTSQPELDTIASYYFDGQGKALRPMVTMLMAKAINYHLNNE 175

Query: 940  XXTKEH--RRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                 H  R++A   EM+H+ASL+HDDV+D+SD RRGK +V+ ++  +   +AGD++ + 
Sbjct: 176  SHQLVHKQRQIALFSEMVHSASLVHDDVIDQSDFRRGKPSVNALWNHKKVTMAGDYILSI 235

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            +S  +A L + +V  ++SQ++ D   GE  Q  S    +     YL K+Y KTASLIA +
Sbjct: 236  ASIMIARLRSDDVTIVLSQILTDLVQGEFMQLGSRETENERFAHYLTKTYRKTASLIANA 295

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
             K  A+ +  D  ++E  +QYGRN+GL+FQ+VDD+LDF  S EQ+GKP  +DL  G  TA
Sbjct: 296  LKATAVIAQADDNVAEVAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATA 355

Query: 406  PVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECL 227
            PV+FA E  P+L  ++   F            V +  G+             AI+  + L
Sbjct: 356  PVLFACEKYPELNPMVMRRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAIRLAQEL 415

Query: 226  PPSPFRVAXEEMVQYNLERVK 164
              SP++   + +    + R+K
Sbjct: 416  TESPYQKGLQVVADLVINRMK 436



>gb:AF118855_2055136 Mus musculus trans-prenyltransferase (Tpt) mRNA,
            complete cds.>gb:BC026820_2095573 Mus musculus
            trans-prenyltransferase, mRNA (cDNA clone MGC:28441
            IMAGE:4039464), complete cds.
          Length = 336

 Score =  185 bits (469), Expect = 3e-45
 Identities = 109/320 (34%), Positives = 173/320 (54%), Gaps = 1/320 (0%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            F++   DL  L ++++  +      L   +E  F   GK  RP +V L++R         
Sbjct: 17   FKLGWRDLKGLYEDIRKELHISTRELKDMSEYYFDGKGKAFRPIIVVLMARACNIHHNNA 76

Query: 940  XXTKEHRR-LAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
               +  +R +A + EMIHTA+L+HDDV+D++  RRGK TV++I+G + AVLAGD + + +
Sbjct: 77   REMQASQRSIALVAEMIHTATLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAA 136

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
            S  LA + N  V+ +++QVI+D   GE  Q  S  + +     YL K++ KTASLIA S 
Sbjct: 137  SVALARIGNTAVVSMLAQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSC 196

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            K  ++    D  + E  YQYG+N+G++FQ++DD+LDFT  ++Q+GKP  +DL  G  T P
Sbjct: 197  KAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGIATGP 256

Query: 403  VIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLP 224
            V+FA +  P++  +I   F            V +  G+             A++ +  L 
Sbjct: 257  VLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHKAVREIRKLR 316

Query: 223  PSPFRVAXEEMVQYNLERVK 164
            PS  R A  ++ +  L R K
Sbjct: 317  PSTERDALIQLSESVLTRDK 336



>gb:AE017002_376450 Bacillus cereus ATCC 14579 section 5 of 18 of the
            complete genome.>gb:AE016877_1016700 Bacillus cereus ATCC
            14579 complete genome.
          Length = 323

 Score =  184 bits (466), Expect = 6e-45
 Identities = 107/316 (33%), Positives = 170/316 (53%), Gaps = 2/316 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            ++  +  D+  + K L+  V +E P++  AA Q+  AGGKR+RP  V L  +        
Sbjct: 9    MYSFLRSDINVIEKELKKTVASEQPLVEEAALQLIEAGGKRIRPVFVLLAGKFGDYKLDA 68

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                   + +A  +E+IH ASL+HDDV+D + +RRG  TV+  +G R+A+  GD++FA+S
Sbjct: 69   I------KHVAVALELIHMASLVHDDVIDAAFLRRGSATVNAKWGDRIAMYTGDYLFAKS 122

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               + N+E  E  + +S  I +   GEI+Q    ++ D  +  YL +   KTA LIAAS 
Sbjct: 123  LECITNIEIPEAHQALSHTILEVCKGEIEQIKDKYNYDQNLRTYLRRIKRKTALLIAASC 182

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            +  AI +G +     +++ YG  +G+S+QI+DDILDF  + E+LGKPAG DL +GN+T P
Sbjct: 183  QLGAIAAGANRDTVNRLFWYGYFVGMSYQIIDDILDFVSTEEKLGKPAGGDLLQGNITLP 242

Query: 403  VIFALETEPKLRDIIES--EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
             ++A+E +P LR  I S  E             VK    I             A++ ++ 
Sbjct: 243  ALYAME-DPVLRQKITSVHENSTASEMQEIIDAVKNSTAIDQAFAFSERYLHKALEIIKP 301

Query: 229  LPPSPFRVAXEEMVQY 182
            LP    + A + + +Y
Sbjct: 302  LPRGKAKYALQNVAKY 317



>gb:AE017269_422869 Bacillus cereus ATCC 10987, section 6 of 18 of the
            complete genome.>gb:AE017194_1061288 Bacillus cereus ATCC
            10987, complete genome.
          Length = 320

 Score =  183 bits (464), Expect = 1e-44
 Identities = 107/316 (33%), Positives = 170/316 (53%), Gaps = 2/316 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            ++  +  D+  + K L+  V +E P++  AA Q+  AGGKR+RP  V L  +        
Sbjct: 6    MYSFLRSDINVIEKELKKTVASEQPLVEEAALQLIEAGGKRIRPVFVLLAGKFGDYKLDA 65

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                   + +A  +E+IH ASL+HDDV+D + +RRG  TV+  +G R+A+  GD++FA+S
Sbjct: 66   I------KHVAVALELIHMASLVHDDVIDAAFLRRGSATVNAKWGDRIAMYTGDYLFAKS 119

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               + N+E  E  + +S  I +   GEI+Q    +D D  +  YL +   KTA LIAAS 
Sbjct: 120  LECITNIEIPEAHQALSHTILEVCKGEIEQIKDKYDYDQNLRTYLRRIKRKTALLIAASC 179

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            +  AI +G +     +++ YG  +G+S+QI+DDILDF  + E+LGKPAG DL +GN+T P
Sbjct: 180  QLGAIAAGANRDTVSRLFWYGYFVGMSYQIIDDILDFVSTEEKLGKPAGGDLLQGNITLP 239

Query: 403  VIFALETEPKLRDIIES--EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
             ++A+E +P L   I+S  E             VK    I             A++ ++ 
Sbjct: 240  ALYAME-DPVLCKKIKSVHENTTADEMKEIIEAVKNSDAIDKAFAFSERYLHKALEIIKP 298

Query: 229  LPPSPFRVAXEEMVQY 182
            LP    + A + + +Y
Sbjct: 299  LPRGQAKYALQNVAKY 314



>sp|P55785|HEP2_BACST Heptaprenyl diphosphate synthase component II
            (EC 2.5.1.30) (HEPPP synthase subunit
            2).>gb:BACHEPS2_745437 Bacillus stearothermophilus DNA
            for component II of heptaprenyl diphosphate synthase,
            complete cds.
          Length = 320

 Score =  182 bits (463), Expect = 1e-44
 Identities = 98/253 (38%), Positives = 154/253 (60%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + + +++  ++DDL  + + L+  V +E   L  AA  +  AGGKR+RP  V L +R   
Sbjct: 1    MKLKAMYSFLSDDLAAVEEELERAVQSEYGPLGEAALHLLQAGGKRIRPVFVLLAARFGQ 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                     +  + +A  +E+IH ASL+HDDV+D++D+RRG+ T+   +  R A+  GD+
Sbjct: 61   YDL------ERMKHVAVALELIHMASLVHDDVIDDADLRRGRPTIKAKWSNRFAMYTGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +FA+S   +A L N    +++++ I +   GEI+Q    +  D  +  YL +   KTA L
Sbjct: 115  LFARSLERMAELGNPRAHQVLAKTIVEVCRGEIEQIKDKYRFDQPLRTYLRRIRRKTALL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IAAS +  A+ +G    I +++Y +G  +G+SFQI DDILDFT + EQLGKPAGSDL +G
Sbjct: 175  IAASCQLGALAAGAPEPIVKRLYWFGHYVGMSFQITDDILDFTGTEEQLGKPAGSDLLQG 234

Query: 418  NLTAPVIFALETE 380
            N+T PV++AL  E
Sbjct: 235  NVTLPVLYALSDE 247



>gb:AP006840_567379 Symbiobacterium thermophilum DNA, complete genome.
          Length = 331

 Score =  181 bits (460), Expect = 3e-44
 Identities = 105/321 (32%), Positives = 172/321 (53%), Gaps = 3/321 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            +F  + DDL  +   +++ +  +  +L   +  +  +GGKR+RPALV L SR        
Sbjct: 15   VFSSIADDLRQVETAIEAALSTQETMLEEVSTHLLRSGGKRIRPALVILASRFPGVEL-- 72

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                K+   +A  +E+IH A+L+HDDV+D +D+RRG+ TV+ ++  +V+VL GD++FA++
Sbjct: 73   ----KQVIDVAVAVELIHMATLVHDDVVDNADLRRGRPTVNALWNNQVSVLTGDYLFAKA 128

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               LA+  N  V++L+S+V+++ + GE+ Q +S FD +   EDY  +   KT  LIA + 
Sbjct: 129  FTLLADTGNNRVVRLMSEVVREMSQGELAQMASYFDVEQTEEDYYRRIARKTGYLIAEAC 188

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            +  A+ +GV     + +Y YG  +GLSFQI DD+LDF    E +GKP   DL  G LT P
Sbjct: 189  RLGAVMAGVGEEQVQAVYDYGMGVGLSFQIADDLLDFFGDEETVGKPVCGDLKIGILTLP 248

Query: 403  VIFALETEPK---LRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLE 233
            VI  L   P+   LR++I S              +   G               A++ L+
Sbjct: 249  VIHGLAHAPRRAELRELILSRSIDDTAVARVKEILTESGSFDYARGKAREHIEKAVRALD 308

Query: 232  CLPPSPFRVAXEEMVQYNLER 170
             +P    R A + + ++ + R
Sbjct: 309  HVPTLATRPALKTLAEFVINR 329



>gb:AF282771_1258696 Trypanosoma cruzi putative farnesyl synthetase
            mRNA, complete cds.
          Length = 363

 Score =  181 bits (459), Expect = 4e-44
 Identities = 117/358 (32%), Positives = 183/358 (51%), Gaps = 17/358 (4%)
 Frame = -1

Query: 1192 TPASSSPMLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVG-AENPVLMSAAEQIFS 1016
            T  +S+   +L  + G P      F +V  ++  + +N+  +V  + N VL   A+ +FS
Sbjct: 14   TTITSTVPSNLLTEDGRP------FAMVAREVRMMQQNMAGLVSNSNNAVLNHIAKYVFS 67

Query: 1015 AGGKRMRPALVFLVSRXX---------------XXXXXXXXXTKEHRRLAEIIEMIHTAS 881
              GK +RP LV +++                            +   RL EI E++HTA+
Sbjct: 68   VSGKMLRPTLVAMMAHALLPPHVSEQIRAESIGSIDDISSGAIRPFLRLGEITELLHTAT 127

Query: 880  LIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIK 701
            L+HDDV+D S+ RRG+ TVH +Y T+ AVLAGDF+ A++S ++A L +  V+ L+S  ++
Sbjct: 128  LVHDDVMDNSNTRRGQPTVHCLYDTKRAVLAGDFLLARASIWIAALGHSRVVLLMSTALE 187

Query: 700  DFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGV-DSGISEQMYQY 524
            D A+GE+ Q    FD    +E Y  KSY KTASLIA S    A+ +G+ ++   E   ++
Sbjct: 188  DLAAGEMMQMDGCFD----IESYEQKSYCKTASLIANSLASTAVLAGLPNTAYEEAAAKF 243

Query: 523  GRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFC 344
            G++LG++FQIVDD LD T   + LGKP  +D+A+G  T PV+ A   E ++ + +   F 
Sbjct: 244  GKHLGIAFQIVDDCLDITGDDKNLGKPKMADMAEGIATLPVLLAAREETRVYEAVRRRFK 303

Query: 343  XXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                       V+R G +              ++ L  L  SP R   E  +   L R
Sbjct: 304  NPGDTEMCMEAVERHGCVAEALEHAGEHCRRGVEALHALHTSPARDCLEAAMGLILTR 361



>gb:CP000001_852014 Bacillus cereus ZK, complete genome.
          Length = 323

 Score =  181 bits (459), Expect = 4e-44
 Identities = 106/316 (33%), Positives = 169/316 (53%), Gaps = 2/316 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            ++  +  D+  + K L+  V +E P++  AA Q+  AGGKR+RP  V L  +        
Sbjct: 9    MYSFLRSDINVIEKELKKTVASEQPLVEEAALQLIEAGGKRIRPVFVLLAGKFGDYKLDA 68

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                   + +A  +E+IH ASL+HDDV+D + +RRG  TV+  +G R+A+  GD++FA+S
Sbjct: 69   I------KHVAVALELIHMASLVHDDVIDAAFLRRGSATVNAKWGDRIAMYTGDYLFAKS 122

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               + N+E  E  + +S  I +   GEI+Q    ++ D  +  YL +   KTA LIAAS 
Sbjct: 123  LECITNIEIPEAHQALSHTILEVCKGEIEQIKDKYNYDQNLRTYLRRIKRKTALLIAASC 182

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            +  AI +G +     +++ YG  +G+S+QI+DDILDF  + E+LGKPAG DL +GN+T P
Sbjct: 183  QLGAIAAGANRDTVSRLFWYGYFVGMSYQIIDDILDFVSTEEKLGKPAGGDLLQGNITLP 242

Query: 403  VIFALETEPKLRDIIES--EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
             ++A+E +P L   I S  E             VK    I             A++ ++ 
Sbjct: 243  ALYAME-DPILCKKIRSVHENTTADEMKEIIEAVKNSASIDKAFAFSERYLHKALEMIKP 301

Query: 229  LPPSPFRVAXEEMVQY 182
            LP    + A + + +Y
Sbjct: 302  LPRGQAKYALQNVAKY 317



>gb:BA000043_738787 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 320

 Score =  181 bits (459), Expect = 4e-44
 Identities = 96/250 (38%), Positives = 153/250 (61%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + + +++  + DDL  + + L+  V +E   L  AA  +  AGGKR+RP  V L +R   
Sbjct: 1    MKLKAMYSFLNDDLAAVEEELERTVRSEYGPLGEAALHLLQAGGKRIRPVFVLLSARFGH 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                     +  + +A  +E+IH ASL+HDDV+D++D+RRG+ T+   +  R A+  GD+
Sbjct: 61   YDF------ERIKHVAVALELIHMASLVHDDVIDDADVRRGRPTIKARWSNRFAMYTGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +FA+S   +A L++    +++++ I +   GEI+Q    +  D  +  YL +   KTA L
Sbjct: 115  LFARSLERMAELDSPRAHQVLAKTIVEVCHGEIEQIKDKYRFDQPLRTYLRRIRRKTALL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IAAS +  A+ +G    ++ Q+Y +G  +G+SFQI DDILDFT + EQLGKPAGSDL +G
Sbjct: 175  IAASCQLGALAAGAPEAVANQLYWFGHCVGMSFQITDDILDFTGTEEQLGKPAGSDLQQG 234

Query: 418  NLTAPVIFAL 389
            N+T PV++AL
Sbjct: 235  NVTLPVLYAL 244



>gb:AE017225_406820 Bacillus anthracis str. Sterne, complete
            genome.>gb:AE017355_462706 Bacillus thuringiensis serovar
            konkukian str. 97-27, complete genome.
          Length = 323

 Score =  181 bits (459), Expect = 4e-44
 Identities = 106/316 (33%), Positives = 169/316 (53%), Gaps = 2/316 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            ++  +  D+  + K L+  V +E P++  AA Q+  AGGKR+RP  V L  +        
Sbjct: 9    MYSFLRSDINVIEKELKKTVASEQPLVEEAALQLIEAGGKRIRPVFVLLAGKFGDYKLDA 68

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                   + +A  +E+IH ASL+HDDV+D + +RRG  TV+  +G R+A+  GD++FA+S
Sbjct: 69   I------KHVAVALELIHMASLVHDDVIDAAFLRRGSATVNAKWGDRIAMYTGDYLFAKS 122

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               + N+E  E  + +S  I +   GEI+Q    ++ D  +  YL +   KTA LIAAS 
Sbjct: 123  LECITNIEIPEAHQALSHTILEVCKGEIEQIKDKYNYDQNLRTYLRRIKRKTALLIAASC 182

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            +  AI +G +     +++ YG  +G+S+QI+DDILDF  + E+LGKPAG DL +GN+T P
Sbjct: 183  QLGAIAAGANRDTVSRLFWYGYFVGMSYQIIDDILDFVSTEEKLGKPAGGDLLQGNITLP 242

Query: 403  VIFALETEPKLRDIIES--EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
             ++A+E +P L   I S  E             VK    I             A++ ++ 
Sbjct: 243  ALYAME-DPILCKKIRSVHENTTADEMKEIIEAVKNSAAIDKAFAFSERYLHKALEMIKP 301

Query: 229  LPPSPFRVAXEEMVQY 182
            LP    + A + + +Y
Sbjct: 302  LPRGQAKYALQNVAKY 317



>gb:AE017028_381714 Bacillus anthracis str. Ames section 5 of 18 of
            the complete genome.>gb:AE017334_451562 Bacillus
            anthracis str. 'Ames Ancestor', complete
            genome.>gb:AE016879_1011419 Bacillus anthracis str. Ames
            complete genome.
          Length = 320

 Score =  181 bits (459), Expect = 4e-44
 Identities = 106/316 (33%), Positives = 169/316 (53%), Gaps = 2/316 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            ++  +  D+  + K L+  V +E P++  AA Q+  AGGKR+RP  V L  +        
Sbjct: 6    MYSFLRSDINVIEKELKKTVASEQPLVEEAALQLIEAGGKRIRPVFVLLAGKFGDYKLDA 65

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                   + +A  +E+IH ASL+HDDV+D + +RRG  TV+  +G R+A+  GD++FA+S
Sbjct: 66   I------KHVAVALELIHMASLVHDDVIDAAFLRRGSATVNAKWGDRIAMYTGDYLFAKS 119

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               + N+E  E  + +S  I +   GEI+Q    ++ D  +  YL +   KTA LIAAS 
Sbjct: 120  LECITNIEIPEAHQALSHTILEVCKGEIEQIKDKYNYDQNLRTYLRRIKRKTALLIAASC 179

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            +  AI +G +     +++ YG  +G+S+QI+DDILDF  + E+LGKPAG DL +GN+T P
Sbjct: 180  QLGAIAAGANRDTVSRLFWYGYFVGMSYQIIDDILDFVSTEEKLGKPAGGDLLQGNITLP 239

Query: 403  VIFALETEPKLRDIIES--EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
             ++A+E +P L   I S  E             VK    I             A++ ++ 
Sbjct: 240  ALYAME-DPILCKKIRSVHENTTADEMKEIIEAVKNSAAIDKAFAFSERYLHKALEMIKP 298

Query: 229  LPPSPFRVAXEEMVQY 182
            LP    + A + + +Y
Sbjct: 299  LPRGQAKYALQNVAKY 314



>gb:BX950851_839440 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 323

 Score =  180 bits (457), Expect = 7e-44
 Identities = 102/328 (31%), Positives = 173/328 (52%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  +  + T D+  +NK +   + ++  ++      I S GGKR+RP +  L +R   
Sbjct: 1    MNLEQITTLTTQDMAAVNKVILEQLNSDVVLINQLGHYIISGGGKRIRPMIAVLAARALA 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      +H  +A +IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GDF
Sbjct: 61   YNGD------KHVTVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   + +LE++ V+ L+S+ +   A GE+ Q  +  D D+  E Y+   Y KTA L
Sbjct: 115  IYTRAFQMMTSLESLRVLALMSEAVNVIAEGEVLQLMNCNDPDITEESYMRVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ + ++I +G      + +  YGR LG +FQ++DD+LD++   + LGK  G DL +G
Sbjct: 175  FEAAAQSSSILAGATPEQEKALQDYGRYLGTAFQLIDDLLDYSADGKTLGKNTGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R  IE E             +++CG +            
Sbjct: 235  KPTLPLLHAMRQGNAEQSSLIRQAIE-EGNGRHLLEPILAAMQQCGSLDYTRQRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L+ LP +P+R+A E +    ++R
Sbjct: 294  KAINALQLLPKTPYRMALEGLAHLAVQR 321



>gb:AE017340_456239 Idiomarina loihiensis L2TR, complete genome.
          Length = 324

 Score =  180 bits (457), Expect = 7e-44
 Identities = 102/329 (31%), Positives = 180/329 (54%), Gaps = 5/329 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + + S+  +  DD+L +N  +   + ++  ++      I ++GGKR+RP L  L  R   
Sbjct: 2    MDMQSINALAKDDMLGVNALIGEQLQSDVALINQLGLYIVNSGGKRLRPLLAILACRALG 61

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      +HR+LA IIE IHTA+L+HDDV+DES++RRG++T + ++G   +VL GDF
Sbjct: 62   YEG------NDHRKLATIIEFIHTATLLHDDVVDESELRRGRKTANAVFGNEASVLVGDF 115

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   + +L+++ ++++++      + GE+ Q  +  D D     Y    Y KTA L
Sbjct: 116  LYTRAFQLMVDLDSLRILRILADATNIISEGEVLQLMNCNDPDTSEASYFNVIYGKTAKL 175

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+T+ A + +  D  +++Q+  YGR LG +FQ+VDD++D+T  +E +GK AG DLA+G
Sbjct: 176  FEAATELAGVLTAQDEKVTQQLADYGRYLGTAFQLVDDLMDYTADSESMGKNAGDDLAEG 235

Query: 418  NLTAPVIFAL----ETEPKL-RDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P+++A+    E E KL R+ IE +             ++R G +            
Sbjct: 236  KPTLPLLYAMWHGNEIEQKLIREAIE-QGDGREHLQTVLTAMERTGALQYTRDKALEAAE 294

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLERV 167
             A ++L  LP S ++ A   +    ++RV
Sbjct: 295  QARESLSELPDSDYKQALLTLTHLAVDRV 323



>gb:BX640437_812968 Bordetella bronchiseptica strain RB50, complete
            genome; segment 1/16.
          Length = 321

 Score =  178 bits (451), Expect = 3e-43
 Identities = 90/261 (34%), Positives = 156/261 (59%), Gaps = 1/261 (0%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  L   + DD+  ++  ++  + ++  ++ +  + I  AGGKRMRPA+V +V+R   
Sbjct: 1    MNLPELIAPIADDMKAVDAVIRDRLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H+ LA ++E IHTA+L+HDDV+DESD+RRG++T + ++G   +VL GD+
Sbjct: 61   YQGT------HHQLLAAVVEFIHTATLLHDDVVDESDLRRGRDTANAVFGNAASVLVGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++++S   +   +++ +++++SQ     A GE+ Q  ++ D DV  E YL    YKTA L
Sbjct: 115  LYSRSFEMMVEADSMRIMQILSQATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ +  A+ +G           YGR++G +FQ+VDD+LD++  A  LGK  G DL +G
Sbjct: 175  FEAAAQVGAVLAGASPEQETAAAAYGRHVGAAFQLVDDVLDYSGDAHALGKNVGDDLREG 234

Query: 418  NLTAPVIFALET-EPKLRDII 359
              T P+I  +ET  P+ R++I
Sbjct: 235  KPTLPLIRVMETGTPEQRELI 255



>gb:BX640413_805185 Bordetella pertussis strain Tohama I, complete
            genome; segment 3/12.
          Length = 321

 Score =  178 bits (451), Expect = 3e-43
 Identities = 90/261 (34%), Positives = 156/261 (59%), Gaps = 1/261 (0%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  L   + DD+  ++  ++  + ++  ++ +  + I  AGGKRMRPA+V +V+R   
Sbjct: 1    MNLPELIAPIADDMKAVDTVIRDRLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H+ LA ++E IHTA+L+HDDV+DESD+RRG++T + ++G   +VL GD+
Sbjct: 61   YQGT------HHQLLAAVVEFIHTATLLHDDVVDESDLRRGRDTANAVFGNAASVLVGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++++S   +   +++ +++++SQ     A GE+ Q  ++ D DV  E YL    YKTA L
Sbjct: 115  LYSRSFEMMVEADSMRIMQILSQATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ +  A+ +G           YGR++G +FQ+VDD+LD++  A  LGK  G DL +G
Sbjct: 175  FEAAAQVGAVLAGASPEQETAAAAYGRHVGTAFQLVDDVLDYSGDAHALGKNVGDDLREG 234

Query: 418  NLTAPVIFALET-EPKLRDII 359
              T P+I  +ET  P+ R++I
Sbjct: 235  KPTLPLIRVMETGTPEQRELI 255



>gb:BX640423_808567 Bordetella parapertussis strain 12822, complete
            genome; segment 1/14.
          Length = 321

 Score =  177 bits (450), Expect = 4e-43
 Identities = 90/261 (34%), Positives = 155/261 (59%), Gaps = 1/261 (0%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  L   + DD+  ++  ++  + ++  ++ +  + I  AGGKRMRPA+V +V+R   
Sbjct: 1    MNLPELIAPIADDMKAVDAVIRDRLNSDVVLIRTIGDYIIGAGGKRMRPAMVLMVARALG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H+ LA ++E IHTA+L+HDDV+DESD+RRG++T + ++G   +VL GD+
Sbjct: 61   YQGT------HHQLLAAVVEFIHTATLLHDDVVDESDLRRGRDTANAVFGNAASVLVGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++++S   +   +++ +++++SQ     A GE+ Q  ++ D DV  E YL    YKTA L
Sbjct: 115  LYSRSFEMMVEADSMRIMQILSQATTVIAEGEVLQLLNVHDPDVSQERYLQVVRYKTAKL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ +  A+ +G           YGR +G +FQ+VDD+LD++  A  LGK  G DL +G
Sbjct: 175  FEAAAQVGAVLAGASPEQETAAAAYGRRVGTAFQLVDDVLDYSGDAHALGKNVGDDLREG 234

Query: 418  NLTAPVIFALET-EPKLRDII 359
              T P+I  +ET  P+ R++I
Sbjct: 235  KPTLPLIRVMETGTPEQRELI 255



>sp|P31114|HEP2_BACSU Heptaprenyl diphosphate synthase component II
            (EC 2.5.1.30) (HEPPP synthase subunit 2) (Spore
            germination protein C3).>pir|E69630|E69630 heptaprenyl
            diphosphate synthase component II gerCC - Bacillus
            subtilis>gb:BACVARGNS_746634 Bacillus subtilis dbpA gene,
            complete sequence; MtrA (mtrA), MtrB (mtrB), GerC1
            (gerC1), GerC2 (gerC2), GerC3 (gerC3), Ndk (ndk), CheR
            (cheR), AroF (aroF), AroB (aroB), AroH (aroH), TrpE
            (trpE), and TrpD (trpD) genes, complete cds; trpC gene,
            complete sequence; and TrpF (trpF), TrpB (trpB), TrpA
            (trpA), HisH (hisH), TyrA (tyrA), and AroE (aroE) genes,
            complete cds.>gb:BSUB0012_754239 Bacillus subtilis
            complete genome (section 12 of 21): from 2207806 to
            2409180.
          Length = 348

 Score =  177 bits (450), Expect = 4e-43
 Identities = 105/316 (33%), Positives = 167/316 (52%), Gaps = 3/316 (0%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            +  + DD+  + + L+  V ++ P+L  A   +  AGGKR+RP  V L            
Sbjct: 35   YSFLNDDIDVIERELEQTVRSDYPLLSEAGLHLLQAGGKRIRPVFVLL------SGMFGD 88

Query: 940  XXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSS 761
                + + +A  +EMIH ASL+HDDV+D++++RRGK T+   +  R+A+  GD+M A S 
Sbjct: 89   YDINKIKYVAVTLEMIHMASLVHDDVIDDAELRRGKPTIKAKWDNRIAMYTGDYMLAGSL 148

Query: 760  WYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTK 581
              +  +   +  +++SQ I +   GEI+Q    ++ +  +  YL +   KTA LIA S +
Sbjct: 149  EMMTRINEPKAHRILSQTIVEVCLGEIEQIKDKYNMEQNLRTYLRRIKRKTALLIAVSCQ 208

Query: 580  GAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPV 401
              AI SG D  I + +Y +G  +G+S+QI+DDILDFT + E+LGKP G DL +GN+T PV
Sbjct: 209  LGAIASGADEKIHKALYWFGYYVGMSYQIIDDILDFTSTEEELGKPVGGDLLQGNVTLPV 268

Query: 400  IFALETEPKLRD---IIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            ++AL+  P L++   +I SE             +K+   I             A Q L  
Sbjct: 269  LYALK-NPALKNQLKLINSE-TTQEQLEPIIEEIKKTDAIEASMAVSEMYLQKAFQKLNT 326

Query: 229  LPPSPFRVAXEEMVQY 182
            LP    R +   + +Y
Sbjct: 327  LPRGRARSSLAAIAKY 342



>gb:AE017333_448251 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_858061 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 320

 Score =  177 bits (449), Expect = 6e-43
 Identities = 100/320 (31%), Positives = 175/320 (54%), Gaps = 1/320 (0%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + + + +  + DD+  + K L+  V ++ P+L  A+  +  AGGKR+RP  V L      
Sbjct: 1    MKLTTFYSFLNDDIELIEKELEKTVHSDYPLLSEASLHLLQAGGKRIRPVFVLL------ 54

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      + + +A  +E+IH ASL+HDDV+D++++RRG+ T+   +  R+A+  GD+
Sbjct: 55   SGMFGEYDISKIKNVAVSLELIHMASLVHDDVIDDAELRRGQPTIKAKWDNRIAMYTGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +FA+S   +  +   +  +++S+ I +   GEI+Q    ++ +  +  YL +   KTA L
Sbjct: 115  LFARSLEAMTKINEPKAHEILSKAIVEVCLGEIEQIKDKYNMEQNLRTYLRRIRRKTALL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IA+S +  AI +G    I + +Y +G  +G+S+QI+DDILDFT S ++LGKP GSDL +G
Sbjct: 175  IASSCQLGAIAAGAGENIHKTLYWFGYYVGMSYQIIDDILDFTSSEKELGKPVGSDLLQG 234

Query: 418  NLTAPVIFALET-EPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQ 242
            N+T PV++A ++ E K R ++ +              +K+   I             A +
Sbjct: 235  NVTLPVLYARKSPELKARLMLVNSETTPEQIKPVIEELKKTDAIEQSFRVSEMYLNKAFE 294

Query: 241  NLECLPPSPFRVAXEEMVQY 182
             LE LP +  R A  ++ +Y
Sbjct: 295  LLETLPKNRARTALGQIAKY 314



>gb:CR382125_1657987 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 477

 Score =  177 bits (448), Expect = 8e-43
 Identities = 112/302 (37%), Positives = 157/302 (51%), Gaps = 47/302 (15%)
 Frame = -1

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
            + RRLAEI+EMIHTASL+HDDV+D SD RRG+ + +  +  ++AVLAGDFM  +++  ++
Sbjct: 176  KQRRLAEIVEMIHTASLLHDDVIDHSDTRRGRPSGNIAFTNKMAVLAGDFMLGRATVAIS 235

Query: 748  NLENIEVIKLISQVIKDFASGEIKQASSL----------------------FDC------ 653
             L N EV++L+S  I +   GE  Q  +                       F+       
Sbjct: 236  RLRNPEVVELVSNSIANLVEGEFMQLKNTAIDADHTTFNNGTQHIPPPPTKFELTEHEYR 295

Query: 652  ------------------DVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQ 527
                              D+  + YL K+Y KTA+LI+ S + AA+ SGV   I E+ Y+
Sbjct: 296  VPTSSTTNGTQLSHDQLVDMAFDYYLHKTYLKTAALISKSCRAAAVLSGVRDPIIEECYE 355

Query: 526  YGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEF 347
            +G+NLG+ FQ+VDD+LDFT SA+ LGKPAG+DL  G  TAPV+FA   +P L  +I+  F
Sbjct: 356  FGKNLGICFQLVDDMLDFTISAKDLGKPAGADLELGIATAPVLFAWREDPSLGPLIKRNF 415

Query: 346  CXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL-ECLPPSPFRVAXEEMVQYNLER 170
                        VK+  G+             A+QNL   LP S  R A E +    L R
Sbjct: 416  SNPGDVEAAALAVKKYDGVGKTNELAKDYCNKALQNLRNGLPNSDARSALEFLTNSVLTR 475

Query: 169  VK 164
             K
Sbjct: 476  RK 477



 Score = 42.4 bits (98), Expect = 0.029
 Identities = 19/49 (38%), Positives = 35/49 (71%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSR 968
            +V++++ TL KN+ +++G+ +P+L   +   F A GK++RP LV L+SR
Sbjct: 51   LVSNEMNTLAKNIVTLIGSGHPLLNRISGYYFEAEGKKVRPMLVLLLSR 99



>gb:AY142889_592072 Heliobacillus mobilis Farnesyl pyrophosphate
            synthetase gene, partial cds.
          Length = 320

 Score =  177 bits (448), Expect = 8e-43
 Identities = 110/316 (34%), Positives = 161/316 (50%), Gaps = 2/316 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            LF+ + +DL  +   L        P L +A+  +  AGGKR+RPA V L  R        
Sbjct: 5    LFQDIQNDLAKVEAELAKYADTSLPTLTAASSHLLHAGGKRLRPAFVLLAGRFHNYSLER 64

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                     LA  +EMIH ASL+HDDV+DES  RRG  TV   +G R+++  GD +FA+S
Sbjct: 65   LLP------LAVAMEMIHMASLVHDDVVDESKTRRGIPTVKARWGNRISIHTGDHLFARS 118

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               +A L + ++ +++++V  +   GEI+Q S  FD +    DYL     KTA LI+AS 
Sbjct: 119  LLLIAELNDDKISEVLAKVSVEMCKGEIQQMSGTFDVNQTFRDYLFHIKRKTALLISASC 178

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            +  A+    D  I   +  YG +LG++FQ+ DDILD T    +LGKP GSDL +G +T P
Sbjct: 179  QLGAMAVKADPSIVRALKMYGHHLGMAFQVTDDILDLTADEAELGKPVGSDLRQGIITLP 238

Query: 403  VIFAL-ET-EPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            ++ AL ET +P LR ++                +K  G I             A   L+ 
Sbjct: 239  ILEALWETKDPLLRLLVAKRDKSQEEVGQAIEIIKNSGAIDRSQKIARRYLEKAKDELKR 298

Query: 229  LPPSPFRVAXEEMVQY 182
            LPP P R +   + ++
Sbjct: 299  LPPVPTRDSLASIAEF 314



>pir|E83856|E83856 heptaprenyl diphosphate synthase component II
            (spore germination protein C3) gerCC [imported] -
            Bacillus halodurans (strain C-125)>gb:BA000004_655599
            Bacillus halodurans C-125 DNA, complete genome.
          Length = 323

 Score =  177 bits (448), Expect = 8e-43
 Identities = 90/261 (34%), Positives = 153/261 (58%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + +A ++    +D+ T+ + L+  V A + +L  A+  +  AGGKR+RP  V L  +   
Sbjct: 1    MKLADIYAHFQEDIFTIERELEEAVQARHDILRKASVHLLKAGGKRIRPVFVLLAGKFGT 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                        + +A  +E+IH ASL+HDDV+D++D+RRGK+T+   +  R+A+  GD+
Sbjct: 61   YDVNVL------KHIAVPLELIHMASLVHDDVIDDADLRRGKKTIKSQWDNRIAMYTGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            MFA++       ++  + ++IS  I +   GE++Q    ++ +  +  Y  +   KTA L
Sbjct: 115  MFAKAVQTATYFDDPNIHQIISNAINEMCLGEVEQIRDQYNPNQHLRIYFRRIKRKTALL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IA S +  A+ +  D  I +++Y +G  +G+SFQI DD+LDF  + EQLGKPAGSDL +G
Sbjct: 175  IAVSCQLGALAAKADPAIVQKLYYFGYYVGMSFQITDDVLDFVGTEEQLGKPAGSDLLQG 234

Query: 418  NLTAPVIFALETEPKLRDIIE 356
            N+T P ++AL  +   + +IE
Sbjct: 235  NVTLPALYALHHDMHAKRLIE 255



>gb:CR382134_1667061 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 483

 Score =  176 bits (445), Expect = 2e-42
 Identities = 108/299 (36%), Positives = 150/299 (50%), Gaps = 44/299 (14%)
 Frame = -1

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
            + RRLAEI+EMIHTASL+HDDV+D SD RRG+ + +  +  ++AVLAGDF+  ++S  +A
Sbjct: 185  KQRRLAEIVEMIHTASLLHDDVIDLSDTRRGRPSGNIAFSNKMAVLAGDFLLGRASVAIA 244

Query: 748  NLENIEVIKLISQVIKDFASGEIKQASSLFDCDVG------------------------- 644
             L N EVI+L+S  I +   GE  Q  +    + G                         
Sbjct: 245  RLRNPEVIELLSTTIANLVEGEFMQLKNTVMSNEGPDSITNDGDIKNIPKATGKVPTVEH 304

Query: 643  -------------------MEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYG 521
                                E YL K+Y KTASL++  ++ A + SG    I E  Y +G
Sbjct: 305  EYSVTAPGEVDHNTNVSAAFEYYLHKTYLKTASLMSKLSRAAGVLSGSQDNIIENCYDFG 364

Query: 520  RNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCX 341
            RNLGL FQIVDD+LD+T S    GKP+ +DL  G  TAP++FA +  P+L ++I  +F  
Sbjct: 365  RNLGLCFQIVDDMLDYTSSDTSFGKPSQADLKLGLATAPILFAWKERPELGELIARKFGE 424

Query: 340  XXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                      V+ CGG+             A++NL  LP S  R A E +    L R K
Sbjct: 425  EGDVEVARKAVEECGGLEKTREMAQDYCYKALENLRVLPESDARSALEFLTNSVLTRSK 483



>gb:AF153713_483851 Pseudomonas sp. BG33R strain BG33R octylprenyl
            diphosphate synthase-like protein gene, complete cds.
          Length = 322

 Score =  176 bits (445), Expect = 2e-42
 Identities = 108/322 (33%), Positives = 169/322 (52%), Gaps = 3/322 (0%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            + +  V DD   ++  ++  + ++ P++    + I SAGGKR+RP LV L  +       
Sbjct: 5    AFYRAVADDFSAVDGIIKQQLTSKVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGD 64

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                  + R LA  IE +HTA+L+HDDV+D S MRRG+ET + ++G   +VL GDFM+++
Sbjct: 65   ------DLRLLAATIEFLHTATLLHDDVVDMSGMRRGRETANAMWGNAPSVLVGDFMYSR 118

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S   +  L ++ V+K++SQ  +  A GE+ Q S + D     E Y+     KTA    AS
Sbjct: 119  SFEMMVELGSMPVMKILSQATRIIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMFFEAS 178

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            T  AA   G  +  +E +  +G NLG++FQ+VDD+LD+   AE LGK  G DLA+G  T 
Sbjct: 179  THSAAALCGATAEQAEALRTFGDNLGVAFQLVDDLLDYKGDAETLGKNVGDDLAEGKPTL 238

Query: 406  PVIFAL-ETEPKLRDIIES--EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            P+I+ + E  P+   ++    +             V+  G +             AIQ L
Sbjct: 239  PLIYTMREGTPEQAALVRKAIQKGGIEDLEAIRAAVEASGSLEYTAQLARDYVARAIQCL 298

Query: 235  ECLPPSPFRVAXEEMVQYNLER 170
            E LP S +R A  E+ ++ + R
Sbjct: 299  EALPASEYRDALVELSEFAVAR 320



>pir|AB1316|AB1316 heptaprenyl diphosphate synthase component II
            (menaquinone biosynthesis) homolog lmo1930 [imported] -
            Listeria monocytogenes (strain EGD-e)>gb:AL591981_536421
            Listeria monocytogenes strain EGD, complete genome,
            segment 9/12.
          Length = 321

 Score =  176 bits (445), Expect = 2e-42
 Identities = 91/247 (36%), Positives = 151/247 (61%), Gaps = 1/247 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQ-SIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            L+  +  D+ ++ K L+ ++ GA      +AA  +  AGGKR+RP  V L +R       
Sbjct: 6    LYANMQKDIDSVEKELKKALSGAAADTTSAAALHLLEAGGKRIRPMFVCLSARLAANADF 65

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                    +  +  IE+IH AS++HDDV+D++D+RRG+ET+   +G  +A+  GDF+FA+
Sbjct: 66   NAV-----KNASVAIELIHMASIVHDDVVDDADLRRGRETIKSKWGNHIAMYTGDFLFAK 120

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S  Y+  ++++   K++S V  + ++GEI+Q    ++ D  + +YL +   KTA LIAAS
Sbjct: 121  SLEYMTEIKDVAAHKMLSHVTVELSTGEIEQLKDKYNFDQSVRNYLRRIKRKTALLIAAS 180

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
                 + SG      +++Y++G  +G++FQI DD+LDF  + ++LGKPAG DL +GN+T 
Sbjct: 181  CGLGGVVSGQSEADYQKLYRFGYYVGMAFQITDDVLDFVGTEKELGKPAGEDLRQGNVTL 240

Query: 406  PVIFALE 386
            PV FA+E
Sbjct: 241  PVFFAME 247



>gb:CR555306_107964 Azoarcus sp. EbN1 complete genome.
          Length = 322

 Score =  175 bits (444), Expect = 2e-42
 Identities = 100/328 (30%), Positives = 172/328 (52%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S   L+  +  D+  ++  ++  + ++  ++   AE I  +GGKR+RPALV        
Sbjct: 1    MSTQQLYAPIATDMQAVDAVIRERLHSDVVLIRQVAEYIIHSGGKRLRPALVLF------ 54

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                     + H +LA ++E IHTA+L+HDDV+DES++RRG +T + ++G   +VL GDF
Sbjct: 55   SAGAMGYRGQSHHQLAAVVEFIHTATLLHDDVVDESELRRGNKTANALFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   +  + ++ V+++++      A GE+ Q  +  + DV +EDYL    YKTA L
Sbjct: 115  LYTRAFQMMVGVGDMRVMQVLADATNIIAEGEVLQLLNCHNADVDIEDYLRVIRYKTAKL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+T+  AI  G +     ++  +G +LG +FQI+DD+LD++      GK  G DLA+G
Sbjct: 175  FEAATRLGAILGGANEEQERKVAAFGMHLGTAFQIIDDVLDYSSDEAATGKHLGDDLAEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P+I A+     E   ++R+ IES              ++  G +            
Sbjct: 235  KPTLPLIHAMKHGTAEQSARVRNAIESG--GRDDFEAVLAAIRETGALEEARRWARAEGQ 292

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  LE LPPS F+ A  ++  + + R
Sbjct: 293  FAIDALEVLPPSIFKDALLQLSDFAVVR 320



>gb:BX571874_789398 Photorhabdus luminescens subsp. laumondii TTO1
            complete genome; segment 16/17.
          Length = 323

 Score =  175 bits (443), Expect = 3e-42
 Identities = 101/329 (30%), Positives = 171/329 (51%), Gaps = 5/329 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++ ++ ++  DD+  +N+ + S + ++  ++      I S GGKR+RP +  L SR   
Sbjct: 1    MNLETIIKLTADDMAAVNETILSQLNSDVTLINQLGYYIISGGGKRIRPIIAILASRVLG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      +H  +A +IE IHTA+L+HDDV+DESDMRRGK T + ++G   +VL GDF
Sbjct: 61   YQGD------KHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAMFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ +S   +  L ++ V+KL+S+     A GE+ Q  +  D ++  +DY+   Y KTA L
Sbjct: 115  IYTRSFQMMTALNSMRVLKLMSEATNVIAEGEVLQLMNCNDPNISEDDYMRVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
               +   +AI S         +  YGR LG +FQ++DD+LD+   ++ LGK  G DL +G
Sbjct: 175  FEVAAHSSAILSNATPEQEMALQNYGRYLGTAFQLIDDLLDYNADSDTLGKNTGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R+ IE +             +K+CG +            
Sbjct: 235  KPTLPLLHAMNHGTPEQSALIREAIE-KGNGRHLLETVLTTMKQCGSLEYTRKRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLERV 167
             AI  L+ L  SP++ A   +    ++R+
Sbjct: 294  KAIAALQALENSPYKQALVGLAHIAVQRL 322



>gb:SME591785_184864 Sinorhizobium meliloti 1021 complete chromosome;
            segment 4/12.
          Length = 338

 Score =  175 bits (443), Expect = 3e-42
 Identities = 103/340 (30%), Positives = 172/340 (50%), Gaps = 5/340 (1%)
 Frame = -1

Query: 1171 MLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRP 992
            ++ L+ +     SV  L ++   D+  +N+ + S  G++  ++   A  + S+GGKR+RP
Sbjct: 4    VIPLEDNKNKQASVKPLVDLTLSDMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRP 63

Query: 991  ALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIY 812
             L    +               H +LA  +E +HTA+L+HDDV+DESD+RRGK T   I+
Sbjct: 64   MLTLAAASMFGYEGDG------HIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIW 117

Query: 811  GTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDY 632
            G + +VL GDF+  Q+   + ++ +I+ + ++S      A GE+ Q S   + +   +DY
Sbjct: 118  GNQASVLVGDFLLGQAFRMMVDVGSIDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDY 177

Query: 631  LIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQL 452
            L     KTA+L AA+++   I +G        +  YG NLGL+FQ+VDD+LD+  ++  L
Sbjct: 178  LQVIRAKTAALFAAASEVGPIVAGGSKADRNALKSYGTNLGLAFQLVDDVLDYGGTSSDL 237

Query: 451  GKPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIX 287
            GK  G D  +G +T PVI +      +     R+ IE               ++R GG+ 
Sbjct: 238  GKNVGDDFREGKITLPVILSYRRGTPQDRAFWREAIEGGASDAANLEKALGLIRRYGGLT 297

Query: 286  XXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                        A   L  LP SP++ A  E++ + ++RV
Sbjct: 298  DTIARAKHYGTIARDALAPLPASPWKSALVEVIDFCIDRV 337



>pir|AB1688|AB1688 heptaprenyl diphosphate synthase component II
            (menaquinone biosynthesis) homolog lin2044 [imported] -
            Listeria innocua  (strain Clip11262)>gb:AL596170_539388
            Listeria innocua Clip11262 complete genome, segment 8/12.
          Length = 321

 Score =  174 bits (442), Expect = 4e-42
 Identities = 91/247 (36%), Positives = 149/247 (60%), Gaps = 1/247 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQ-SIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            L+  +  D+  + K L+ ++ GA       AA  +  AGGKR+RP  V L +R       
Sbjct: 6    LYPNMQKDIDLVEKELKRALTGAAAETTSDAALHLLEAGGKRIRPMFVCLSARLSPDADF 65

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                    +     IE+IH AS++HDDV+D++D+RRG+ET+   +G  +A+  GDF+FA+
Sbjct: 66   EAV-----KNAGVAIELIHMASIVHDDVVDDADLRRGRETIKSKWGNHIAMYTGDFLFAK 120

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S  Y+  ++++   K++S V  + ++GEI+Q    ++ D  + +YL +   KTA LIAAS
Sbjct: 121  SLEYMTEIKDVAAHKMLSHVTVELSTGEIEQLKDKYNFDQSVRNYLRRIKRKTALLIAAS 180

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
                 + SG      +++Y++G  +G++FQI DD+LDF  + ++LGKPAG DL++GN+T 
Sbjct: 181  CGLGGVVSGQSEADYKKLYRFGYYVGMAFQITDDVLDFVGTEKELGKPAGEDLSQGNVTL 240

Query: 406  PVIFALE 386
            PV FA+E
Sbjct: 241  PVFFAME 247



>gb:BA000031_705787 Vibrio parahaemolyticus RIMD 2210633 DNA,
            chromosome 1, complete sequence.
          Length = 333

 Score =  174 bits (441), Expect = 5e-42
 Identities = 102/334 (30%), Positives = 171/334 (51%), Gaps = 5/334 (1%)
 Frame = -1

Query: 1150 SGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVS 971
            +G  +   ++  +  DD+  +N+ +Q+ + ++  ++      I S GGKR+RP L  L +
Sbjct: 7    AGYTMDFKTIQALTADDMAKVNETIQAQLNSDVSLINQLGFYIVSGGGKRLRPLLAILSA 66

Query: 970  RXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVL 791
            R              H   A  IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL
Sbjct: 67   RALGYQGTG------HTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVL 120

Query: 790  AGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYK 611
             GDF++ +S   +  L ++++++L+S  +   A GE++Q  +  D D   E Y+   Y K
Sbjct: 121  VGDFIYTRSFQMMTELGSMKILQLMSNAVNVIAEGEVQQLMNCNDPDTTEESYMQVIYSK 180

Query: 610  TASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSD 431
            TA L  ++T+  AI +     +   +  YG+ LG +FQ++DD++D+T   E +GK  G D
Sbjct: 181  TARLFESATQIGAILNDAPEHVELALQNYGKYLGTAFQLIDDVMDYTSDGEDMGKNVGDD 240

Query: 430  LAKGNLTAPVIFAL-ETEPK----LRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXX 266
            LA+G  T P++ A+  T P+    +R+ IE +             +K  G +        
Sbjct: 241  LAEGKPTLPLLHAMRNTTPENALMIREAIE-KANGMERLDEILAVMKEAGSLEYTTQKAL 299

Query: 265  XXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                 AI  LE LP S ++ A   +    ++R +
Sbjct: 300  EEADKAIAELEVLPESEYKEALITLAHVAVKRTR 333



>gb:AP006627_564208 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 323

 Score =  174 bits (441), Expect = 5e-42
 Identities = 94/261 (36%), Positives = 147/261 (56%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + +A +++    D+  +   L+  + A++PVL  A+  +  AGGKR+RP LV L  +   
Sbjct: 1    MKLADIYKAFQGDIEFIEAELERTLSAKHPVLKEASTGLLKAGGKRIRPVLVLLAGKFGD 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                        + +A  +E+IH  SL+HDDV+D + +RRG+ETV   +  RVA+  GD+
Sbjct: 61   YQLDRL------KHIAVTLELIHMGSLVHDDVIDNAPLRRGRETVMSRWDNRVAMYTGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +F  +        +  V  +IS V+     GEI+Q    ++ D G+  YL +   KTA L
Sbjct: 115  IFGHAIETTKAFSDKRVHTIISDVMNQICRGEIEQIRDQYNWDQGLRIYLRRIKRKTALL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IA S +  AI SG    + + +Y +   LG+S+QI+DDILDF  + EQLGKPAG DL +G
Sbjct: 175  IAVSCQLGAIVSGATDELQKNLYYFAYFLGMSYQIMDDILDFVGTNEQLGKPAGGDLRQG 234

Query: 418  NLTAPVIFALETEPKLRDIIE 356
            N+T P ++A+E  P  +  +E
Sbjct: 235  NVTLPALYAIEHTPGFKQRLE 255



>gb:AE017328_444380 Listeria monocytogenes str. 4b F2365, section 7 of
            10 of the complete genome.>gb:AE017262_1076736 Listeria
            monocytogenes str. 4b F2365, complete genome.
          Length = 321

 Score =  174 bits (440), Expect = 6e-42
 Identities = 91/247 (36%), Positives = 149/247 (60%), Gaps = 1/247 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQ-SIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            L+  +  D+ ++ K L+ ++ GA       AA  +  AGGKR+RP  V L +R       
Sbjct: 6    LYANMQKDIDSVEKELKKALSGAAAETTSDAALHLLEAGGKRIRPMFVCLSARLAPNADF 65

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                    +  +  IE+IH AS++HDDV+D +D+RRG+ET+   +G  +A+  GDF+FA+
Sbjct: 66   DAV-----KNASVAIELIHMASIVHDDVVDNADLRRGRETIKSKWGNHIAMYTGDFLFAK 120

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S  Y+  ++++   K++S V  + ++GEI+Q    ++ D  + +YL +   KTA LIAAS
Sbjct: 121  SLEYMTEIKDVAAHKMLSHVTVELSTGEIEQLKDKYNFDQSVRNYLRRIKRKTALLIAAS 180

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
                 + SG      +++Y++G  +G++FQI DD+LDF  + ++LGKPAG DL +GN+T 
Sbjct: 181  CGLGGVVSGQSEADYQKLYRFGYYVGMAFQITDDVLDFVGTEKELGKPAGEDLRQGNVTL 240

Query: 406  PVIFALE 386
            PV FA+E
Sbjct: 241  PVFFAME 247



>gb:CR380949_1649593 Candida glabrata strain CBS138 chromosome C
            complete sequence.
          Length = 471

 Score =  173 bits (439), Expect = 8e-42
 Identities = 107/300 (35%), Positives = 157/300 (52%), Gaps = 45/300 (15%)
 Frame = -1

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
            + RRLAEI+EMIHTASL+HDDV+D SD RRG+ + +  +  ++AVLAGDF+  +++  ++
Sbjct: 172  KQRRLAEIVEMIHTASLLHDDVIDYSDTRRGRPSGNVAFSNKMAVLAGDFLLGRATVAIS 231

Query: 748  NLENIEVIKLISQVIKDFASGEIKQASSLFDCD--------------------------- 650
             L+N EV++L+S  I +   GE  Q  ++   D                           
Sbjct: 232  RLKNPEVVELMSNSIANLVEGEFMQLKNMAVEDQPLVGSKNDKILPPPSKKLELKEHDYR 291

Query: 649  -----------------VGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYG 521
                             +  E YL K+Y KTA+LI+ S++ AAI SG    + E+ Y +G
Sbjct: 292  VATPEATGSFSHEEVINIAFEYYLHKTYLKTAALISKSSRAAAILSGARDPVIEECYSFG 351

Query: 520  RNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCX 341
            RN+G+ FQ+VDD+LDF+ SA+ LGKPAG+DL  G  TAPV+FA + +P L  +I+  F  
Sbjct: 352  RNIGICFQLVDDLLDFSVSAKDLGKPAGADLKLGIATAPVLFAWKEDPSLGPLIKRNFSE 411

Query: 340  XXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLE-CLPPSPFRVAXEEMVQYNLERVK 164
                      V+   G+             A+QNL+  LP S  R A E +    + R K
Sbjct: 412  PGDVEKTVKSVQDHDGVGKTMEFAKEYRNKALQNLKNALPESDCRSALEFLTNSIVTRKK 471



 Score = 42.0 bits (97), Expect = 0.038
 Identities = 18/49 (36%), Positives = 32/49 (65%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSR 968
            +V++++ TL KN+ +++G+ +P L       F   GK++RP LV L+SR
Sbjct: 45   LVSNEMNTLAKNIMALIGSGHPTLNRVTSYYFETEGKKVRPLLVLLLSR 93



>gb:CP000010_866684 Burkholderia mallei ATCC 23344 chromosome 1,
            complete sequence.
          Length = 330

 Score =  173 bits (439), Expect = 8e-42
 Identities = 97/326 (29%), Positives = 170/326 (52%), Gaps = 3/326 (0%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S A L   +  D+  +N+ ++  + ++  ++   AE I  AGGKR+RPAL+ LV+    
Sbjct: 9    LSAAHLLAPIASDMEQVNRVIRQSLASDVLLINQIAEYIIGAGGKRLRPALLLLVA---- 64

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                    T +   LA ++E IHTA+L+HDDV+DES++RRG++T + ++G   +VL GD+
Sbjct: 65   --GALGENTSQKHVLAAVVEFIHTATLLHDDVVDESELRRGRKTANALFGNAASVLVGDY 122

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++++S   +  +  + V++++S+     + GE+ Q  ++ D DV    Y+    YKTA L
Sbjct: 123  LYSRSFEMMVGVGKMRVMEILSEATTIISEGEVLQLLNMHDADVDEARYMQVIRYKTAKL 182

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ +  A+ +G D+       +YGR +G +FQI+DD LD+  +AE +GK AG DL +G
Sbjct: 183  FEAAARLGAVLAGADAPTEAAAAEYGRRIGTAFQIMDDWLDYAGTAESMGKNAGDDLREG 242

Query: 418  NLTAPVIFALETEPKLRDIIESEFC---XXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXA 248
              T P+I+ +E     +  +  E                + R G +             A
Sbjct: 243  KPTLPLIYLIERGTPEQSTLAREAIEHGGTDRFDTIFDAITRSGALDHTLECARQEAQAA 302

Query: 247  IQNLECLPPSPFRVAXEEMVQYNLER 170
               +   P S F+ +  E+  Y++ R
Sbjct: 303  AAAISSFPSSNFKESLLELCSYSMSR 328



>gb:AP008226_579112 Thermus thermophilus HB8 genomic DNA, complete
            genome.
          Length = 312

 Score =  173 bits (438), Expect = 1e-41
 Identities = 99/294 (33%), Positives = 155/294 (52%), Gaps = 5/294 (1%)
 Frame = -1

Query: 1030 EQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDES 851
            + + +AGGKR+RP LVFL SR                 LA  +E++H+A+L+HDD++D++
Sbjct: 31   QDLVTAGGKRIRPRLVFLASRALGGAPFEL-------ELALAVELLHSATLLHDDLIDDA 83

Query: 850  DMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQA 671
            + RRGKE   + YG  V+VL+GDF+ ++    +A    +E+++  ++V K  + GE+ Q 
Sbjct: 84   ETRRGKEAAFRKYGNAVSVLSGDFLLSRLLHVIAKTGRMELVERFAEVAKTLSEGEVLQF 143

Query: 670  SSLFDCDVGMEDYLIKSY-----YKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGL 506
                     +EDY +++Y      KTA L+A +T+G A+  G +SG+ E +Y+YG   G 
Sbjct: 144  QV-----AALEDYSLENYERIITAKTAVLMALATEGPALLLGAESGVREALYRYGLLYGQ 198

Query: 505  SFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXXX 326
            +FQ+ DD LD   + E LGKP G DL +G  T   +  +E  P++R+++           
Sbjct: 199  AFQMRDDYLDLMGTPEVLGKPVGGDLREGKATLIPLLLMERYPEVREVLRRRAREAGDLE 258

Query: 325  XXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                  +  G               A Q LE LPPSPFR A  E+     ERV+
Sbjct: 259  RVRALARESGAAEEAVRRIRERAEAAAQALEALPPSPFREALRELALKEAERVR 312



>gb:AE015800_317978 Shewanella oneidensis MR-1 section 349 of 457 of
            the complete genome.>gb:AE014299_953575 Shewanella
            oneidensis MR-1 complete genome.
          Length = 323

 Score =  173 bits (438), Expect = 1e-41
 Identities = 101/321 (31%), Positives = 167/321 (52%), Gaps = 5/321 (1%)
 Frame = -1

Query: 1117 EVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXX 938
            ++   D+  +N+ +   + ++  ++      I + GGKR+RP L  L +R          
Sbjct: 8    QLADTDMQAVNQLIYKQLESDVALINQLGFYIINGGGKRLRPLLSVLAARAVDYQG---- 63

Query: 937  XTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSW 758
              + H +LA IIE IHTASL+HDDV+DES +RRG+ET + ++G   +VL GDF++ +S  
Sbjct: 64   --EAHLKLAAIIEFIHTASLLHDDVVDESTLRRGRETANALFGNSASVLVGDFLYTRSFQ 121

Query: 757  YLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKG 578
             +  L+++ V+++++      A GE+ Q  +  D D   E Y+   Y KTA L  A+T  
Sbjct: 122  MMTELDSMRVLRVLADTTNVLAEGEVLQLMNCNDPDTTEESYMRVIYCKTAKLFEAATLL 181

Query: 577  AAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVI 398
            AA+ +G        +  YG+ LG +FQ+ DD+LD+T  +++LGK  G DLA+G  T P+I
Sbjct: 182  AAVLAGASPEQETALGDYGKYLGTAFQLTDDLLDYTADSDELGKNIGDDLAEGKPTLPLI 241

Query: 397  FAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLE 233
            +A+     E +  +R  IE +             +  CG +             AI  L 
Sbjct: 242  YAIAHGTEEEKQLIRQAIE-QGDGTHAIEKIVAALHHCGALNYTQQKAIEESNKAIAALS 300

Query: 232  CLPPSPFRVAXEEMVQYNLER 170
             LP S F+ A   + + +++R
Sbjct: 301  VLPDSDFKTALISLAKISVDR 321



>sp|P18900|COQ1_YEAST Hexaprenyl pyrophosphate synthetase,
            mitochondrial precursor (EC 2.5.1.-)
            (HPS).>pir|A36625|XUBYTP
            trans-pentaprenyltranstransferase (EC 2.5.1.33) precursor
            - yeast (Saccharomyces cerevisiae)>gb:AY558099_1614326
            Saccharomyces cerevisiae clone FLH113446.01X YBR003W
            gene, complete cds.>gb:SCYBR003W_1711214 S.cerevisiae
            chromosome II reading frame ORF
            YBR003w.>gb:YSCHPS_1729342 S.cerevisiae hexaprenyl
            pyrophosphate synthetase (COQ1) gene, complete cds.
          Length = 473

 Score =  172 bits (437), Expect = 1e-41
 Identities = 108/300 (36%), Positives = 153/300 (51%), Gaps = 45/300 (15%)
 Frame = -1

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
            + RRLAEI+EMIHTASL+HDDV+D SD RRG+ + +  +  ++AVLAGDF+  +++  ++
Sbjct: 174  KQRRLAEIVEMIHTASLLHDDVIDHSDTRRGRPSGNAAFTNKMAVLAGDFLLGRATVSIS 233

Query: 748  NLENIEVIKLISQVIKDFASGEIKQASSL-FDCDV------------------------- 647
             L N EV++L+S  I +   GE  Q  +   D D+                         
Sbjct: 234  RLHNPEVVELMSNSIANLVEGEFMQLKNTSIDADIDTIENGHKLLPVPSKKLEVKEHDFR 293

Query: 646  ------------------GMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYG 521
                                E Y+ K+Y KTA+LI+ S + AAI SG    + ++ Y +G
Sbjct: 294  VPSRQQGLQLSHDQIIETAFEYYIHKTYLKTAALISKSCRCAAILSGASPAVIDECYDFG 353

Query: 520  RNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCX 341
            RNLG+ FQ+VDD+LDFT S + LGKP+G+DL  G  TAPV+FA + +P L  +I   F  
Sbjct: 354  RNLGICFQLVDDMLDFTVSGKDLGKPSGADLKLGIATAPVLFAWKEDPSLGPLISRNFSE 413

Query: 340  XXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL-ECLPPSPFRVAXEEMVQYNLERVK 164
                      V+   GI             A+QNL + LP S  R A E +    L R K
Sbjct: 414  RGDVEKTIDSVRLHNGIAKTKILAEEYRDKALQNLRDSLPESDARSALEFLTNSILTRRK 473



 Score = 42.4 bits (98), Expect = 0.029
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSR 968
            +V+ ++ TL KN+ +++G+ +PVL       F   GK++RP LV L+SR
Sbjct: 48   LVSKEMNTLAKNIVALIGSGHPVLNKVTSYYFETEGKKVRPLLVLLLSR 96



>gb:BX571965_792805 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.
          Length = 332

 Score =  172 bits (436), Expect = 2e-41
 Identities = 97/326 (29%), Positives = 169/326 (51%), Gaps = 3/326 (0%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S A L   +  D+  +N+ ++  + ++  ++   AE I  AGGKR+RPAL+ LV+    
Sbjct: 11   LSAAHLLAPIASDMEQVNRVIRQSLASDVLLINQIAEYIIGAGGKRLRPALLLLVA---- 66

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                    T +   LA ++E IHTA+L+HDDV+DES++RRG++T + ++G   +VL GD+
Sbjct: 67   --GALGENTNQKHVLAAVVEFIHTATLLHDDVVDESELRRGRKTANALFGNAASVLVGDY 124

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++++S   +  +  + V++++S+     + GE+ Q  ++ D DV    Y+    YKTA L
Sbjct: 125  LYSRSFEMMVGVGKMRVMEILSEATTIISEGEVLQLLNMHDADVDEARYMQVIRYKTAKL 184

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ +  A+ +G D+       +YGR +G +FQI+DD LD+  +AE +GK AG DL +G
Sbjct: 185  FEAAARLGAVLAGADAPTEAAAAEYGRRIGTAFQIMDDWLDYAGTAESMGKNAGDDLREG 244

Query: 418  NLTAPVIFALETEPKLRDIIESEFC---XXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXA 248
              T P+I+ +E     +  +  E                + R G +             A
Sbjct: 245  KPTLPLIYLIERGTPEQSTLAREAIEHGGTDRFDTIFDAITRSGALDHTLECARQEAQAA 304

Query: 247  IQNLECLPPSPFRVAXEEMVQYNLER 170
               +   P S F+ +  E+  Y+  R
Sbjct: 305  AAAISSFPSSNFKESLLELCSYSTSR 330



>gb:BX936398_835108 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 323

 Score =  172 bits (435), Expect = 2e-41
 Identities = 101/328 (30%), Positives = 165/328 (50%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + E+   D+  +N  +   + ++  ++      I S GGKR+RP +  LV+R   
Sbjct: 1    MNLEKIIELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMIAVLVARALN 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      +H  +A +IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GD+
Sbjct: 61   YQGS------KHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ +S   +  L+++ V+ L+S+     A GE+ Q  +  + D+  E Y+   Y KTA L
Sbjct: 115  IYTRSFQMMTGLQSMRVLTLMSEATNVIAEGEVLQLMNCNNPDITEESYMQVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ + AAI S         +  YGR LG +FQ++DD+LD++     LGK  G DL +G
Sbjct: 175  FEAAAQSAAILSDASEEQELALQNYGRYLGTAFQLIDDLLDYSAEGSTLGKNTGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R  IE +             ++ CG +            
Sbjct: 235  KPTLPLLHAMHNGTPEQAAMIRQAIE-QGNGRHLLEPVLAAMEHCGSLVYTRQRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L  LP S +R+A E +   ++ R
Sbjct: 294  KAIAALHALPESDYRLALEGLAHISVHR 321



>gb:BFU61168_748532 Bacillus firmus spore germination proteins C2
            (gerC2) and C3 (gerC3) genes, partial cds, and
            4-hydroxybenzoate octaprenyltransferase (ubiA) and
            3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiX)
            genes, complete cds.
          Length = 288

 Score =  171 bits (434), Expect = 3e-41
 Identities = 93/287 (32%), Positives = 163/287 (56%), Gaps = 4/287 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + +A ++     D+  + + L++ V A + VL +A+  +  AGGKR+RP  V L ++   
Sbjct: 8    MKLADIYMQFQSDITIIEQELEASVQARHDVLKNASTHLLKAGGKRIRPVFVLLAAKFGT 67

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                        + +A  +E++H ASL+HDDV+D++++RRGK TV   +  +VA+  G++
Sbjct: 68   YDIHVL------KNIAVPLELVHMASLVHDDVIDDAELRRGKRTVKSQWDNKVAMYTGNY 121

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +FA++    A  ++  V +++S  + +   GE++Q    ++    +  YL +   KTA L
Sbjct: 122  IFAKAVEASAYFDHPRVHQVLSNTLVEMCIGEVEQIRDQYNWGQNLRVYLRRIKRKTALL 181

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            IA S +  A+ +  D  I + +Y +G N+G+SFQI DDILDF  + +QLGKPAG DL +G
Sbjct: 182  IAVSCELGALAADADPVIQKHLYNFGYNVGMSFQITDDILDFVGTEKQLGKPAGGDLRQG 241

Query: 418  NLTAPVIFAL----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGI 290
            N+T P ++A+    E    +++++++EF            VK  GGI
Sbjct: 242  NVTLPALYAMHHDEEISHLIKNMLKNEFPENIDMQPILKAVKESGGI 288



>gb:AE016912_355808 Chromobacterium violaceum ATCC 12472 section 3 of
            16 of the complete genome.>gb:AE016825_1040962
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 309

 Score =  171 bits (434), Expect = 3e-41
 Identities = 98/299 (32%), Positives = 160/299 (53%), Gaps = 6/299 (2%)
 Frame = -1

Query: 1048 VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR-RLAEIIEMIHTASLIH 872
            ++   AE I SAGGKR+RP L  L  R             EH   LA +IE IHTA+L+H
Sbjct: 18   LIRQVAEYIISAGGKRLRPILTLLSGRALGYRG-------EHLFELAAMIEFIHTATLLH 70

Query: 871  DDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFA 692
            DDV+DESD+RRG++T + ++G   +VL GDF++ ++   +    N+ +++++++     A
Sbjct: 71   DDVVDESDLRRGRKTANALFGNAASVLVGDFLYTRAFQMMVTTRNMTILEVMAEATNIIA 130

Query: 691  SGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNL 512
             GE+ Q  ++ + DV  ++YL    YKTA L  A+ +  A+ +   +     M  YG  L
Sbjct: 131  EGEVLQLLNIGNTDVSEDEYLKVIQYKTAKLFEAAARVGALIADASAEQVRAMADYGMYL 190

Query: 511  GLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEF 347
            G +FQI+DD+LD++  A+ +GK  G DLA+G  T P+I+ +     E    +RD +E+  
Sbjct: 191  GTAFQIIDDVLDYSGDADTIGKSLGDDLAEGKPTLPLIYTMRNGSSEASALVRDALEN-- 248

Query: 346  CXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                        V+ CG +             AI +L+ +P S  R A  E+ + +++R
Sbjct: 249  ANRDRFHDVLNAVQSCGALEYAKNEAVKMAEQAIASLQSIPDSEVRQALIELARLSVDR 307



>gb:AE016858_350250 Pseudomonas syringae pv. tomato str. DC3000
            section 3 of 21 of the complete
            genome.>gb:AE016853_1035425 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 322

 Score =  171 bits (433), Expect = 4e-41
 Identities = 104/322 (32%), Positives = 167/322 (51%), Gaps = 3/322 (0%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            + +  V DD   ++  ++  + +  P++    + I SAGGKR+RP LV L  +       
Sbjct: 5    AFYRAVADDFSAVDLIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGD 64

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                  + R LA  IE +HTA+L+HDDV+D S MRRG+ T + ++G   +VL GDF++++
Sbjct: 65   ------DIRLLAATIEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSR 118

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S   +  L ++EV+K++S+  +  A GE+ Q S + D     E Y+     KTA L  AS
Sbjct: 119  SFEMMVELGSMEVMKILSKATRIIAEGEVLQLSKIRDASTTEETYMEVIRGKTAMLFEAS 178

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            T  AA         +E +  +G +LG++FQ+VDD+LD+   AE LGK  G DLA+G  T 
Sbjct: 179  THSAAALCKASEAQTEALRTFGDHLGVAFQLVDDLLDYRGDAETLGKNVGDDLAEGKPTL 238

Query: 406  PVIFAL-ETEPKLRDIIES--EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNL 236
            P+I+ + E  P+   ++    +             V+  G +             AI  L
Sbjct: 239  PLIYTMREGSPEQAALVRQAIQKGGLEDLESIRNAVESAGALDYTAQLARDYAARAIACL 298

Query: 235  ECLPPSPFRVAXEEMVQYNLER 170
            + LPPS +R A  E+ ++ + R
Sbjct: 299  DALPPSEYRDALIELSEFAVAR 320



>pir|AB0427|AB0427 octaprenyl-diphosphate synthase (EC 2.5.1.-)
            [imported] - Yersinia pestis (strain
            CO92)>gb:AE013669_299001 Yersinia pestis KIM section 69
            of 415 of the complete genome.>gb:AE017129_386417
            Yersinia pestis biovar Medievalis str. 91001 section 3 of
            16 of the complete genome.>gb:AJ414157_525271 Yersinia
            pestis strain CO92 complete genome; segment
            17/20.>gb:AE009952_929184 Yersinia pestis KIM complete
            genome.>gb:AE017042_1142983 Yersinia pestis biovar
            Medievalis str. 91001 complete genome.
          Length = 323

 Score =  171 bits (433), Expect = 4e-41
 Identities = 101/328 (30%), Positives = 165/328 (50%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + E+   D+  +N  +   + ++  ++      I S GGKR+RP +  LV+R   
Sbjct: 1    MNLEKIIELTAPDMAAVNTTILDQLNSDVVLINQLGHYIISGGGKRIRPMISVLVARALN 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      +H  +A +IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GD+
Sbjct: 61   YQGS------KHITVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ +S   +  L+++ V+ L+S+     A GE+ Q  +  + D+  E Y+   Y KTA L
Sbjct: 115  IYTRSFQMMTGLQSMRVLTLMSEATNVIAEGEVLQLMNCNNPDITEESYMQVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ + AAI S         +  YGR LG +FQ++DD+LD++     LGK  G DL +G
Sbjct: 175  FEAAAQSAAILSDASEEQELALQNYGRYLGTAFQLIDDLLDYSAEGSTLGKNTGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R  IE +             ++ CG +            
Sbjct: 235  KPTLPLLHAMHNGTPEQAAMIRQAIE-QGNGRHLLEPVLAAMEHCGSLVYTRQRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L  LP S +R+A E +   ++ R
Sbjct: 294  KAIAALHALPESDYRLALEGLAHISVHR 321



>gb:CP000020_870453 Vibrio fischeri ES114 chromosome I, complete
            sequence.
          Length = 323

 Score =  170 bits (431), Expect = 7e-41
 Identities = 100/322 (31%), Positives = 165/322 (51%), Gaps = 5/322 (1%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            +  DD+  +N+ + + + ++  ++      I S GGKR+RP L  L ++           
Sbjct: 9    LTADDMAIVNETILAQLNSDVALINQLGFYIVSGGGKRLRPVLAILSAKALGYEG----- 63

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
             K+H   A  IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GDF++ +S   
Sbjct: 64   -KDHTMAAAFIEFIHTATLLHDDVVDESDMRRGKATANAEFGNAASVLVGDFIYTRSFQM 122

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            + +L +I+++ L+S+ +   A GE+ Q  +  D +   E Y+   Y KTA L  A+T+  
Sbjct: 123  MTSLGSIKILSLMSEAVNVIAEGEVLQLMNCNDPNTTEESYMQVIYSKTARLFEAATQIG 182

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
            AI +     I   +  YG+ LG +FQ++DD++D+T   + +GK  G DLA+G  T P++ 
Sbjct: 183  AILNDAPQEIETALQNYGKYLGTAFQLIDDVMDYTSDGKDMGKNVGDDLAEGKPTLPLLH 242

Query: 394  AL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            A+     E    +R+ IE+              +K  G +             AI  L  
Sbjct: 243  AMMHGNEEQNAMIREAIENG-NGLDKLEPILACMKEVGSLEYTKQKADEEADKAIAELAI 301

Query: 229  LPPSPFRVAXEEMVQYNLERVK 164
            LP S ++ A + +    ++R K
Sbjct: 302  LPESDYKEALKALAHLAVKRSK 323



>gb:AE017305_436925 Thermus thermophilus HB27 section 5 of 7 of the
            complete genome.>gb:AE017221_1078903 Thermus thermophilus
            HB27 complete genome.
          Length = 312

 Score =  170 bits (430), Expect = 9e-41
 Identities = 98/294 (33%), Positives = 154/294 (52%), Gaps = 5/294 (1%)
 Frame = -1

Query: 1030 EQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDES 851
            + + +AGGKR+RP LVFL SR                 LA  +E++H+A+L+HDD++D++
Sbjct: 31   QDLVTAGGKRIRPRLVFLASRALGGAPFEL-------ELALAVELLHSATLLHDDLIDDA 83

Query: 850  DMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQA 671
            + RRGKE   + YG  V+VL+GDF+ ++    +A    +E+++  ++V K  + GE+ Q 
Sbjct: 84   ETRRGKEAAFRKYGNAVSVLSGDFLLSRLLHVIAKTGRMELVERFAEVAKTLSEGEVLQF 143

Query: 670  SSLFDCDVGMEDYLIKSY-----YKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGL 506
                     +EDY +++Y      KTA L+A +T+G A+  G +S + E +Y+YG   G 
Sbjct: 144  QV-----AALEDYSLENYERIITAKTAVLMALATEGPALLLGAESRVREALYRYGLLYGQ 198

Query: 505  SFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXXX 326
            +FQ+ DD LD   + E LGKP G DL +G  T   +  +E  P++R+++           
Sbjct: 199  AFQMRDDYLDLMGTPEVLGKPVGGDLREGKATLIPLLLMERYPEVREVLRRRAREAGDLE 258

Query: 325  XXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                  +  G               A Q LE LPPSPFR A  E+     ERV+
Sbjct: 259  RVRALARESGAAEEAVRRIRERAEAAAQALEALPPSPFREALRELALKEAERVR 312



>gb:CP000027_79395 Dehalococcoides ethenogenes 195, complete genome.
          Length = 324

 Score =  169 bits (427), Expect = 2e-40
 Identities = 93/257 (36%), Positives = 144/257 (56%), Gaps = 2/257 (0%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQI--FSAGGKRMRPALVFLVSRX 965
            + ++S++  + + L  +    + +  +        AE +     GGK +RPAL  L    
Sbjct: 2    LKLSSIYAPINEGLKGVEDEFKLVSESRKQSFPEMAEMLDYILVGGKVLRPALSML---- 57

Query: 964  XXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAG 785
                       K+   LA   EM+H A+L+HDD +D++D RR + TV+ ++G   A+L G
Sbjct: 58   --SAMCFGTGIKKVLPLATSSEMLHIATLVHDDAIDKADTRRSRRTVNSVWGLEKAILLG 115

Query: 784  DFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTA 605
            DF+FA ++   A  +N+ ++ L +Q ++  ASGE+KQA + F+ D   E+YL +   KTA
Sbjct: 116  DFLFAHAAEVAAETDNMRIVTLFAQTLQIIASGELKQAYASFNPDQSYENYLERISGKTA 175

Query: 604  SLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLA 425
            +L   +TKG AI +       E M  YG NLGLSFQIVDDILDF  +A+ +GKP GSDL 
Sbjct: 176  ALFVMATKGGAILADASPSDEEIMRSYGYNLGLSFQIVDDILDFVGNAKDMGKPVGSDLN 235

Query: 424  KGNLTAPVIFALETEPK 374
             G +T P +  ++  P+
Sbjct: 236  NGTVTLPALLLMDRYPE 252



>gb:AE017349_1758668 Cryptococcus neoformans var. neoformans JEC21
            chromosome 9, complete sequence.
          Length = 483

 Score =  168 bits (426), Expect = 3e-40
 Identities = 101/265 (38%), Positives = 146/265 (55%), Gaps = 12/265 (4%)
 Frame = -1

Query: 922  RRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL 743
            RRLA I EMIH ASL+HDDV+D S +RRG  +    +G ++++L+GDF+  ++S  LA L
Sbjct: 219  RRLASITEMIHVASLLHDDVIDSSSLRRGTPSAPSTFGNKLSILSGDFLLGRASVALARL 278

Query: 742  ENIEVIKLISQVIKDFASGEIKQASSLFDCD-----VGMEDYLIKSYYKTASLIAASTKG 578
             + EV++L++ VI +   GE+ Q  +  + +      G EDY+ K+Y KTASL+A S + 
Sbjct: 279  GSREVVELLATVIANLVEGEMMQLRATSEPEKAPTAKGFEDYMRKTYLKTASLMAKSARA 338

Query: 577  AAIFSGVDS------GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA-GSDLAKG 419
            A I  G  S       + +  Y YGRNLG++FQ++DD LDF      LGKP+ G+DL  G
Sbjct: 339  AVILGGCGSVSEEGAWVKDVAYGYGRNLGIAFQLIDDALDFLPPDSSLGKPSLGADLRLG 398

Query: 418  NLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQN 239
              TAP +FA ET P +  +I  +F            V R  G+             A + 
Sbjct: 399  LATAPALFAWETHPSMGPLILRKFTEPGDVEAARDLVARSDGLQRTIELAREFAGEARRL 458

Query: 238  LECLPPSPFRVAXEEMVQYNLERVK 164
            +E LP S  R A  ++    +ERVK
Sbjct: 459  VEMLPESGARDALVQLTVKVVERVK 483



>gb:AY075463_1296258 Drosophila melanogaster RE18374 full length
           cDNA.
          Length = 245

 Score =  168 bits (426), Expect = 3e-40
 Identities = 89/245 (36%), Positives = 139/245 (56%)
 Frame = -1

Query: 898 MIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKL 719
           M+H+ASL+HDDV+D+SD RRGK +V+ ++  +   +AGD++ + +S  +A L + +V  +
Sbjct: 1   MVHSASLVHDDVIDQSDFRRGKPSVNALWNHKKVTMAGDYILSIASIMIARLRSDDVTIV 60

Query: 718 ISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISE 539
           +SQ++ D   GE  Q  S    +     YL K+Y KTASLIA + K  A+ +  D  ++E
Sbjct: 61  LSQILTDLVQGEFMQLGSRETENERFAHYLTKTYRKTASLIANALKATAVIAQADDNVAE 120

Query: 538 QMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDII 359
             +QYGRN+GL+FQ+VDD+LDF  S EQ+GKP  +DL  G  TAPV+FA E  P+L  ++
Sbjct: 121 VAFQYGRNIGLAFQLVDDMLDFVSSTEQMGKPTAADLKLGLATAPVLFACEKYPELNPMV 180

Query: 358 ESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYN 179
              F            V +  G+             AI+  + L  SP++   + +    
Sbjct: 181 MRRFSEPGDVERAFELVHKSHGLEQTRFLAKKHCNEAIRLAQELTESPYQKGLQVVADLV 240

Query: 178 LERVK 164
           + R+K
Sbjct: 241 INRMK 245



>gb:AE016767_327923 Escherichia coli CFT073 section 13 of 18 of the
            complete genome.>gb:AE014075_958507 Escherichia coli
            CFT073 complete genome.
          Length = 323

 Score =  168 bits (426), Expect = 3e-40
 Identities = 99/328 (30%), Positives = 169/328 (51%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + E+   D+  +N  +   + ++  ++      I S GGKR+RP +  L +R   
Sbjct: 1    MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H  +A +IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GDF
Sbjct: 61   YEGNA------HVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   + +L +++V++++S+ +   A GE+ Q  ++ D D+  E+Y+   Y KTA L
Sbjct: 115  IYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ + + I +G      + +  YGR LG +FQ++DD+LD+    EQLGK  G DL +G
Sbjct: 175  FEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R  IE +             +  CG +            
Sbjct: 235  KPTLPLLHAMHHGTPEQAQMIRTAIE-QGNGRHLLEPVLEAMNACGSLEWTRQRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L+ LP +P+R A   +    ++R
Sbjct: 294  KAIAALQVLPDTPWREALVSLAHIAVQR 321



>gb:AB001997_498 Rhodobacter capsulatus DNA for solanesyl diphosphate
            synthase, complete cds.
          Length = 325

 Score =  168 bits (425), Expect = 4e-40
 Identities = 106/338 (31%), Positives = 177/338 (52%), Gaps = 3/338 (0%)
 Frame = -1

Query: 1168 LDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPA 989
            +D K+D  +P++          D   +++ +   + ++  ++MS ++ +  AGGKRMRP 
Sbjct: 3    IDFKQDILAPVA---------QDFAAMDQFINEGISSKVALVMSVSKHVVEAGGKRMRPI 53

Query: 988  LVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYG 809
            +  L +             K  ++LA IIEM+HTA+L+HDDV+DES +RRG+ T +  + 
Sbjct: 54   MCLLAA-----YACGETNLKHAQKLAAIIEMLHTATLVHDDVVDESGLRRGRPTANATWN 108

Query: 808  TRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYL 629
             + AVL GDF+ A++   L +L+N+ ++K  S    + A GE+ Q  +    D   + YL
Sbjct: 109  NQTAVLVGDFLIARAFDLLVDLDNMILLKDFSTGTCEIAEGEVLQLQAQHQPDTTEDIYL 168

Query: 628  IKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLG 449
               + KT+ L   +T+GAAI +G      E + ++  + G +FQI+DDILD+T  A+ LG
Sbjct: 169  QIIHGKTSRLFELATEGAAILAGKPE-YREPLRRFAGHFGNAFQIIDDILDYTSDADTLG 227

Query: 448  KPAGSDLAKGNLTAPVIFALE-TEPKLRDIIESEFCX--XXXXXXXXXXVKRCGGIXXXX 278
            K  G DL +G  T P+I A++ T+ + RD+I                  V+  G +    
Sbjct: 228  KNIGDDLMEGKPTLPLIAAMQNTQGEQRDLIRRSIATGGTSQLEQVIAIVQNSGALDYCH 287

Query: 277  XXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                     A+Q LE LP S +R A   + +  L+R++
Sbjct: 288  KRATEETERALQALEILPESTYRQALVNLTRLALDRIQ 325



>gb:BA000037_721295 Vibrio vulnificus YJ016 DNA, chromosome I,
            complete sequence.
          Length = 306

 Score =  167 bits (424), Expect = 5e-40
 Identities = 97/292 (33%), Positives = 151/292 (51%), Gaps = 5/292 (1%)
 Frame = -1

Query: 1024 IFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDM 845
            I S GGKR+RP L  L +R              H   A  IE IHTA+L+HDDV+DESDM
Sbjct: 22   IISGGGKRLRPLLAVLSARALGYQGNA------HTTAAAFIEFIHTATLLHDDVVDESDM 75

Query: 844  RRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASS 665
            RRGK T +  +G   +VL GDF++ +S   +  L +++++KL+S  +   A GE+ Q  +
Sbjct: 76   RRGKATANAAFGNAASVLVGDFIYTRSFQMMTELGSMKILKLMSDAVNIIAEGEVLQLMN 135

Query: 664  LFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDD 485
              D D   E Y+   Y KTA L  A+T+  AI +   + +   +  YG+ LG +FQ++DD
Sbjct: 136  CNDPDTTEESYMQVIYSKTARLFEAATQIGAILNDAPAEVETALQNYGKYLGTAFQLIDD 195

Query: 484  ILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXX 320
            ++D+T   E++GK  G DLA+G  T P++ A+     E    +R+ IE+           
Sbjct: 196  VMDYTSDGEEMGKNVGDDLAEGKPTLPLLHAMRHTNAENAQMIREAIENA-NGMERLDDI 254

Query: 319  XXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
               +++ G +             AI  L+ LP S ++ A   +    ++R K
Sbjct: 255  LAVMQQAGSLTYTEAKAMEEADKAIAELQVLPESEYKQALIALAHMAVKRSK 306



>pir|E85982|E85982 octaprenyl diphosphate synthase [imported] -
            Escherichia coli (strain O157:H7, substrain
            EDL933)>pir|B91137|B91137 octaprenyl diphosphate synthase
            [imported] - Escherichia coli (strain O157:H7, substrain
            RIMD 0509952)>gb:AE005174_68320 Escherichia coli O157:H7
            EDL933, complete genome.>gb:BA000007_662078 Escherichia
            coli O157:H7 DNA, complete genome.
          Length = 323

 Score =  167 bits (423), Expect = 6e-40
 Identities = 99/328 (30%), Positives = 169/328 (51%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + E+   D+  +N  +   + ++  ++      I S GGKR+RP +  L +R   
Sbjct: 1    MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H  +A +IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GDF
Sbjct: 61   YEGNA------HVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   + +L +++V++++S+ +   A GE+ Q  ++ D D+  E+Y+   Y KTA L
Sbjct: 115  IYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ + + I +G      + +  YGR LG +FQ++DD+LD+    EQLGK  G DL +G
Sbjct: 175  FEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R  IE +             +  CG +            
Sbjct: 235  KPTLPLLHAMHHGTPEQAQMIRTAIE-QGNGRHLLKPVLEAMNACGSLEWTRQRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L+ LP +P+R A   +    ++R
Sbjct: 294  KAIAALQVLPDTPWREALIGLAHIAVQR 321



>pir|AH0903|AH0903 octaprenyl-diphosphate synthase [imported] -
            Salmonella enterica subsp. enterica serovar Typhi (strain
            CT18)>gb:CP000026_77881 Salmonella enterica subsp.
            enterica serovar Paratypi A str. ATCC
            9150.>gb:AE008852_244946 Salmonella typhimurium LT2,
            section 156 of 220 of the complete
            genome.>gb:AE016845_347214 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, section 12 of 16 of the
            complete genome.>gb:AL627278_543544 Salmonella enterica
            serovar Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 14/20.>gb:AE014613_984546 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.>gb:AE006468_1002028 Salmonella typhimurium LT2,
            complete genome.
          Length = 323

 Score =  167 bits (423), Expect = 6e-40
 Identities = 98/328 (29%), Positives = 169/328 (51%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + E+   D+  +N  +   + ++  ++      I S GGKR+RP +  L +R   
Sbjct: 1    MNLEKINELTAQDMAGVNATILEQLNSDVQLINQLGYYIISGGGKRIRPMIAVLAARAVG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H  +A +IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GDF
Sbjct: 61   YQGNA------HVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   + +L +++V++++S+ +   A GE+ Q  ++ D D+  E+Y+   Y KTA L
Sbjct: 115  IYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ + + I +G      + +  YGR LG +FQ++DD+LD++   E LGK  G DL +G
Sbjct: 175  FEAAAQCSGILAGCTPEQEKGLQDYGRYLGTAFQLIDDLLDYSADGEHLGKNVGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R  IE +             +  CG +            
Sbjct: 235  KPTLPLLHAMRHGTPEQSAMIRTAIE-QGNGRHLLEPVLEAMTTCGSLEWTRQRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L+ LP +P+R A   +    ++R
Sbjct: 294  KAISALQILPDTPWREALIGLAHIAVQR 321



>sp|P19641|ISPB_ECOLI Octaprenyl-diphosphate synthase (EC 2.5.1.-)
            (Octaprenyl pyrophosphate synthetase) (OPP
            synthetase).>pir|E65109|E65109 octaprenyl-diphosphate
            synthase (EC 2.5.1.-) - Escherichia coli (strain
            K-12)>gb:AE005674_72811 Shigella flexneri 2a str. 301,
            complete genome.>gb:ECOUW67_130748 Escherichia coli K-12
            chromosomal region from 67.4 to 76.0
            minutes.>gb:U00096_202196 Escherichia coli K-12 MG1655
            complete genome.>gb:AE016989_372954 Shigella flexneri 2a
            str. 2457T section 12 of 16 of the complete
            genome.>gb:AE014073_997704 Shigella flexneri 2a str.
            2457T complete genome.
          Length = 323

 Score =  167 bits (423), Expect = 6e-40
 Identities = 99/328 (30%), Positives = 169/328 (51%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + E+   D+  +N  +   + ++  ++      I S GGKR+RP +  L +R   
Sbjct: 1    MNLEKINELTAQDMAGVNAAILEQLNSDVQLINQLGYYIVSGGGKRIRPMIAVLAARAVG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H  +A +IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GDF
Sbjct: 61   YEGNA------HVTIAALIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   + +L +++V++++S+ +   A GE+ Q  ++ D D+  E+Y+   Y KTA L
Sbjct: 115  IYTRAFQMMTSLGSLKVLEVMSEAVNVIAEGEVLQLMNVNDPDITEENYMRVIYSKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ + + I +G      + +  YGR LG +FQ++DD+LD+    EQLGK  G DL +G
Sbjct: 175  FEAAAQCSGILAGCTPEEEKGLQDYGRYLGTAFQLIDDLLDYNADGEQLGKNVGDDLNEG 234

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P++ A+     E    +R  IE +             +  CG +            
Sbjct: 235  KPTLPLLHAMHHGTPEQAQMIRTAIE-QGNGRHLLEPVLEAMNACGSLEWTRQRAEEEAD 293

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L+ LP +P+R A   +    ++R
Sbjct: 294  KAIAALQVLPDTPWREALIGLAHIAVQR 321



>pir|AD2654|AD2654 octaprenyl-diphosphate synthase [imported] -
            Agrobacterium tumefaciens (strain C58,
            Dupont)>gb:AE009031_247677 Agrobacterium tumefaciens str.
            C58 circular chromosome, section 57 of 256 of the
            complete sequence.>gb:AE008688_1085520 Agrobacterium
            tumefaciens str. C58 circular chromosome, complete
            sequence.
          Length = 338

 Score =  167 bits (422), Expect = 8e-40
 Identities = 100/340 (29%), Positives = 167/340 (49%), Gaps = 5/340 (1%)
 Frame = -1

Query: 1171 MLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRP 992
            ++ L++      SV  L ++   D+  +N+ + S  G++  ++   A  + S+GGKR+RP
Sbjct: 4    VIPLEESKNKLASVKPLVDLTRPDMERVNQLILSRAGSDVQMIPEVANHLISSGGKRLRP 63

Query: 991  ALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIY 812
             L                    H +LA  +E +HTA+L+HDDV+DESD+RRGK T   I+
Sbjct: 64   MLTL------ASASMFGYEGDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIW 117

Query: 811  GTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDY 632
            G + +VL GDF+  Q+   + ++ +++ + ++S      A GE+ Q S   + +   +DY
Sbjct: 118  GNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDY 177

Query: 631  LIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQL 452
            L     KTA+L AA+ +   I +  D      +  YG NLGL+FQ+VDD+LD+   +  L
Sbjct: 178  LQVIRAKTAALFAAAAEVGPIVAKTDKASRSALKSYGMNLGLAFQLVDDVLDYGGKSADL 237

Query: 451  GKPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIX 287
            GK  G D  +G +T PVI +      +     R+ IE               + +  G+ 
Sbjct: 238  GKNTGDDFREGKITLPVILSYRRGTQDERAFWRNAIEKGESSDENLEKALGLITKYNGLG 297

Query: 286  XXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                        A   L  LP SP++ A  E++ + +ER+
Sbjct: 298  DTIGRATHYGTIARDALAPLPQSPWKNALLEVIDFCIERL 337



>pir|A82322|A82322 octaprenyl-diphosphate synthase VC0434 [imported] -
            Vibrio cholerae (strain N16961 serogroup
            O1)>gb:AE004131_50837 Vibrio cholerae O1 biovar eltor
            str. N16961 chromosome I, section 39 of 251 of the
            complete chromosome.>gb:AE003852_1051611 Vibrio cholerae
            O1 biovar eltor str. N16961 chromosome I, complete
            chromosome.
          Length = 348

 Score =  167 bits (422), Expect = 8e-40
 Identities = 97/334 (29%), Positives = 167/334 (50%), Gaps = 5/334 (1%)
 Frame = -1

Query: 1150 SGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVS 971
            +G  +   ++  +  +D+  +N+ + + + ++  ++      I S GGKR+RP L  L +
Sbjct: 22   AGFTMDFKAIQALTANDMAKVNETIHAQLNSDVSLINQLGFYIISGGGKRLRPLLAVLSA 81

Query: 970  RXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVL 791
            +              H   A  IE IHTA+L+HDDV+DESD+RRGK T +  +G   +VL
Sbjct: 82   KALGYQGS------HHTTAAAFIEFIHTATLLHDDVVDESDLRRGKATANAAFGNAASVL 135

Query: 790  AGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYK 611
             GDF++ +S   +  L +++++KL+S  +   A GE++Q  +  D D     Y+   Y K
Sbjct: 136  VGDFIYTRSFQMMTELGSMKILKLMSDAVNVIAEGEVQQLMNCNDPDTTEASYMQVIYSK 195

Query: 610  TASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSD 431
            TA L  A+T+  AI       +   M  YG+ LG +FQ++DD++D+T   +++GK  G D
Sbjct: 196  TARLFEAATQIGAILCDASPEVELAMQNYGKYLGTAFQLIDDVMDYTSDGDEMGKNVGDD 255

Query: 430  LAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXX 266
            LA+G  T P+++A+     E    +R+ IE +             +++ G +        
Sbjct: 256  LAEGKPTLPLLYAMQHGNPEQAAMIREAIE-KANGMSRLNEILAAMEQTGSLQYTIEKAL 314

Query: 265  XXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                 AI  L  LP S ++ A   +    + R K
Sbjct: 315  HEADKAIAELAILPESEYKQALITLAHMAVNRSK 348



>pir|H97435|H97435 decaprenyl diphosphate synthase (AB006850)
            [imported] - Agrobacterium tumefaciens (strain C58,
            Cereon)>gb:AE007997_232381 Agrobacterium tumefaciens str.
            C58 circular chromosome, section 55 of 254 of the
            complete sequence.>gb:AE007869_1082050 Agrobacterium
            tumefaciens str. C58 circular chromosome, complete
            sequence.
          Length = 358

 Score =  167 bits (422), Expect = 8e-40
 Identities = 100/340 (29%), Positives = 167/340 (49%), Gaps = 5/340 (1%)
 Frame = -1

Query: 1171 MLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRP 992
            ++ L++      SV  L ++   D+  +N+ + S  G++  ++   A  + S+GGKR+RP
Sbjct: 24   VIPLEESKNKLASVKPLVDLTRPDMERVNQLILSRAGSDVQMIPEVANHLISSGGKRLRP 83

Query: 991  ALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIY 812
             L                    H +LA  +E +HTA+L+HDDV+DESD+RRGK T   I+
Sbjct: 84   MLTL------ASASMFGYEGDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIW 137

Query: 811  GTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDY 632
            G + +VL GDF+  Q+   + ++ +++ + ++S      A GE+ Q S   + +   +DY
Sbjct: 138  GNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDY 197

Query: 631  LIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQL 452
            L     KTA+L AA+ +   I +  D      +  YG NLGL+FQ+VDD+LD+   +  L
Sbjct: 198  LQVIRAKTAALFAAAAEVGPIVAKTDKASRSALKSYGMNLGLAFQLVDDVLDYGGKSADL 257

Query: 451  GKPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIX 287
            GK  G D  +G +T PVI +      +     R+ IE               + +  G+ 
Sbjct: 258  GKNTGDDFREGKITLPVILSYRRGTQDERAFWRNAIEKGESSDENLEKALGLITKYNGLG 317

Query: 286  XXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                        A   L  LP SP++ A  E++ + +ER+
Sbjct: 318  DTIGRATHYGTIARDALAPLPQSPWKNALLEVIDFCIERL 357



>gb:AY224190_599143 Agrobacterium tumefaciens BNQ0605 decaprenyl
            diphosphate synthase (dps44) gene, complete cds.
          Length = 358

 Score =  166 bits (421), Expect = 1e-39
 Identities = 100/340 (29%), Positives = 166/340 (48%), Gaps = 5/340 (1%)
 Frame = -1

Query: 1171 MLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRP 992
            ++ L++      SV  L ++   D+  +N+ + S  G++  ++   A  + S+GGKR+RP
Sbjct: 24   VIPLEESKNKLASVKPLVDLTRPDMERVNQLILSKAGSDVQMIPEVANHLISSGGKRLRP 83

Query: 991  ALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIY 812
             L                    H +LA  +E +HTA+L+HDDV+DESD+RRGK T   I+
Sbjct: 84   MLTL------ASASMFGYEGDNHIKLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIW 137

Query: 811  GTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDY 632
            G + +VL GDF+  Q+   + ++ +++ + ++S      A GE+ Q S   + +   +DY
Sbjct: 138  GNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSTAASVIAEGEVLQLSVAKNMETTEDDY 197

Query: 631  LIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQL 452
            L     KTA+L AA+ +   I +  D      +  YG NLGL+FQ+VDD+LD+   +  L
Sbjct: 198  LQVIRAKTAALFAAAAEVGPIVAKTDKATRSALKSYGMNLGLAFQLVDDVLDYGGKSADL 257

Query: 451  GKPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIX 287
            GK  G D  +G +T PVI +      +     R  IE               + +  G+ 
Sbjct: 258  GKNTGDDFREGKITLPVILSYRRGTQDERAFWRTAIEKGESSDENLEKALGLITKYNGLG 317

Query: 286  XXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                        A   L  LP SP++ A  E++ + +ER+
Sbjct: 318  DTIGRATHYGTIARDALAPLPQSPWKDALLEVIDFCIERL 357



>gb:AE017152_392225 Haemophilus ducreyi strain 35000HP section 2 of 6
            of the complete genome.>gb:AE017143_1026487 Haemophilus
            ducreyi strain 35000HP complete genome.
          Length = 327

 Score =  166 bits (421), Expect = 1e-39
 Identities = 85/251 (33%), Positives = 145/251 (57%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  +  +   D+  +++ + + + +E P++      I S GGKR+RP +  L +    
Sbjct: 5    LTLEQIQALAQQDMQAVDQEILAQLNSEVPLINQLGHYIISGGGKRIRPLIAVLAANALC 64

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                     ++H   A  IE +HTA+L+HDDV+DES +RRG+ET + I+G   +VL GDF
Sbjct: 65   YTG------RKHLTCAAFIEFVHTATLLHDDVVDESALRRGRETANAIFGNAASVLVGDF 118

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ +S   + +++++EV+K++S      A GE++Q  ++ D      +Y+   Y KTA L
Sbjct: 119  IYTRSFQMMTSVDSLEVLKVMSAATNALAEGEVQQLMNINDPHTTEANYMRVIYNKTARL 178

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+T+  AI +G    I + +  YG  LG +FQ+VDDILD++  AEQ GK  G D  +G
Sbjct: 179  FEAATQCVAIVAGASQQIEQALKAYGCYLGTAFQLVDDILDYSAKAEQFGKNVGDDFVEG 238

Query: 418  NLTAPVIFALE 386
              T P++ AL+
Sbjct: 239  KPTLPLLHALQ 249



>gb:BX321862_774243 Nitrosomonas europaea ATCC 19718, complete genome;
            segment 7/10.
          Length = 322

 Score =  166 bits (420), Expect = 1e-39
 Identities = 86/252 (34%), Positives = 147/252 (58%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S+ S+  V+  D+  ++  +Q  + ++  ++   +E I  +GGKR+RPALV L +    
Sbjct: 1    MSIESIRNVIAKDMGEVDNVIQQKLHSQVALVRQVSEYIIHSGGKRLRPALVILAAGLFD 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H  LA ++E IHTA+L+HDDV+DES++RR + T + ++G   +VL GDF
Sbjct: 61   YKGL------HHHNLAAVVEFIHTATLLHDDVVDESELRRNQATANALFGNAASVLVGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +++++   +  + N+ V+++++      A GE+ Q  +  D DV  E+YL    +KTA L
Sbjct: 115  LYSRAFQMMVEVGNMRVMEVLADATNTIAEGEVLQLLNCRDPDVEEENYLQVIRFKTAKL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+ +  AI  G      E +  YG +LG +FQ+VDD+LD++ + +  GK  G DLA+G
Sbjct: 175  FEAAARLGAILGGATPAEEEALAAYGMHLGTAFQLVDDLLDYSGNDQDTGKNLGDDLAEG 234

Query: 418  NLTAPVIFALET 383
              T P+IFA+ +
Sbjct: 235  KPTLPLIFAMRS 246



>gb:CR543861_104751 Acinetobacter sp. ADP1 complete genome.
          Length = 325

 Score =  166 bits (419), Expect = 2e-39
 Identities = 106/338 (31%), Positives = 175/338 (51%), Gaps = 3/338 (0%)
 Frame = -1

Query: 1168 LDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPA 989
            +D K+D  +P++          D   ++  +   + ++  ++M+ ++ +  AGGKRMRP 
Sbjct: 3    IDFKQDILAPVA---------SDFAAMDTFINEGITSKVALVMAVSKHVVEAGGKRMRPI 53

Query: 988  LVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYG 809
            +  L ++            ++HR+LA IIEM+HTA+L+HDDV+DES +RRG+ T +  + 
Sbjct: 54   MCLLAAKACGSTDL-----EQHRKLAAIIEMLHTATLVHDDVVDESGLRRGRPTANATWN 108

Query: 808  TRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYL 629
             + AVL GDF+ +++   L +L ++ ++K  S    + A GE+ Q  S  D +   + YL
Sbjct: 109  NQTAVLVGDFLISRAFDLLVDLNDMVLLKDFSTGTCEIAEGEVLQLQSQHDPETTEQTYL 168

Query: 628  IKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLG 449
               + KT+ L   +T+GAAI SG      E +  +  + G +FQI+DDILD+T  AE LG
Sbjct: 169  NIIHGKTSRLFELATEGAAILSGTPE-YREPLRHFAGHFGNAFQIIDDILDYTSDAETLG 227

Query: 448  KPAGSDLAKGNLTAPVIFALE-TEPKLRDIIESEFCX--XXXXXXXXXXVKRCGGIXXXX 278
            K  G DL +G  T P+I AL+ T+ +  DI+                  V++ G +    
Sbjct: 228  KNIGDDLMEGKPTLPLISALQHTQGEEHDIVRRSIATGGIHQLEQVIQIVQQSGALDYCR 287

Query: 277  XXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
                     A+  L+ LP S  R A   + Q  L R++
Sbjct: 288  KRAEEETQAALAALQHLPESEARQALFNLTQLALHRIQ 325



>gb:AE016827_343229 Mannheimia succiniciproducens MBEL55E, complete
            genome.
          Length = 358

 Score =  165 bits (418), Expect = 2e-39
 Identities = 86/250 (34%), Positives = 145/250 (58%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            + + ++  +V+DD+  +N+ + + + ++ P++      I  +GGKR+RP +  L ++   
Sbjct: 36   MDIKTIQALVSDDMQKVNEEILAQLNSDVPLINQLGYYIIHSGGKRIRPMIANLAAKALN 95

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      +H   A  IE +HTA+L+HDDV+DESDMRRG  T +  +G   +VL GD+
Sbjct: 96   YQD------NKHITCAAFIEFLHTATLLHDDVVDESDMRRGNPTANAEFGNAASVLVGDY 149

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            M  +S   +  L ++ +++++S      A GE++Q  ++ D D   ++Y+   Y KTA L
Sbjct: 150  MHTRSFQMMTELGSLRILQVMSAATNVIAEGEVQQLMNVRDPDTTEQNYMKVIYSKTARL 209

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
               ST+  AI +   + I E +  YGR LG +FQ+VDDILD++ +A  LGK  G DLA+G
Sbjct: 210  FEVSTQTVAILADAGAAIEEGLQNYGRYLGTAFQLVDDILDYSANAATLGKNIGDDLAEG 269

Query: 418  NLTAPVIFAL 389
              T P++ A+
Sbjct: 270  KPTLPLLHAM 279



>sp|O43091|DPS1_SCHPO Decaprenyl-diphosphate synthase (EC 2.5.1.-)
            (Decaprenyl pyrophosphate synthetase).>pir|JC5429|JC5429
            di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31)
            [similarity] - fission yeast (Schizosaccharomyces
            pombe)>gb:D84311_1674852 Schizosaccharomyces pombe dps1
            mRNA for decaprenyl diphosphate synthase subunit 1,
            complete cds.>gb:SPBPJ694_1720737 S.pombe chromosome II
            PCR product pJ694.
          Length = 378

 Score =  163 bits (413), Expect = 9e-39
 Identities = 105/343 (30%), Positives = 169/343 (49%), Gaps = 26/343 (7%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX------- 956
            ++ ++L  ++  ++ ++ + +  L   ++    A GK+MRP+LV L+S+           
Sbjct: 36   LIKNELEQISPGIRQMLNSNSEFLEECSKYYTIAQGKQMRPSLVLLMSKATSLCHGIDRS 95

Query: 955  -------------XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQI 815
                                     RLA+I EMIH ASL+HDDV+D +++RRG  + +  
Sbjct: 96   VVGDKYIDDDDLRSFSTGQILPSQLRLAQITEMIHIASLLHDDVIDHANVRRGSPSSNVA 155

Query: 814  YGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDV---- 647
            +G R ++LAG+F+ A++S  +A L N +V +L++ VI D   GE  Q  +  D       
Sbjct: 156  FGNRRSILAGNFILARASTAMARLRNPQVTELLATVIADLVRGEFLQLKNTMDPSSLEIK 215

Query: 646  --GMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDF 473
                + Y+ KS+ KTASLI+ S K + I       ++    +YGR +G +FQ++DD+LD+
Sbjct: 216  QSNFDYYIEKSFLKTASLISKSCKASTILGQCSPTVATAAGEYGRCIGTAFQLMDDVLDY 275

Query: 472  TQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGG 293
            T   + LGK AG+DL  G  TAPV+FA +  P+L  +I + F            V+    
Sbjct: 276  TSKDDTLGKAAGADLKLGLATAPVLFAWKKYPELGAMIVNRFNHPSDIQRARSLVECTDA 335

Query: 292  IXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
            I             A  +L CLP SP R A   +    + R K
Sbjct: 336  IEQTITWAKEYIKKAKDSLLCLPDSPARKALFALADKVITRKK 378



>gb:AE012555_284045 Xylella fastidiosa Temecula1, section 3 of 9 of
            the complete genome.>gb:AE009442_960621 Xylella
            fastidiosa Temecula1, complete genome.
          Length = 333

 Score =  162 bits (411), Expect = 1e-38
 Identities = 99/328 (30%), Positives = 164/328 (50%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S+  +      D+  ++  +   + ++  ++   A+ I  +GGKR+RP L  L      
Sbjct: 12   LSLPQIQSFAASDMAAIDTLIHDRLTSDIVLINQIADHIICSGGKRLRPMLTMLAGHAIG 71

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H +LA IIE IHTA+L+HDDV+D S++RR + T + ++G   +VL GDF
Sbjct: 72   PTG------PHHHQLAAIIEFIHTATLLHDDVVDGSELRRSRSTANALWGNAPSVLVGDF 125

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++++S   +  L N+EV++++++     + GE+ Q   + + D     YL     KTA L
Sbjct: 126  LYSRSFQLMTELANLEVMQILAETTNRISEGEVLQLLHVHNPDTDETTYLSVIERKTAIL 185

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
             AA+ +  A+ S  D+    +MY+YG  LG +FQI DD+LD+T +  QLGK  G DLA+G
Sbjct: 186  FAAAAQLGALASHADTQTQTRMYEYGMQLGYAFQITDDVLDYTANNSQLGKNLGDDLAEG 245

Query: 418  NLTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T PVI A+      T  +LR II                ++  G +            
Sbjct: 246  KATLPVIHAMTHSDAATCERLRMIISKG--DSDAMPEVLNAIRTTGSLDYSRQRASAYAA 303

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             A + L+ LP +    A   + +Y ++R
Sbjct: 304  TAERALDGLPETEAVAALRGLARYAVQR 331



>gb:CR628336_112826 Legionella pneumophila str. Paris complete genome.
          Length = 322

 Score =  162 bits (411), Expect = 1e-38
 Identities = 96/328 (29%), Positives = 170/328 (51%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + E+V++D   +N  +   + ++  ++   ++ I  +GGKR+RP +V L S    
Sbjct: 1    MTIDRIRELVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACG 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                     K+H  LA ++E  HTA+L+HDDV+DES +RRG++T + I+G++ +VL GD+
Sbjct: 61   YKG------KDHISLAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDY 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            +F QS   +  +   E++ L++        GE+KQ ++  +  + ++DY      KTA L
Sbjct: 115  LFTQSVNLMVEVGIKEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
             AA+     I +     I + +Y YG +LG +FQ++DD LD+   A  LGK  G DLA G
Sbjct: 175  FAAAACIGPILTNAPIEIRDSLYNYGLHLGNAFQLIDDALDYCSDAATLGKNIGDDLADG 234

Query: 418  NLTAPVIFALET-----EPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
              T P+I AL+      + ++R+ +                +++   I            
Sbjct: 235  KATLPLIHALQNGNATQQQQIRESLMKG--SLSHLPDILIAIEQTEAIPFTKRIAAQEVD 292

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             A+  LE LP S ++ A  ++ ++ LER
Sbjct: 293  SALSALEILPDSVYKEALVDLAKFALER 320



>pir|A82688|A82688 octaprenyl-diphosphate synthase XF1391 [imported] -
            Xylella fastidiosa (strain 9a5c)>gb:AE003970_49029
            Xylella fastidiosa 9a5c, section 116 of 229 of the
            complete genome.>gb:AE003849_1116239 Xylella fastidiosa
            9a5c, complete genome.
          Length = 332

 Score =  162 bits (409), Expect = 3e-38
 Identities = 86/250 (34%), Positives = 140/250 (56%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S+  +      D+  ++  +   + ++  ++   A+ I  +GGKR+RP L  L      
Sbjct: 11   LSLPQIQSFAASDMAAIDTLIHDRLTSDIVLINQIADHIICSGGKRLRPMLTMLAGHAIG 70

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                       H +LA IIE IHTA+L+HDDV+D S++RR + T + ++G   +VL GDF
Sbjct: 71   PTG------PHHHQLAAIIEFIHTATLLHDDVVDGSELRRSRSTANALWGNAPSVLVGDF 124

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++++S   +  L N+EV++++++     + GE+ Q   + + D     YL     KTA L
Sbjct: 125  LYSRSFQLMTELANLEVMQILAETTNRISEGEVLQLLHVHNPDTDETTYLRVIERKTAIL 184

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
             AA+ +  A+ S  D+    +MY+YG  LG +FQI DD+LD+T +  QLGK  G DLA+G
Sbjct: 185  FAAAAQLGALASHADTQTQTRMYEYGMQLGYAFQITDDVLDYTANNSQLGKNLGDDLAEG 244

Query: 418  NLTAPVIFAL 389
              T PVI A+
Sbjct: 245  KATLPVIHAM 254



>gb:AE016818_1748152 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 475

 Score =  161 bits (408), Expect = 3e-38
 Identities = 106/299 (35%), Positives = 150/299 (50%), Gaps = 44/299 (14%)
 Frame = -1

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
            + RRLAEI+ MIHTASL+HDDV+D S  RRGK + +  +  ++AVLAGDF+  +++  ++
Sbjct: 178  KQRRLAEIVLMIHTASLLHDDVIDHSGTRRGKPSGNVAFTNKMAVLAGDFLLGRATVSIS 237

Query: 748  NLENIEVIKLISQVIKDFASGEIKQA-SSLFDCDV------------------------- 647
             L N EV++L+S  I +   GE  Q  +++ D D+                         
Sbjct: 238  RLRNPEVVELVSNCIANLVEGEFMQLKNTVVDGDLETINNGTQQIPPASKTIPLPVHDYR 297

Query: 646  -----------------GMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGR 518
                               + YL K+Y KTA+LI+ S + AA+ SG    I ++ Y +G+
Sbjct: 298  VNTTLASGISHEVMIETAFDYYLHKTYLKTAALISKSCRAAAVLSGARDPILDECYHFGK 357

Query: 517  NLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCXX 338
            NLG+ FQ+VDD+LDFT S E LGKP G+D   G  TAPV+FA + +P L  II+  F   
Sbjct: 358  NLGICFQLVDDMLDFTTSGE-LGKPVGADFELGIATAPVLFAWKEDPSLGPIIQRNFSQP 416

Query: 337  XXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLE-CLPPSPFRVAXEEMVQYNLERVK 164
                     V +  GI             A+ NL   LP S  R A E +    L R K
Sbjct: 417  GDVARALEAVHQHDGIKKTAEVAREYRDKALHNLRAALPESDSRAALEFLTNSILTRRK 475



 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 21/49 (42%), Positives = 35/49 (71%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSR 968
            +V+D++ TL+KN+  ++G+ +PVL       F +GGK++RP LV L+SR
Sbjct: 53   LVSDEMKTLSKNIARLIGSGHPVLNRVTSYYFDSGGKKVRPMLVLLLSR 101



>gb:AE008692_240302 Zymomonas mobilis subsp. mobilis ZM4, complete
            genome.
          Length = 337

 Score =  161 bits (408), Expect = 3e-38
 Identities = 98/333 (29%), Positives = 157/333 (47%), Gaps = 5/333 (1%)
 Frame = -1

Query: 1153 DSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLV 974
            D     S+  L  +V  D+  +N+ +   + +E P++   A  + S+GGKRMRP L+   
Sbjct: 9    DRNQAASLKPLMHLVASDMQAVNQVILDRMQSEVPLIPELAGHLISSGGKRMRPMLMLAC 68

Query: 973  SRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAV 794
            SR              H +LA  IE IHTA+L+HDDV+D SD+RRGK T + I+G    V
Sbjct: 69   SRLIGEPRDI------HYKLAAAIEFIHTATLLHDDVVDHSDLRRGKRTANNIWGNGPTV 122

Query: 793  LAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYY 614
            L GDF+ +++   +    ++  ++++S        GE+ Q  S +  +     YL     
Sbjct: 123  LVGDFLLSRAFEMMVESGSLRALEILSNAAAIITQGEVDQLVSQYQVETDEARYLSIIGA 182

Query: 613  KTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGS 434
            KTA L AAS + AA+ +G      + +  YG+ LG++FQ+ DD +D+   ++ +GK  G 
Sbjct: 183  KTAVLFAASCRIAAVMAGCSKDKEQSLADYGQYLGIAFQLTDDAIDYMSDSQTMGKGVGD 242

Query: 433  DLAKGNLTAPVIFALETEPKL-----RDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXX 269
            D   G +T PVI A +   K      R+ IE               +     +       
Sbjct: 243  DFRDGKVTLPVILAYQRGEKADRDFWREAIEGRRVADSDLDIAKILLVNTDALSDTLERA 302

Query: 268  XXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                  AIQ+L+  P    + A  E V++ + R
Sbjct: 303  RLYGEKAIQSLKAFPDGAVKEALVEAVEFTIAR 335



>gb:BX897699_827047 Bartonella henselae strain Houston-1, complete
            genome.
          Length = 356

 Score =  161 bits (407), Expect = 4e-38
 Identities = 85/251 (33%), Positives = 144/251 (57%)
 Frame = -1

Query: 1144 SPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRX 965
            +PIS+ SL  +  DD+  +N+ + S+  ++  ++   +  + S+GGKR+RP L    +R 
Sbjct: 31   NPISLQSLVNLTKDDMEHVNQCIFSMAKSDVEIIPEISNHLISSGGKRLRPMLTLASARM 90

Query: 964  XXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAG 785
                         H +LA  +E +HTA+L+HDDV+DES++RRGK T   I+G + ++L G
Sbjct: 91   FGYQNDG------HIKLATAVEFMHTATLLHDDVIDESNLRRGKSTARMIWGNQASILVG 144

Query: 784  DFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTA 605
            DF+  Q+   + ++ +IE + +++      A GE+ Q S+  + +  + DYL     KTA
Sbjct: 145  DFLLGQAFKMMVDVGSIEALSVLANAAAIIAEGEVMQLSATKNIETSISDYLKIINAKTA 204

Query: 604  SLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLA 425
            +L +A+ +   I +G        + +YG  LGL+FQ++DD LD+  +A+ LGK  G D  
Sbjct: 205  ALFSAAAEVGPIIAGYGHEERLALREYGTFLGLAFQLIDDALDYGGTAKYLGKNIGDDFR 264

Query: 424  KGNLTAPVIFA 392
            +G +T PVI A
Sbjct: 265  EGKITMPVILA 275



>sp|P44916|ISPB_HAEIN Octaprenyl-diphosphate synthase (EC 2.5.1.-)
            (Octaprenyl pyrophosphate synthetase) (OPP
            synthetase).>pir|I64160|I64160 hypothetical protein
            HI0881 - Haemophilus influenzae (strain Rd
            KW20)>gb:U32770_204553 Haemophilus influenzae Rd KW20
            section 85 of 163 of the complete
            genome.>gb:L42023_1097102 Haemophilus influenzae Rd KW20
            complete genome.
          Length = 329

 Score =  161 bits (407), Expect = 4e-38
 Identities = 82/250 (32%), Positives = 143/250 (57%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S+  + ++   D+  +N+N+ + + ++ P++      I   GGKR+RP +  L +R   
Sbjct: 7    MSIDEIQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYIVQGGGKRIRPLIAVLAARSLG 66

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                           A  +E IHTASL+HDDV+DESDMRRG+ T +  +G   +VL GDF
Sbjct: 67   FEGSNSIT------CATFVEFIHTASLLHDDVVDESDMRRGRATANAEFGNAASVLVGDF 120

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   +A LE+++++ +++      A GE++Q  ++ D +    +Y+   Y KTA L
Sbjct: 121  IYTRAFQLVAQLESLKILSIMADATNVLAEGEVQQLMNVNDPETSEANYMRVIYSKTARL 180

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
               + + AAI +G      + +  YGR LG +FQ+VDD+LD++ + + LGK  G DLA+G
Sbjct: 181  FEVAGQAAAIVAGGTEAQEKALQDYGRYLGTAFQLVDDVLDYSANTQALGKNVGDDLAEG 240

Query: 418  NLTAPVIFAL 389
              T P++ A+
Sbjct: 241  KPTLPLLHAM 250



>gb:AE016747_322807 Staphylococcus epidermidis ATCC 12228, section 4
            of 9 of the complete genome.>gb:AE015929_1147476
            Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 339

 Score =  160 bits (406), Expect = 6e-38
 Identities = 90/260 (34%), Positives = 148/260 (56%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            I+VA L   + +++  + K L+  + + +  L  A+  + S+GGKR+RPA V L  +   
Sbjct: 19   INVAKLN--INNEIKKVEKRLEEAIISSDQTLQEASFHLLSSGGKRVRPAFVILSGQFGS 76

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                     ++  R+A  +E+IH A+L+HDDV+D+SD RRG+ T+ + +    A+L G+F
Sbjct: 77   NNKPS----EDTYRVAVALELIHMATLVHDDVIDKSDKRRGRLTISKKWDQSTAILTGNF 132

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            + A    +L+ + +  V   IS+ I D   GE+ Q    F+ +  + +YL +   KTA L
Sbjct: 133  LLAMGLKHLSEISDTRVHSTISKSIVDVCRGELFQFQDQFNSNQTITNYLRRINRKTALL 192

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            I  ST+  AI S   + +  ++   G  +G+SFQI+DD+LDFT S ++LGKP GSDL  G
Sbjct: 193  IQLSTQVGAITSNASNDVIRKLKMIGHYIGMSFQIIDDVLDFTSSEKKLGKPVGSDLMNG 252

Query: 418  NLTAPVIFALETEPKLRDII 359
            ++T PV+  +      +D I
Sbjct: 253  HITLPVLLEMRKNKTFKDKI 272



>gb:CP000029_81643 Staphylococcus epidermidis RP62A, complete genome.
          Length = 319

 Score =  160 bits (405), Expect = 7e-38
 Identities = 86/251 (34%), Positives = 143/251 (56%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            + +++  + K L+  + + +  L  A+  + S+GGKR+RPA V L  +            
Sbjct: 6    INNEIKKVEKRLEEAIISSDQTLQEASFHLLSSGGKRVRPAFVILSGQFGSNNKPS---- 61

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
            ++  R+A  +E+IH A+L+HDDV+D+SD RRG+ T+ + +    A+L G+F+ A    +L
Sbjct: 62   EDTYRVAVALELIHMATLVHDDVIDKSDKRRGRLTISKKWDQSTAILTGNFLLAMGLKHL 121

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
            + + +  V   IS+ I D   GE+ Q    F+ +  + +YL +   KTA LI  ST+  A
Sbjct: 122  SEISDTRVHSTISKSIVDVCRGELFQFQDQFNSNQTITNYLRRINRKTALLIQLSTQVGA 181

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            I S   + +  ++   G  +G+SFQI+DD+LDFT S ++LGKP GSDL  G++T PV+  
Sbjct: 182  ITSNASNDVIRKLKMIGHYIGMSFQIIDDVLDFTSSEKKLGKPVGSDLMNGHITLPVLLE 241

Query: 391  LETEPKLRDII 359
            +      +D I
Sbjct: 242  MRKNKTFKDKI 252



>gb:AE016776_330126 Pseudomonas putida KT2440 section 3 of 21 of the
            complete genome.>gb:AE015451_945203 Pseudomonas putida
            KT2440 complete genome.
          Length = 322

 Score =  159 bits (403), Expect = 1e-37
 Identities = 101/324 (31%), Positives = 165/324 (50%), Gaps = 5/324 (1%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            + +  V DD   +++ ++  + +  P++    + I SAGGKR+RP LV L  +       
Sbjct: 5    TFYRAVADDFSAVDEIIKKQLTSRVPLVSKIGDYITSAGGKRLRPLLVLLCGKALGREGD 64

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                  + R LA  IE +HTA+L+HDDV+D S MRRG+ T + ++G   +VL GDF++++
Sbjct: 65   ------DLRLLAATIEFLHTATLLHDDVVDMSGMRRGRSTANALWGNAPSVLVGDFLYSR 118

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S   +  L ++ V++++S+  +  A GE+ Q S + D     E Y+     KTA L  AS
Sbjct: 119  SFEMMVELGSMPVMQILSKATRVIAEGEVLQLSRVRDASTTEEVYMEVIRGKTAMLFEAS 178

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            T  AA  +       E +  +G +LG++FQ+VDD+LD+   ++ LGK  G DLA+G  T 
Sbjct: 179  THSAAALAQATDEQREALRTFGDHLGVAFQLVDDLLDYKGDSQTLGKNVGDDLAEGKPTL 238

Query: 406  PVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQ 242
            P+I+ +     E    +R  I+               V+  G +             AI 
Sbjct: 239  PLIYTMREGTAEQAALVRQAIQKG--GLEDLEQIRVAVEESGALKYTAELARDYVKRAIA 296

Query: 241  NLECLPPSPFRVAXEEMVQYNLER 170
             LE LP S +R A  E+ ++ + R
Sbjct: 297  CLEVLPASEYRDALVELSEFAVAR 320



>gb:CR628337_115787 Legionella pneumophila str. Lens complete genome.
          Length = 322

 Score =  159 bits (403), Expect = 1e-37
 Identities = 95/320 (29%), Positives = 164/320 (51%), Gaps = 5/320 (1%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            +V++D   +N  +   + ++  ++   ++ I  +GGKR+RP +V L S            
Sbjct: 9    LVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACGYKG----- 63

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
             K+H  LA ++E  HTA+L+HDDV+DES +RRG++T + I+G++ +VL GD++F QS   
Sbjct: 64   -KDHISLAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDYLFTQSVNL 122

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            +  +   E++ L++        GE+KQ ++  +  + ++DY      KTA L AA+    
Sbjct: 123  MVEVGIKEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALLFAAAACIG 182

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
             I +     I   +Y YG +LG +FQ++DD LD+   A  LGK  G DLA G  T P+I 
Sbjct: 183  PILTNAPIEIRNSLYNYGLHLGNAFQLIDDALDYCSDAATLGKNIGDDLADGKATLPLIH 242

Query: 394  ALET-----EPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            AL+      + ++R+ +                +++   I             A+  LE 
Sbjct: 243  ALQNGNATQQQQIRESLMKG--SLSHLPDILIAIEQTEAIPFTKRIAAQEVDSALSALEI 300

Query: 229  LPPSPFRVAXEEMVQYNLER 170
            LP S ++ A  ++ ++ LER
Sbjct: 301  LPDSVYKEALVDLAKFALER 320



>gb:CR378664_93802 Photobacterium profundum SS9; segment 2/12.
          Length = 323

 Score =  159 bits (403), Expect = 1e-37
 Identities = 79/242 (32%), Positives = 143/242 (59%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            +  +D+  ++  +Q+ + ++  ++      I S GGKR+RP LV L +R           
Sbjct: 9    LTANDMAGVDAKIQAQLNSDVALINQLGFYIVSGGGKRLRPMLVVLAARALGYQGD---- 64

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
              +H   A  +E IHTA+L+HDDV+DESDMRRGK+T +  +G   +VL GD+++ +S   
Sbjct: 65   --KHITAAAFVEFIHTATLLHDDVVDESDMRRGKDTANAAFGNAASVLVGDYIYTRSFQM 122

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            + +L +++++ ++S+     A GE++Q  +  D +   ++Y+   Y KTA L  A+T+ +
Sbjct: 123  MTSLRSLKILDIMSEATNVIAEGEVQQLMNCNDPNTTEDNYMQVIYSKTARLFEAATQIS 182

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
            AI +   + +   +  YGR LG +FQ++DD+LD+    +++GK  G DL++G  T P++ 
Sbjct: 183  AIITESSTEVEVALQDYGRYLGTAFQLIDDVLDYVADGKEMGKNVGDDLSEGKPTLPLLH 242

Query: 394  AL 389
            A+
Sbjct: 243  AM 244



>pir|H87510|H87510 polyprenyl synthetase family protein [imported] -
            Caulobacter crescentus>gb:AE005884_213247 Caulobacter
            crescentus CB15 section 210 of 359 of the complete
            genome.>gb:AE005673_923146 Caulobacter crescentus CB15
            complete genome.
          Length = 338

 Score =  159 bits (403), Expect = 1e-37
 Identities = 85/249 (34%), Positives = 141/249 (56%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            SV  L  +   D+  +N+ +   + ++  ++ + AE + +AGGKR+RP +    +R    
Sbjct: 16   SVDRLVRLAEADMAGVNRLITDRMQSDVAIIPALAEHLIAAGGKRLRPLMTVAAARLAGA 75

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                       ++LA  +E IHTA+L+HDDV+D S +RRGK   H I+G   +VL GDF+
Sbjct: 76   DND------HFQKLAAAVEFIHTATLLHDDVVDGSQLRRGKVAAHLIWGGAQSVLVGDFL 129

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
            FA++   +    +++ ++++++  +  A GE+ Q     D ++    YL     KTA L 
Sbjct: 130  FARAFELMVETNSMKALEILARASRVIAEGEVLQLMRSHDLNLSQAVYLEIIQAKTAELF 189

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            AA+++  A+ +GVD   SE +  YG NLGL+FQ+ DD LD+  + E LGK AG D  +G 
Sbjct: 190  AAASEAGAVSAGVDVAKSEALRDYGLNLGLAFQLADDALDYGGATETLGKNAGDDFREGK 249

Query: 415  LTAPVIFAL 389
             T P++ A+
Sbjct: 250  ATLPLLLAI 258



>gb:BX897700_828561 Bartonella quintana str. Toulouse, complete
            genome.
          Length = 356

 Score =  159 bits (402), Expect = 2e-37
 Identities = 83/253 (32%), Positives = 144/253 (56%)
 Frame = -1

Query: 1150 SGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVS 971
            + + IS+ SL  +  DD+  +NK + S+  ++  ++   +  + S+GGKR+RP +    +
Sbjct: 29   TNNQISLQSLINLTKDDMERVNKFILSMAKSDIEMIPEISNHLISSGGKRLRPMITLASA 88

Query: 970  RXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVL 791
                           H +LA  +E +HTA+L+HDDV+DES++RRGK T   I+G + ++L
Sbjct: 89   HMFDYQNDG------HIKLATAVEFMHTATLLHDDVIDESNLRRGKSTARMIWGNQASIL 142

Query: 790  AGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYK 611
             GDF+  Q+   + ++ +IE + +++      A GE+ Q S++ + +    DYL     K
Sbjct: 143  VGDFLLGQAFKLMVDVGSIEALSVLANAAAIIAEGEVMQLSAVKNIETSTSDYLKIINAK 202

Query: 610  TASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSD 431
            TA+L +A+ +   I +G        + +YG  LGL+FQ++DD+LD+  +A+ LGK  G D
Sbjct: 203  TAALFSAAAEVGPIIAGYKYKERFALREYGTLLGLAFQLIDDVLDYGGTAKHLGKNIGDD 262

Query: 430  LAKGNLTAPVIFA 392
              +G +T PVI A
Sbjct: 263  FREGKITMPVILA 275



>gb:AE017354_461000 Legionella pneumophila subsp. pneumophila str.
            Philadelphia 1, complete genome.
          Length = 322

 Score =  159 bits (401), Expect = 2e-37
 Identities = 94/320 (29%), Positives = 164/320 (51%), Gaps = 5/320 (1%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            +V++D   +N  +   + ++  ++   ++ I  +GGKR+RP +V L S            
Sbjct: 9    LVSEDFNAVNNLIIDKIQSQVGLIQDLSQHIVESGGKRLRPLVVLLASNACGYKG----- 63

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
             K+H  LA ++E  HTA+L+HDDV+DES +RRG++T + I+G++ +VL GD++F QS   
Sbjct: 64   -KDHISLAAMVEFFHTATLLHDDVIDESTLRRGRQTANSIWGSKASVLVGDYLFTQSVNL 122

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            +  +   E++ L++        GE+KQ ++  +  + ++DY      KTA L AA+    
Sbjct: 123  MVEVGIKEILNLLANTSHQITCGEVKQLANRHNPALTLDDYFDVIRAKTALLFAAAACIG 182

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
             I +     +   +Y YG +LG +FQ++DD LD+   A  LGK  G DLA G  T P+I 
Sbjct: 183  PILTNAPIELRNSLYNYGLHLGNAFQLIDDALDYCSDAATLGKNIGDDLADGKATLPLIH 242

Query: 394  ALET-----EPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            AL+      + ++R+ +                +++   I             A+  LE 
Sbjct: 243  ALQNGNATQQQQIRESLMKG--SLSHLPDILIAIEQTEAIPFTKRIAAQEVDSALSALEI 300

Query: 229  LPPSPFRVAXEEMVQYNLER 170
            LP S ++ A  ++ ++ LER
Sbjct: 301  LPDSVYKEALVDLAKFALER 320



>gb:AY658845_2147855 Synthetic construct Peudomonas aeruginosa clone
            FLH042424.01F PA4569 gene, partial cds.
          Length = 323

 Score =  158 bits (400), Expect = 3e-37
 Identities = 101/324 (31%), Positives = 161/324 (49%), Gaps = 5/324 (1%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            + + VV +D   ++  ++  + +  P++    + I SAGGKR+RP LV L  +       
Sbjct: 5    AFYRVVAEDFTAVDGIIRRQLTSRVPLVEKIGDYIISAGGKRLRPLLVLLAGKTLGYKGD 64

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                      LA  IE +HT++L+HDDV+D S +RRG+ T + ++G   +VL GDF++A+
Sbjct: 65   DLCL------LAATIEFLHTSTLLHDDVVDASGLRRGRSTANALWGNAPSVLVGDFLYAR 118

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S   +  L ++ V+++ISQ  +  A GE+ Q S + D     E Y+     KTA L  AS
Sbjct: 119  SFEMMVELGSMPVMRIISQATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEAS 178

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            T  AA         SE + ++G  LG++FQ+VDD+LD+   A  LGK  G DLA+G  T 
Sbjct: 179  THSAAALCQAGEEQSEALRRFGDYLGIAFQLVDDLLDYRGDAATLGKNVGDDLAEGKPTL 238

Query: 406  PVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQ 242
            P+I  +     E    +R  I+               V+  G +             AI 
Sbjct: 239  PLIVTMRDGTEEQAALVRKAIQQG--GSQDLESVCAAVEAAGALDYTANLARDYAARAIA 296

Query: 241  NLECLPPSPFRVAXEEMVQYNLER 170
             L+ LP + +R A  E+ ++ + R
Sbjct: 297  CLDTLPDNEYRSALVELSEFAVAR 320



>pir|AF3443|AF3443 geranyltranstransferase (EC 2.5.1.10) [imported] -
            Brucella melitensis (strain 16M)>gb:AE009589_253450
            Brucella melitensis 16M chromosome I, section 146 of 195
            of the complete sequence.>gb:AE008917_979362 Brucella
            melitensis 16M chromosome I, complete sequence.
          Length = 362

 Score =  158 bits (400), Expect = 3e-37
 Identities = 99/328 (30%), Positives = 161/328 (49%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            SV  L ++   D+  +N+ + S  G++  ++   A  + S+GGKR+RP +    +R    
Sbjct: 40   SVQPLVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGY 99

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                      H RLA  +E +HTA+L+HDDV+DESD+RRGK T   I+G + +VL GDF+
Sbjct: 100  EGDG------HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFL 153

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
              Q+   + ++ +++ + +++      A GE+ Q ++  + +   ++YL     KTA+L 
Sbjct: 154  LGQAFKMMVDVGSLDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALF 213

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            +A+ +   I +G        +  YG NLGL+FQ+VDD LD+  SA  LGK  G D  +G 
Sbjct: 214  SAAAEVGPIIAGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGK 273

Query: 415  LTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXX 251
            +T PVI +      E     +  IE               + + G I             
Sbjct: 274  ITLPVILSYRRGTDEERAFWKGAIEGGASDDASLQKAIGLMMKHGAIADTVQRARHFGEI 333

Query: 250  AIQNLECLPPSPFRVAXEEMVQYNLERV 167
            A   L  L  SP + A  E+V + + RV
Sbjct: 334  ARDALAPLKASPQKDALIEVVDFCISRV 361



>pir|C83075|C83075 octaprenyl-diphosphate synthase PA4569 [imported] -
            Pseudomonas aeruginosa (strain PAO1)>gb:AE004870_58804
            Pseudomonas aeruginosa PAO1, section 431 of 529 of the
            complete genome.>gb:AE004091_972904 Pseudomonas
            aeruginosa PAO1, complete genome.
          Length = 322

 Score =  158 bits (400), Expect = 3e-37
 Identities = 101/324 (31%), Positives = 161/324 (49%), Gaps = 5/324 (1%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            + + VV +D   ++  ++  + +  P++    + I SAGGKR+RP LV L  +       
Sbjct: 5    AFYRVVAEDFTAVDGIIRRQLTSRVPLVEKIGDYIISAGGKRLRPLLVLLAGKTLGYKGD 64

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                      LA  IE +HT++L+HDDV+D S +RRG+ T + ++G   +VL GDF++A+
Sbjct: 65   DLCL------LAATIEFLHTSTLLHDDVVDASGLRRGRSTANALWGNAPSVLVGDFLYAR 118

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S   +  L ++ V+++ISQ  +  A GE+ Q S + D     E Y+     KTA L  AS
Sbjct: 119  SFEMMVELGSMPVMRIISQATRVIAEGEVLQLSKVRDASTTEETYMEVIRGKTAMLFEAS 178

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            T  AA         SE + ++G  LG++FQ+VDD+LD+   A  LGK  G DLA+G  T 
Sbjct: 179  THSAAALCQAGEEQSEALRRFGDYLGIAFQLVDDLLDYRGDAATLGKNVGDDLAEGKPTL 238

Query: 406  PVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQ 242
            P+I  +     E    +R  I+               V+  G +             AI 
Sbjct: 239  PLIVTMRDGTEEQAALVRKAIQQG--GSQDLESVCAAVEAAGALDYTANLARDYAARAIA 296

Query: 241  NLECLPPSPFRVAXEEMVQYNLER 170
             L+ LP + +R A  E+ ++ + R
Sbjct: 297  CLDTLPDNEYRSALVELSEFAVAR 320



>gb:BX571856_780921 Staphylococcus aureus subsp. aureus strain
            MRSA252, complete genome.
          Length = 319

 Score =  158 bits (399), Expect = 4e-37
 Identities = 88/252 (34%), Positives = 147/252 (58%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            + +++  + + L+  + +++ VL  A+  + S+GGKR+RPA V L S+            
Sbjct: 6    MNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKDEQTS---- 61

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
            ++  ++A  +E+IH A+L+HDDV+D+SD RRGK T+ + +    A+L G+F+ A    +L
Sbjct: 62   EQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALGLEHL 121

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
              +++  V +LIS+ I D   GE+ Q    F+    + +YL +   KTA LI  ST+  A
Sbjct: 122  MAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQLSTEVGA 181

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            I S  D     ++   G  +G+SFQI+DD+LDFT + ++LGKP GSDL  G++T P++  
Sbjct: 182  ITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLPILLE 241

Query: 391  LETEPKLRDIIE 356
            +   P  +  IE
Sbjct: 242  MRKNPDFKLKIE 253



>gb:BA000033_711651 Staphylococcus aureus subsp. aureus MW2 DNA,
            complete genome, strain:MW2.>gb:BX571857_783632
            Staphylococcus aureus strain MSSA476, complete genome.
          Length = 319

 Score =  158 bits (399), Expect = 4e-37
 Identities = 88/252 (34%), Positives = 147/252 (58%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            + +++  + + L+  + +++ VL  A+  + S+GGKR+RPA V L S+            
Sbjct: 6    MNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKDEQTS---- 61

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
            ++  ++A  +E+IH A+L+HDDV+D+SD RRGK T+ + +    A+L G+F+ A    +L
Sbjct: 62   EQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALGLEHL 121

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
              +++  V +LIS+ I D   GE+ Q    F+    + +YL +   KTA LI  ST+  A
Sbjct: 122  MAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQISTEVGA 181

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            I S  D     ++   G  +G+SFQI+DD+LDFT + ++LGKP GSDL  G++T P++  
Sbjct: 182  ITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLPILLE 241

Query: 391  LETEPKLRDIIE 356
            +   P  +  IE
Sbjct: 242  MRKNPDFKLKIE 253



>gb:AE016961_367625 Coxiella burnetii strain RSA 493, section 2 of 7
            of the complete genome.>gb:AE016828_1008361 Coxiella
            burnetii strain RSA 493, complete genome.
          Length = 332

 Score =  158 bits (399), Expect = 4e-37
 Identities = 96/333 (28%), Positives = 170/333 (51%), Gaps = 5/333 (1%)
 Frame = -1

Query: 1153 DSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLV 974
            D  +   + SL + V +D+  ++  +   + +  P++ +    I  +GGKR+RP +V L 
Sbjct: 5    DKQATFEIESLRQPVQNDIEAVDALIVKELSSHVPLIETITHHIIQSGGKRLRPLVVLLT 64

Query: 973  SRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAV 794
            +R             EH+ LA +IE IHTA+L+HDDV+D+S  RRG++T + ++G   +V
Sbjct: 65   ARACGYEQDV-----EHQELATVIEFIHTATLLHDDVVDKSTQRRGQKTANALWGNSASV 119

Query: 793  LAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYY 614
            L GDF+++++   LA   N+ ++K+++      + GE+ Q  +  D D+    Y      
Sbjct: 120  LVGDFLYSRAFQILARRSNVPIMKILATTTNQISEGEVWQLMNQNDPDIDEVTYYEVIRR 179

Query: 613  KTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGS 434
            KTA L +A+ +  AI +  +    + M  +G +LG+++QI+DD+LD+++ A  L K  G 
Sbjct: 180  KTAQLFSAAAEIGAIVATKNETWQKSMAAFGFHLGMAYQIIDDLLDYSKDASALDKNVGD 239

Query: 433  DLAKGNLTAPVIFA-LETEP----KLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXX 269
            DLA+G  T P+I+A  + +P     +R+ I++                R           
Sbjct: 240  DLAEGKATLPLIYAKQQAQPAQAEHIREAIKNGDLDDLQSIMKLMDETRAREYTQQCALK 299

Query: 268  XXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                      L+ LPPSP+R A   + Q+ + R
Sbjct: 300  QAEKAHTY--LQQLPPSPYRDALNALTQFVVSR 330



>pir|F89925|F89925 heptaprenyl diphosphate syntase component II
            [imported] - Staphylococcus aureus (strain
            N315)>gb:CP000046_91633 Staphylococcus aureus subsp.
            aureus COL, complete genome.>gb:BA000017_677159
            Staphylococcus aureus subsp. aureus Mu50 DNA, complete
            genome.>gb:BA000018_679745 Staphylococcus aureus subsp.
            aureus N315 genomic DNA, complete genome.
          Length = 319

 Score =  158 bits (399), Expect = 4e-37
 Identities = 88/252 (34%), Positives = 147/252 (58%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            + +++  + + L+  + +++ VL  A+  + S+GGKR+RPA V L S+            
Sbjct: 6    MNNEIKKVEQRLEKAIKSKDSVLEQASLHLLSSGGKRVRPAFVILSSQFGKDEQTS---- 61

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
            ++  ++A  +E+IH A+L+HDDV+D+SD RRGK T+ + +    A+L G+F+ A    +L
Sbjct: 62   EQTYQVAVALELIHMATLVHDDVIDKSDKRRGKLTISKKWDQTTAILTGNFLLALGLEHL 121

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
              +++  V +LIS+ I D   GE+ Q    F+    + +YL +   KTA LI  ST+  A
Sbjct: 122  MAVKDNRVHQLISESIVDVCRGELFQFQDQFNSQQTIINYLRRINRKTALLIQISTEVGA 181

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            I S  D     ++   G  +G+SFQI+DD+LDFT + ++LGKP GSDL  G++T P++  
Sbjct: 182  ITSQSDKETVRKLKMIGHYIGMSFQIIDDVLDFTSTEKKLGKPVGSDLLNGHITLPILLE 241

Query: 391  LETEPKLRDIIE 356
            +   P  +  IE
Sbjct: 242  MRKNPDFKLKIE 253



>gb:AE014291_307855 Brucella suis 1330 chromosome I, complete
            sequence.
          Length = 340

 Score =  157 bits (398), Expect = 5e-37
 Identities = 99/328 (30%), Positives = 160/328 (48%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            SV  L ++   D+  +N+ + S  G++  ++   A  + S+GGKR+RP +    +R    
Sbjct: 18   SVQPLVDLTRADMARVNELILSRAGSDVEMIPEVANHLISSGGKRLRPMMTLASARMFGY 77

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                      H RLA  +E +HTA+L+HDDV+DESD+RRGK T   I+G + +VL GDF+
Sbjct: 78   EGDG------HVRLATSVEFMHTATLLHDDVVDESDLRRGKSTARTIWGNQASVLVGDFL 131

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
              Q+   + ++ + + + +++      A GE+ Q ++  + +   ++YL     KTA+L 
Sbjct: 132  LGQAFKMMVDVGSFDALDVLATSASIIAEGEVMQLAAAKNMETTEDEYLAVIKAKTAALF 191

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            +A+ +   I +G        +  YG NLGL+FQ+VDD LD+  SA  LGK  G D  +G 
Sbjct: 192  SAAAEVGPIIAGAQRSDRAALRDYGLNLGLAFQLVDDALDYGGSAADLGKNTGDDFREGK 251

Query: 415  LTAPVIFAL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXX 251
            +T PVI +      E     +  IE               + + G I             
Sbjct: 252  ITLPVILSYRRGTDEERAFWKGAIEGGASYDASLQKAIGLMMKHGAIADTVQRARHFGEI 311

Query: 250  AIQNLECLPPSPFRVAXEEMVQYNLERV 167
            A   L  L  SP + A  E+V + + RV
Sbjct: 312  ARDALAPLKASPQKDALIEVVDFCISRV 339



>pir|T43193|T43193 trans-pentaprenyltranstransferase homolog - fission
            yeast  (Schizosaccharomyces pombe)>gb:D89265_1675382
            Schizosaccharomyces pombe mRNA, partial cds, clone: SY
            1754.
          Length = 356

 Score =  157 bits (398), Expect = 5e-37
 Identities = 94/282 (33%), Positives = 153/282 (54%), Gaps = 26/282 (9%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX------- 956
            ++ ++L  ++  ++ ++ + +  L   ++    A GK+MRP+LV L+S+           
Sbjct: 36   LIKNELEQISPGIRQMLNSNSEFLEECSKYYTIAQGKQMRPSLVLLMSKATSLFHGIDRS 95

Query: 955  -------------XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQI 815
                                     RLA+I EMIH ASL+HDDV+D +++RRG  + +  
Sbjct: 96   VVGDKYTDDDDLRSFSTGQILPSQLRLAQITEMIHIASLLHDDVIDHANVRRGSPSSNVA 155

Query: 814  YGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQ------ASSLFDC 653
            +G R ++LAG+F+ A++S  +A L N +V +L++ VI D   GE  Q       SSL   
Sbjct: 156  FGNRRSILAGNFILARASTVMARLRNPQVTELLATVIADLVRGEFLQLKNTMDPSSLEIK 215

Query: 652  DVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDF 473
                + Y+ KS+ KTASLI+ S K + I       ++    +YGR +G +FQ++DD+LD+
Sbjct: 216  QSNFDYYIEKSFLKTASLISKSCKASTILGQCSPTVATAAGEYGRCIGTAFQLMDDVLDY 275

Query: 472  TQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEF 347
            T   + LGK AG+DL  G  TAPV+FA +  P+L  +I + F
Sbjct: 276  TSKDDTLGKAAGADLKLGLATAPVLFAWKKYPELGAMIVNRF 317



>gb:AP006618_561523 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 345

 Score =  157 bits (397), Expect = 6e-37
 Identities = 100/332 (30%), Positives = 165/332 (49%), Gaps = 4/332 (1%)
 Frame = -1

Query: 1150 SGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVS 971
            +G  +  A L   V + L  + K L + +      L  AA  +  AGGKR RP    L  
Sbjct: 19   AGVELGDAELAATVRNGLEEVEKLLIAELSDGEDFLQDAALHLAKAGGKRFRPLFTILTG 78

Query: 970  RXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVL 791
            +           T        ++E++H A+L HDDV+DE+ MRRG  +V+  +G  +A+L
Sbjct: 79   QLGPRPTDPALITA-----GTVVELVHLATLYHDDVMDEATMRRGAPSVNSRWGNNIAIL 133

Query: 790  AGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYK 611
            AGD++FA +S   + L   + +++I++   +  +G++++     +    +E YL   + K
Sbjct: 134  AGDYLFAHASRLTSTL-GPDAVRIIAETFAELVTGQMRETMGARESQDPVEHYLRVVWEK 192

Query: 610  TASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSD 431
            T SLIAA+ +    FSG D+   E++ + G  +G +FQI DDI+D + ++EQ GK  G+D
Sbjct: 193  TGSLIAAAGRFGGTFSGADTAHIERLARLGDAVGTAFQISDDIIDISSASEQSGKTPGTD 252

Query: 430  LAKGNLTAPVIFALETE----PKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXX 263
            L +G  T PV++AL  E     +LR +++               + R  G+         
Sbjct: 253  LREGVHTLPVLYALREEGAEADRLRTLLDHPLHSDDEVAEALELLGRSQGMVLAKEKLQS 312

Query: 262  XXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                A   L  LP  P   A E++V+Y +ERV
Sbjct: 313  YADQAYAELAALPSGPANDALEQLVRYTIERV 344



>gb:BA000012_671818 Mesorhizobium loti MAFF303099 DNA, complete
            genome.
          Length = 338

 Score =  157 bits (396), Expect = 8e-37
 Identities = 80/260 (30%), Positives = 145/260 (55%)
 Frame = -1

Query: 1171 MLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRP 992
            +L+++     P S+  L ++   D+  +N+ + S  G++  ++   A  + S+GGKR+RP
Sbjct: 4    VLNIENGKREPASIKDLIDLTAADMGRVNELILSKAGSDVEMIPEVANHLISSGGKRLRP 63

Query: 991  ALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIY 812
             L    ++            + H +LA  +E +HTA+L+HDDV+DES MRRGK+T   I+
Sbjct: 64   MLTLAAAQMFGYAG------EGHVKLATSVEFMHTATLLHDDVVDESGMRRGKKTARMIW 117

Query: 811  GTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDY 632
            G + +VL GDF+  Q+   + ++ ++E + ++S      A GE+ Q ++  + +   +++
Sbjct: 118  GNQASVLVGDFLLGQAFRMMVDVGSLEALDILSSAASIIAEGEVMQLAAAKNLETTEDEH 177

Query: 631  LIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQL 452
                  KTA+L +A+ +   + +         +  YG NLGL+FQ++DD LD+  +++ L
Sbjct: 178  FAVIKAKTAALFSAAAEVGPVIAQATRNDRAALRSYGMNLGLAFQLIDDALDYGGTSKDL 237

Query: 451  GKPAGSDLAKGNLTAPVIFA 392
            GK  G D  +G +T PVI A
Sbjct: 238  GKNVGDDFREGKVTLPVILA 257



>gb:U80443_1406255 Caenorhabditis elegans cosmid C24A11, complete
            sequence.
          Length = 393

 Score =  156 bits (395), Expect = 1e-36
 Identities = 83/229 (36%), Positives = 140/229 (61%), Gaps = 5/229 (2%)
 Frame = -1

Query: 1018 SAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRR 839
            SA  + +    + ++S             +   ++  I EMIHTASL+HDDV+DE++ RR
Sbjct: 104  SAANRSISEEYLAMLSTERSGIAAHLSVCQNQYKIGMIAEMIHTASLVHDDVIDEANTRR 163

Query: 838  GKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLF 659
            G  +V+ ++G +++VL GDF+ A+++  L ++    +I +++ +I+D   GE  Q S+  
Sbjct: 164  GSASVNAVWGNKMSVLVGDFILARATQILCSIGKPNIISVMASIIEDLVLGEFMQMSTT- 222

Query: 658  DCDV----GMEDYLIKSYYKTASLIAASTKGAAIFS-GVDSGISEQMYQYGRNLGLSFQI 494
              D      M+ Y+ K++ KTASL A+S + AAI + G D  + E  ++YGRNLG++FQ+
Sbjct: 223  PTDATPVDRMKAYIEKTHRKTASLFASSCRSAAILADGSDLKLHEIAFEYGRNLGIAFQL 282

Query: 493  VDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEF 347
             DD+LDF  +A+++GKP  +DL  G  TAPV++A E  P+L  ++  +F
Sbjct: 283  ADDLLDFIATADEMGKPVAADLKLGLATAPVLYACEQYPELNTMLLRKF 331



>pir|G87775|G87775 protein C24A11.9 [imported] - Caenorhabditis
           elegans
          Length = 277

 Score =  156 bits (394), Expect = 1e-36
 Identities = 80/196 (40%), Positives = 131/196 (66%), Gaps = 5/196 (2%)
 Frame = -1

Query: 919 RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
           ++  I EMIHTASL+HDDV+DE++ RRG  +V+ ++G +++VL GDF+ A+++  L ++ 
Sbjct: 21  KIGMIAEMIHTASLVHDDVIDEANTRRGSASVNAVWGNKMSVLVGDFILARATQILCSIG 80

Query: 739 NIEVIKLISQVIKDFASGEIKQASSLFDCDV----GMEDYLIKSYYKTASLIAASTKGAA 572
              +I +++ +I+D   GE  Q S+    D      M+ Y+ K++ KTASL A+S + AA
Sbjct: 81  KPNIISVMASIIEDLVLGEFMQMSTT-PTDATPVDRMKAYIEKTHRKTASLFASSCRSAA 139

Query: 571 IFS-GVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
           I + G D  + E  ++YGRNLG++FQ+ DD+LDF  +A+++GKP  +DL  G  TAPV++
Sbjct: 140 ILADGSDLKLHEIAFEYGRNLGIAFQLADDLLDFIATADEMGKPVAADLKLGLATAPVLY 199

Query: 394 ALETEPKLRDIIESEF 347
           A E  P+L  ++  +F
Sbjct: 200 ACEQYPELNTMLLRKF 215



>gb:AE017180_399615 Geobacter sulfurreducens PCA, complete genome.
          Length = 322

 Score =  155 bits (393), Expect = 2e-36
 Identities = 93/320 (29%), Positives = 157/320 (49%), Gaps = 5/320 (1%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            +V DDL  +    +  + ++  ++    E + ++GGKR+RP L+ L ++           
Sbjct: 7    LVGDDLKNVELQFRKDLESDVYLIRKVGEYVLASGGKRIRPMLLLLSAKLCGYQGD---- 62

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
               H  LA +IE IHTA+L+HDDV+D + +RRG  + ++++G   +VL GDF+F++S   
Sbjct: 63   --RHVPLASVIEFIHTATLLHDDVVDNATLRRGNASANEVWGNEASVLVGDFLFSKSFSL 120

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            +    ++ ++K+IS      A GE+ Q     D ++  E Y+     KTA L++A+ +  
Sbjct: 121  MVEAGDLRILKVISGATTIIAEGEVLQLLCTSDLEMTQERYIEVVKSKTAVLLSAACEAG 180

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
            AI     +   E +  +G +LG++FQ++DD LD+T S EQ GK  G DL +G +T P+I 
Sbjct: 181  AILGTSSAEQQEALRDFGMDLGIAFQLMDDTLDYTASEEQFGKEIGHDLEEGKITLPLIH 240

Query: 394  AL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
             L     E    +  ++E E             V + GGI                +L  
Sbjct: 241  TLMKCSDEERETIAAVVEKEILEPGDFESVFTLVHKYGGIEYTVSVANEYIARCKAHLGA 300

Query: 229  LPPSPFRVAXEEMVQYNLER 170
               S  + A  E+  Y + R
Sbjct: 301  FVDSQEKAALIELADYVVNR 320



>gb:AE016799_335437 Vibrio vulnificus CMCP6 chromosome I section 3
           of 11 of the complete sequence.>gb:AE016795_1045161
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 282

 Score =  155 bits (393), Expect = 2e-36
 Identities = 86/259 (33%), Positives = 138/259 (53%), Gaps = 5/259 (1%)
 Frame = -1

Query: 925 HRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN 746
           H   A  IE IHTA+L+HDDV+DESDMRRGK T +  +G   +VL GDF++ +S   +  
Sbjct: 25  HTTAAAFIEFIHTATLLHDDVVDESDMRRGKATANAAFGNAASVLVGDFIYTRSFQMMTE 84

Query: 745 LENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIF 566
           L +++++KL+S  +   A GE+ Q  +  D D   E Y+   Y KTA L  A+T+  AI 
Sbjct: 85  LGSMKILKLMSDAVNIIAEGEVLQLMNCNDPDTTEESYMQVIYSKTARLFEAATQIGAIL 144

Query: 565 SGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL- 389
           +   + +   +  YG+ LG +FQ++DD++D+T   E++GK  G DLA+G  T P++ A+ 
Sbjct: 145 NDAPAEVETALQNYGKYLGTAFQLIDDVMDYTSDGEEMGKNVGDDLAEGKPTLPLLHAMR 204

Query: 388 ----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPP 221
               E    +R+ IE+              +++ G +             AI  L+ LP 
Sbjct: 205 HTNAENAQMIREAIENA-NGMERLDDILAVMQQAGSLTYTEAKAMEEADKAIAELQVLPE 263

Query: 220 SPFRVAXEEMVQYNLERVK 164
           S ++ A   +    ++R K
Sbjct: 264 SEYKQALIALAHMAVKRSK 282



>gb:AJ749949_531501 Francisella tularensis subsp. tularensis complete
            genome.
          Length = 325

 Score =  154 bits (390), Expect = 4e-36
 Identities = 91/309 (29%), Positives = 165/309 (53%), Gaps = 5/309 (1%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            ++ +D+   N+ +   + ++  ++   +  I ++GGKR+RP LV L +R           
Sbjct: 10   LIKEDIQNNNQFIVDSLCSDVVLINQISHYIINSGGKRLRPLLVMLFARALNYNGD---- 65

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
              +H   A IIE IHTA+L+HDDV+D+S +RRGK+T + ++G   +VL GDF+++++   
Sbjct: 66   --KHLACAAIIEFIHTATLLHDDVVDDSQLRRGKQTANNVFGNAASVLTGDFLYSRAFQM 123

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            + +L+N++++++++      + GE+ Q  +  + ++  E+Y+   Y KTA L  A+ + A
Sbjct: 124  MVSLDNMQIMQILADATNKISEGEVLQLLNARNSELSEEEYIKVIYCKTAKLFEAACELA 183

Query: 574  AIFSGVDSGISE---QMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
             + S      ++   ++  YG  LG +FQI DD+LD+   AE LGK  G DL +G +T P
Sbjct: 184  GVISLDKQDYTKYQGRIKNYGVYLGNAFQIADDVLDYVSDAESLGKNIGDDLDEGKMTLP 243

Query: 403  VIFALE--TEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
             I+AL   TE + + + ++              VK  G +             A Q ++ 
Sbjct: 244  TIYALANVTEQQQQILKKAIEKGEYRIDEIIAMVKDSGAVDYSYKVACQYADLAKQQIDF 303

Query: 229  LPPSPFRVA 203
            LP S ++ A
Sbjct: 304  LPDSEYKQA 312



>gb:AE004969_61329 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 324

 Score =  154 bits (390), Expect = 4e-36
 Identities = 78/239 (32%), Positives = 133/239 (55%)
 Frame = -1

Query: 1105 DDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKE 926
            +DL  +N+ +   V ++  ++      I SAGGKR+RP +  L  +              
Sbjct: 14   EDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKAVGYDDEKLYS--- 70

Query: 925  HRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN 746
               LA ++E IHT++L+HDDV+DESD+RRG+ T + ++G   AVL GDF++ ++   +  
Sbjct: 71   ---LAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTRAFQLMVA 127

Query: 745  LENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIF 566
              ++ V+++++      A GE+ Q  ++ + D+  E Y+    YKTA L  A+ +  AI 
Sbjct: 128  SGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIRVIQYKTAKLFEAAAQVGAIL 187

Query: 565  SGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
                 G  + +  YG  +G +FQI+DD+LD++   E+ GK  G DLA+G  T P+I+ +
Sbjct: 188  GKASPGHEQALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTLPLIYLM 246



>gb:BX572596_800655 Rhodopseudomonas palustris CGA009 complete genome;
            segment 4/16.
          Length = 336

 Score =  154 bits (389), Expect = 5e-36
 Identities = 92/331 (27%), Positives = 157/331 (47%), Gaps = 6/331 (1%)
 Frame = -1

Query: 1144 SPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRX 965
            S  S+  L E+V  D+  +N  + S  G++  ++   A  + S+GGKR+RP L   ++  
Sbjct: 11   STASIDQLVELVAADMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANL 70

Query: 964  XXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAG 785
                         H +LA  +E +HTA+L+HDDV+DES+MRRGK++   ++G   +VL G
Sbjct: 71   TGYTGDG------HIKLAAAVEFMHTATLLHDDVVDESEMRRGKKSARMLWGNEASVLVG 124

Query: 784  DFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTA 605
            DF+  Q+   +  + ++  + ++S      A GE+ Q ++  +     ++YL     KTA
Sbjct: 125  DFLLGQAFRMMVEVGSLRALDILSSASATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTA 184

Query: 604  SLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLA 425
             L AA+ +     +            +G N+G++FQ++DD+LD+   A +LGK  G D  
Sbjct: 185  ELFAAACEVGPAIANRPKPEQSACRSFGMNIGIAFQLIDDVLDYGGKAAKLGKNVGDDFR 244

Query: 424  KGNLTAPVIFAL------ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXX 263
            +G +T PV+ A       E E  ++ +   E              K    +         
Sbjct: 245  EGKITLPVVLAFRRGNDAEREFWIKSLERGEISDADLDQAIKLMTKH-RALDDTIQRAHH 303

Query: 262  XXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                A+  L   P SP + A E++V + L R
Sbjct: 304  YGAMAVDALALFPSSPMKTALEQVVAFCLAR 334



>gb:CP000009_863976 Gluconobacter oxydans 621H, complete genome.
          Length = 315

 Score =  153 bits (386), Expect = 1e-35
 Identities = 91/301 (30%), Positives = 148/301 (49%), Gaps = 5/301 (1%)
 Frame = -1

Query: 1051 PVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIH 872
            P++      + +AGGKR+RP L    SR            + H  LA  +E IHTA+L+H
Sbjct: 17   PLIPQLGAHLVAAGGKRLRPLLTLASSRLCGYKSTPEN--QRHVGLAACVEFIHTATLLH 74

Query: 871  DDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFA 692
            DDV+DES++RRG  + + ++G + +VL GDF+FA+S   +    +++V+ ++S      A
Sbjct: 75   DDVVDESNLRRGLASANAVFGNKASVLVGDFLFARSFQLMTADGSLKVMAILSDASATIA 134

Query: 691  SGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNL 512
             GE+ Q  +  D    ++ YL   + KTA+L AA+ +  A+ +         + ++G NL
Sbjct: 135  EGEVLQMVTQNDLSTPVDRYLEVIHGKTAALFAAACRVGAVVADRPEAEELALDRFGTNL 194

Query: 511  GLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALET-----EPKLRDIIESEF 347
            G++FQ+VDD LD+    + LGK  G D+ +G +T PV+ A E            +IE   
Sbjct: 195  GMAFQLVDDALDYAADQQILGKTVGDDMREGKITLPVLAAYEAGSAEDRAFWERVIEKGE 254

Query: 346  CXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                        +++ G I             A+  L   P S  R    E VQY ++R 
Sbjct: 255  QTEADLPHALALIEKTGAIATTIARAQAYAAEAVDALSIFPDSELRRLMTETVQYTVDRA 314

Query: 166  K 164
            +
Sbjct: 315  R 315



>gb:CR767821_116403 Ehrlichia ruminantium strain Welgevonden, complete
            genome.>gb:CR925677_117310 Ehrlichia ruminantium str.
            Gardel, complete genome.>gb:CR925678_118261 Ehrlichia
            ruminantium str. Welgevonden, complete genome.
          Length = 325

 Score =  152 bits (384), Expect = 2e-35
 Identities = 76/215 (35%), Positives = 130/215 (60%)
 Frame = -1

Query: 1030 EQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDES 851
            + +  +GGKR+RP + F++ +             +   +A  IE IH A+L+HDDV+DES
Sbjct: 43   QHLIKSGGKRIRPIIFFIICKMLNYNK------NDKVYIAAAIEFIHNATLLHDDVIDES 96

Query: 850  DMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQA 671
            ++RRG++T + ++G + ++L GDF+ A S  +L   +N+ ++ ++S+       GE++Q 
Sbjct: 97   ELRRGEKTSNFLWGNKASILVGDFLLAVSFQWLIQCKNLTILSILSKTSNTIIIGEVEQM 156

Query: 670  SSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIV 491
             + ++ ++  E Y+     KTASL  A+ + AA  + V++     + Q+G NLG+SFQI+
Sbjct: 157  VASYNINISQEKYIDIISAKTASLFEATCESAANLAEVNNEKIHALKQFGYNLGISFQIL 216

Query: 490  DDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
            DDILD+T S  Q GK  G+DL  G +T P+I A +
Sbjct: 217  DDILDYTASETQFGKKLGNDLLTGKITLPIIIAYQ 251



>pir|A81213|A81213 octaprenyl-diphosphate synthase (EC 2.5.1.-)
            NMA2161 [imported] - Neisseria meningitidis (strain MC58
            serogroup B, strain Z2491 serogroup A)>gb:AE002389_45797
            Neisseria meningitidis serogroup B strain MC58 section 31
            of 206 of the complete genome.>gb:NMA7Z2491_155029
            Neisseria meningitidis serogroup A strain Z2491 complete
            genome; segment 7/7.>gb:AE002098_895910 Neisseria
            meningitidis serogroup B strain MC58 complete genome.
          Length = 324

 Score =  152 bits (384), Expect = 2e-35
 Identities = 91/316 (28%), Positives = 156/316 (49%), Gaps = 3/316 (0%)
 Frame = -1

Query: 1105 DDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKE 926
            +DL  +N+ +   V ++  ++      I SAGGKR+RP +  L  +              
Sbjct: 14   EDLAKVNEVINRAVQSDVALISQIGTYIISAGGKRLRPIMTILAGKAVGYDDEKLYS--- 70

Query: 925  HRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN 746
               LA ++E IHT++L+HDDV+DESD+RRG+ T + ++G   AVL GDF++ ++   +  
Sbjct: 71   ---LAAMVEFIHTSTLLHDDVVDESDLRRGRATANNLFGNAAAVLVGDFLYTRAFQLMVA 127

Query: 745  LENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIF 566
              ++ V+++++      A GE+ Q  ++ + D+  E Y+    YKTA L  A+ +  AI 
Sbjct: 128  SGSMRVLEVMADATNIIAEGEVMQLMNIGNTDITEEQYIQVIQYKTAKLFEAAAQVGAIL 187

Query: 565  SGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
                      +  YG  +G +FQI+DD+LD++   E+ GK  G DLA+G  T P+I+ + 
Sbjct: 188  GKASPEHERALKDYGMYVGTAFQIIDDVLDYSGETEETGKNVGDDLAEGKPTLPLIYLMR 247

Query: 385  --TEPKLRDIIES-EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSP 215
              +E    D+  + E             V R   +             A+  L+ LP S 
Sbjct: 248  QGSEQVANDVRTALENADRSYFEKIHDYVVRSDALAYSIGEARKAVDCAVTALDALPDSE 307

Query: 214  FRVAXEEMVQYNLERV 167
             + A  ++ + +L RV
Sbjct: 308  VKDAMIQLAKESLVRV 323



>pir|A84759|A84759 probable trans-prenyltransferase [imported] -
            Arabidopsis thaliana>gb:AC004077_1531357 Arabidopsis
            thaliana chromosome 2 clone T31E10 map ve016, complete
            sequence.
          Length = 297

 Score =  151 bits (382), Expect = 3e-35
 Identities = 88/251 (35%), Positives = 139/251 (55%), Gaps = 13/251 (5%)
 Frame = -1

Query: 1069 IVGAENPVLMSAAEQIFSAG--GKRMRPALVFLVSRXX-----------XXXXXXXXXTK 929
            +V AE P L SAAE  F  G  GK+ R  ++ L++                         
Sbjct: 1    MVLAEVPKLASAAEYFFKRGVQGKQFRSTILLLMATALNVRVPEALIGESTDIVTSELRV 60

Query: 928  EHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA 749
              R +AEI EMIH ASL+HDDVLD++D RRG  +++ + G +V                 
Sbjct: 61   RQRGIAEITEMIHVASLLHDDVLDDADTRRGVGSLNVVMGNKV----------------- 103

Query: 748  NLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAI 569
                   + L++  ++   +GE  + +S  +    M+ Y+ K+YYKTASLI+ S K  A+
Sbjct: 104  -------VALLATAVEHLVTGETMEITSSTEQRYSMDYYMQKTYYKTASLISNSCKAVAV 156

Query: 568  FSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
             +G  + ++   ++YGRNLGL+FQ++DDILDFT ++  LGK + SD+  G +TAP++FA+
Sbjct: 157  LTGQTAEVAVLAFEYGRNLGLAFQLIDDILDFTGTSASLGKGSLSDIRHGVITAPILFAM 216

Query: 388  ETEPKLRDIIE 356
            E  P+LR++++
Sbjct: 217  EEFPQLREVVD 227



>gb:BX248584_763717 Blochmannia floridanus complete genome; segment
            1/3.
          Length = 324

 Score =  151 bits (381), Expect = 4e-35
 Identities = 87/328 (26%), Positives = 169/328 (51%), Gaps = 5/328 (1%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +++  + +++  D++ +N  +   + +   ++    + I ++GGK++R  ++ L+++   
Sbjct: 1    MNINQINKLIKQDIININFEIHKRLKSNIILINKFIKYIINSGGKKIRSTMILLIAKSLT 60

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                      +H  LA +IE IHTA+L+HDDV+D S  RRGK T + I+G   ++L GDF
Sbjct: 61   YNKT------QHTILATLIEFIHTATLLHDDVIDHSTTRRGKTTANIIFGNPASILIGDF 114

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   +  L+++ ++ L++  +   A GEI Q +   D  + M +Y+   Y KTA L
Sbjct: 115  IYTRAFQMMTELQSLRILSLMADAVNIIAEGEILQLTYCNDPTITMNNYMQIIYKKTARL 174

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQS-AEQLGKPAGSDLAK 422
               +++ +AI +  +    + +  YG+ +G++FQ++DD+LD+  S     GK  G+DL +
Sbjct: 175  FEVASQSSAILAHANIQQEQALSNYGKYIGIAFQLIDDLLDYNASDIVSFGKNIGNDLNE 234

Query: 421  GNLTAPVIFAL-ETEPKLRDIIESEFC---XXXXXXXXXXXVKRCGGIXXXXXXXXXXXX 254
            G LT P++ A+  + PK   II                   +++ G +            
Sbjct: 235  GKLTLPLLHAIYHSTPKEASIIHQAITDKNNQNLLYTVLNIMQQYGSLDYTRKCAETKIN 294

Query: 253  XAIQNLECLPPSPFRVAXEEMVQYNLER 170
             AI  L  L PSP++ A + +  + L R
Sbjct: 295  KAINCLNILSPSPYKHALKHLAYFILTR 322



>gb:AP006841_570618 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 324

 Score =  150 bits (380), Expect = 6e-35
 Identities = 105/331 (31%), Positives = 164/331 (49%), Gaps = 7/331 (2%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            S++ +   +T +L        S + + N +L +    I    GK MRP LV LV++    
Sbjct: 3    SLSLIKSPITTELEDFKNLFDSSLSSSNLLLNNVIAHIRQRNGKMMRPILVLLVAKLYGE 62

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                     E    A  +E++HTASL+HDDV+DES  RRG+ +V+ I+  +VAVL GDF+
Sbjct: 63   IK------PETLHAAVSLELLHTASLVHDDVVDESTERRGQLSVNAIFNNKVAVLVGDFL 116

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
             A S  +     N ++I +++ + +D A GEI Q S++ + +     Y      KTA+L 
Sbjct: 117  LATSLVHAERTRNHDIIGVVACLGQDLAEGEILQLSNVSNREYSETIYFDVIRKKTAALF 176

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            AA TK AA+   V    +E    +G N+G+ FQI DDI D+ +S E +GKP G+D+ +G 
Sbjct: 177  AACTKAAALSVEVTDEKAEFARLFGENIGICFQIKDDIFDYFESKE-IGKPTGNDMLEGK 235

Query: 415  LTAPVIFALET-------EPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXX 257
            LT P ++ L T       E  LR  +++              +K+ GGI           
Sbjct: 236  LTLPALYVLNTTTDAWAQEMALR--VKAGTATVDEITRLIEFIKQNGGIEYAVKVMYEYK 293

Query: 256  XXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
              A+  L  LP S  + +    + Y ++R K
Sbjct: 294  ERALDLLRTLPDSAVKTSLITYLDYVVDRDK 324



>gb:AE006071_215234 Pasteurella multocida subsp. multocida str. Pm70
            section 38 of 204 of the complete
            genome.>gb:AE004439_1117964 Pasteurella multocida subsp.
            multocida str. Pm70, complete genome.
          Length = 330

 Score =  150 bits (380), Expect = 6e-35
 Identities = 81/250 (32%), Positives = 141/250 (56%)
 Frame = -1

Query: 1138 ISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXX 959
            +S+  + +++  D+   N+ + + + ++  ++      I  +GGKR+RP +  L +R   
Sbjct: 8    MSIDDIQKLIHRDMQKTNETILAQLNSDVTLINQLGYYIIQSGGKRIRPMIAILAARALG 67

Query: 958  XXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDF 779
                     ++    A  IE IHTA+L+HDDV+DES +RRG  T +  +G   +VL GDF
Sbjct: 68   FHG------EQPITCATFIEFIHTATLLHDDVVDESALRRGNPTANAEFGNAASVLVGDF 121

Query: 778  MFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASL 599
            ++ ++   +  L+++ ++K++S      A GE++Q  ++ D +   E+Y+   Y KTA L
Sbjct: 122  IYTRAFQLMTQLDSLRILKVMSDATNVIAEGEVQQLMNVNDPNTTEENYMQVIYGKTARL 181

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
              A+T  AAI +         + +YG  LG +FQ+VDDILD++  A+ LGK  G DLA+G
Sbjct: 182  FEAATHCAAILAHATEAQENALREYGCYLGTAFQLVDDILDYSADAQALGKNIGDDLAEG 241

Query: 418  NLTAPVIFAL 389
              T P++ A+
Sbjct: 242  KPTLPLLHAM 251



>gb:CP000030_83961 Anaplasma marginale str. St. Maries, complete
            genome.
          Length = 327

 Score =  149 bits (375), Expect = 2e-34
 Identities = 79/250 (31%), Positives = 138/250 (55%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            ++  L  +V +DL  + + +     ++   +      +  +GGKR+RP L+  V +    
Sbjct: 8    ALIDLKSLVLEDLQAMEQLIVDTSNSDISYIADIISHLMLSGGKRIRPILLLAVCKMLAL 67

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                    +   R+A  IE IH+A+L+HDDV+D+S++RRG +T + ++G + ++L GDF+
Sbjct: 68   AD------ERRIRIAAAIEFIHSATLLHDDVVDQSELRRGAKTSNSLWGNKASILVGDFL 121

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
             A +  ++ +  N E++ ++S   +   +GEI+Q     + D+  E Y+     KTA+L 
Sbjct: 122  LAAAFQWIVSCGNFELLTVLSGASRTIVAGEIQQMVYSKNLDITREKYIEIISAKTAALF 181

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            +A+ + A + S    G  E +  +G N G++FQIVDD+LD+T   EQ GK    DL  G 
Sbjct: 182  SATCESAGVLSESPHGNREALRDFGHNFGITFQIVDDLLDYTAQHEQWGKAHSQDLNNGQ 241

Query: 415  LTAPVIFALE 386
            +T P+I A E
Sbjct: 242  VTLPLIMAYE 251



>gb:AB006850_1017 Gluconobacter suboxydans ddsA gene for decaprenyl
            diphosphate synthase, complete cds.
          Length = 315

 Score =  149 bits (375), Expect = 2e-34
 Identities = 94/317 (29%), Positives = 156/317 (49%), Gaps = 5/317 (1%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            +L  N+ + + + +  P++      + +AGGKR+RP L    +R            + H 
Sbjct: 1    MLACNRAIIARMESPVPLIPQLGAHLVAAGGKRLRPLLTLASARLCGYQPGPDH--QRHV 58

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
             LA  +E IHTA+L+HDDV+DES +RRG  + + ++G + +VL GDF+FA+S   +    
Sbjct: 59   GLAACVEFIHTATLLHDDVVDESTLRRGLASANAVFGNKASVLVGDFLFARSFQLMTADG 118

Query: 739  NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
            +++V+ ++S      A GE+ Q     D    +E YL   + KTA+L AA+ +  A+ + 
Sbjct: 119  SLKVMAILSDASATIAEGEVLQMVVQNDLTTPVERYLEVIHGKTAALFAAACRVGAVVAE 178

Query: 559  VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALET- 383
                  E + ++G NLG++FQ+VDD LD+    + LGK  G D+ +G +T PV+ A E  
Sbjct: 179  RPEAEEEALERFGTNLGMAFQLVDDALDYAADQQVLGKTVGDDMREGKITLPVLAAYEAG 238

Query: 382  EPKLR----DIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSP 215
             P+ R     +I                + + G I             A++ L   P S 
Sbjct: 239  SPEDRIFWERVIGEGEQTEDDLPHALNLIAKTGAINTTIARAQVYADAAVEALSIFPDSE 298

Query: 214  FRVAXEEMVQYNLERVK 164
             R    E VQ+ + R +
Sbjct: 299  LRRLLIETVQFTVNRAR 315



>pir|T45152|T45152 bifunctional short chain isoprenyl diphosphate
            synthase [imported] - Methanobacterium
            thermoautotrophicum>gb:S75695_169052 idsA=bifunctional
            short chain isoprenyl diphosphate synthase
            [Methanobacterium thermoautotrophicum, Marburg, Genomic,
            1380 nt].
          Length = 325

 Score =  148 bits (373), Expect = 4e-34
 Identities = 86/224 (38%), Positives = 128/224 (57%), Gaps = 4/224 (1%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            L+ A+E + +AGGK++RP+L  L               ++   +A  IE+IHT SLIHDD
Sbjct: 31   LLKASEHLITAGGKKIRPSLALLSCEAVGGNP------EDAAGVAAAIELIHTFSLIHDD 84

Query: 865  VLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKD---- 698
            ++D+ +MRRG+ +VH I+G  +A+LAGD +F+++   +    + E +K    V+ D    
Sbjct: 85   IMDDDEMRRGEPSVHVIWGEPMAILAGDVLFSKAFEAVIRNGDSERVKDALAVVVDSCVK 144

Query: 697  FASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGR 518
               G+          DV  ++Y+   Y KTA+LIAA+TK  AI  G      E +  YG+
Sbjct: 145  ICEGQALDMGFEERLDVTEDEYMEMIYKKTAALIAAATKAGAIMGGASEREVEALEDYGK 204

Query: 517  NLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
             +GL+FQI DD LD     E LGKP GSD+A+G +T  V+ ALE
Sbjct: 205  FIGLAFQIHDDYLDVVSDEESLGKPVGSDIAEGKMTLMVVKALE 248



>sp|Q53479|IDSA_METTM Bifunctional short chain isoprenyl diphosphate
            synthase [Includes: Farnesyl pyrophosphate synthetase (EC
            2.5.1.1) (FPP synthetase) (Dimethylallyltransferase);
            Geranyltranstransferase (EC 2.5.1.10)].
          Length = 324

 Score =  148 bits (373), Expect = 4e-34
 Identities = 86/224 (38%), Positives = 128/224 (57%), Gaps = 4/224 (1%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            L+ A+E + +AGGK++RP+L  L               ++   +A  IE+IHT SLIHDD
Sbjct: 30   LLKASEHLITAGGKKIRPSLALLSCEAVGGNP------EDAAGVAAAIELIHTFSLIHDD 83

Query: 865  VLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKD---- 698
            ++D+ +MRRG+ +VH I+G  +A+LAGD +F+++   +    + E +K    V+ D    
Sbjct: 84   IMDDDEMRRGEPSVHVIWGEPMAILAGDVLFSKAFEAVIRNGDSERVKDALAVVVDSCVK 143

Query: 697  FASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGR 518
               G+          DV  ++Y+   Y KTA+LIAA+TK  AI  G      E +  YG+
Sbjct: 144  ICEGQALDMGFEERLDVTEDEYMEMIYKKTAALIAAATKAGAIMGGASEREVEALEDYGK 203

Query: 517  NLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
             +GL+FQI DD LD     E LGKP GSD+A+G +T  V+ ALE
Sbjct: 204  FIGLAFQIHDDYLDVVSDEESLGKPVGSDIAEGKMTLMVVKALE 247



>gb:AE017320_441421 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 12 of 12 of the complete
            genome.>gb:AE017285_1074582 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 321

 Score =  147 bits (372), Expect = 5e-34
 Identities = 85/235 (36%), Positives = 131/235 (55%)
 Frame = -1

Query: 1087 NKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAE 908
            N  L + VG  +P++   A  +  AGGKR+RP L  LV+R                 LA 
Sbjct: 16   NATLATEVGTLHPLVQPVAAHVLKAGGKRLRPLLTLLVARALGYADDDIYP------LAC 69

Query: 907  IIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEV 728
             +E++H+A+L+HDD+LD++D+RRG    H ++G+   VLAGD + A ++  +A   +  +
Sbjct: 70   SVELLHSATLLHDDILDDADLRRGMAAAHTVFGSTATVLAGDALLALANLIVARYGDPRL 129

Query: 727  IKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSG 548
               IS+ I   A+GEI + + +   D G + Y+     KTA ++ AS +  A+ +G    
Sbjct: 130  TACISEAIIRTATGEIVEIAHMRGTDHGRDTYIDIITGKTAWMLRASCELGALRAGASEE 189

Query: 547  ISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALET 383
                   +G +LG++FQIVDD LDF   A+  GKP G DL +G LT P+I+ LET
Sbjct: 190  AVRAAAAFGLDLGIAFQIVDDALDFADRAD-TGKPVGGDLREGKLTPPLIYYLET 243



>sp|O26156|IDSA_METTH Bifunctional short chain isoprenyl diphosphate
            synthase [Includes: Farnesyl pyrophosphate synthetase (EC
            2.5.1.1) (FPP synthetase) (Dimethylallyltransferase);
            Geranyltranstransferase (EC 2.5.1.10)].>pir|G69165|G69165
            bifunctional short chain isoprenyl diphosphate synthase -
            Methanobacterium thermoautotrophicum (strain Delta
            H)>gb:AE000797_27753 Methanobacterium thermoautotrophicum
            from bases 26164 to 36324 (section 3 of 148) of the
            complete genome.>gb:AE000666_924835 Methanobacterium
            thermoautotrophicum str. Delta H complete genome.
          Length = 325

 Score =  147 bits (372), Expect = 5e-34
 Identities = 88/234 (37%), Positives = 129/234 (55%), Gaps = 4/234 (1%)
 Frame = -1

Query: 1075 QSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEM 896
            +SI       L+ A+E + +AGGK++RP+L  L S                  +A  IE+
Sbjct: 21   ESISDITPETLLRASEHLITAGGKKIRPSLALLSSEAVGGDPGDAAG------VAAAIEL 74

Query: 895  IHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLI 716
            IHT SLIHDD++D+ ++RRG+  VH ++G  +A+LAGD +F+++   +    + E++K  
Sbjct: 75   IHTFSLIHDDIMDDDEIRRGEPAVHVLWGEPMAILAGDVLFSKAFEAVIRNGDSEMVKEA 134

Query: 715  SQVIKD----FASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSG 548
              V+ D       G+          DV  E+Y+   Y KTA+LIAA+TK  AI  G    
Sbjct: 135  LAVVVDSCVKICEGQALDMGFEERLDVTEEEYMEMIYKKTAALIAAATKAGAIMGGGSPQ 194

Query: 547  ISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
                +  YGR +GL+FQI DD LD     E LGKP GSD+A+G +T  V+ ALE
Sbjct: 195  EIAALEDYGRCIGLAFQIHDDYLDVVSDEESLGKPVGSDIAEGKMTLMVVKALE 248



>gb:AE013189_290038 Thermoanaerobacter tengcongensis MB4, section 216
            of 244 of the complete genome.>gb:AE008691_1112103
            Thermoanaerobacter tengcongensis strain MB4, complete
            genome.
          Length = 322

 Score =  147 bits (371), Expect = 6e-34
 Identities = 92/301 (30%), Positives = 154/301 (51%), Gaps = 2/301 (0%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            V ++L+ + K ++  V + N ++      + +  GK +RPA V + ++            
Sbjct: 11   VKEELVEVVKIMKKRVKSSNKLISDILLDMVNNSGKMLRPAFVIISAKFGNYDR------ 64

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
            K+   LA  IEM+H A+L+HDD++D + +RR K T+   YG   AV  GDF+F+QS   L
Sbjct: 65   KKILPLAAAIEMLHMATLVHDDIIDNALIRRSKPTIQAEYGKDYAVFIGDFLFSQSFLLL 124

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
            ++  N+  +K +S+V+     GEI Q  S +D ++ + DYL +   KTA+L A S    A
Sbjct: 125  SDNINVANLKKVSKVVSRICKGEIDQFESRYDINITINDYLKRIAAKTAALFALSFYVGA 184

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
              S     +++ +   G N+G++FQI+DDILD+T     +GKP  +D+ +G  T P+I++
Sbjct: 185  YESNCGEELAKILGSIGYNIGIAFQIIDDILDYTGEESVVGKPLCNDIRQGVFTLPLIYS 244

Query: 391  LE--TEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPS 218
            LE   + K+  +I+               V++ GGI             A   +  L  S
Sbjct: 245  LERNRDEKIISLIKKRNYCEDDIKRIVAFVQQNGGITQSKMLAEKYTKKAFDKIAMLKDS 304

Query: 217  P 215
            P
Sbjct: 305  P 305



>gb:BA000040_730791 Bradyrhizobium japonicum USDA 110 DNA, complete
            genome.
          Length = 335

 Score =  147 bits (370), Expect = 8e-34
 Identities = 90/327 (27%), Positives = 154/327 (47%), Gaps = 5/327 (1%)
 Frame = -1

Query: 1135 SVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            S+  L  +V  D+  +N  + S  G++  ++   A  + S+GGKR+RP L   ++     
Sbjct: 13   SIEELVALVAGDMERVNATILSRTGSDVTMIPEVANHLISSGGKRLRPMLTLAMANLAGY 72

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFM 776
                      H +LA  +E +HTA+L+HDDV+DES+MRRGK +   ++G   +VL GDF+
Sbjct: 73   TGDG------HIKLAASVEFMHTATLLHDDVVDESEMRRGKLSARMLWGNEASVLVGDFL 126

Query: 775  FAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLI 596
              Q+   +  + ++  + ++S      A GE+ Q ++  +     ++YL     KTA L 
Sbjct: 127  LGQAFRMMVEVGSLRALDILSAAAATIAEGEVMQLAAAKNTATTEDEYLAVIRGKTAELF 186

Query: 595  AASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGN 416
            AA+ +   + +             G NLG++FQ+VDD+LD+   + +LGK  G D  +G 
Sbjct: 187  AAACEVGPVIANRPKAEQTACRSVGMNLGIAFQLVDDVLDYGGKSAKLGKNTGDDFREGK 246

Query: 415  LTAPVIFAL----ETEPKL-RDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXX 251
            +T PV+ A     +TE       +E               + +   +             
Sbjct: 247  ITLPVVLAFRRGNDTERAFWIKALERGEIGDTDLDHAIGLMNKHRALEDTLSRAQHYGAM 306

Query: 250  AIQNLECLPPSPFRVAXEEMVQYNLER 170
            A+  L   P SP + A E++V + L R
Sbjct: 307  AVDALALFPSSPMKSALEQVVAFCLAR 333



>gb:AB003188_614 Micrococcus luteus hexs-a, menG, hexs-b gene,
            complete cds.
          Length = 325

 Score =  146 bits (369), Expect = 1e-33
 Identities = 81/237 (34%), Positives = 129/237 (54%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            ++ + K L   + +++  +  AA  I S+GGKR+RP  V L                +  
Sbjct: 14   IIEVEKRLYECIQSDSETINKAAHHILSSGGKRVRPMFVLL------SGFLNDTQKDDLI 67

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
            R A  +E++H ASL+HDD +D SDMRRG  +VH  +    A+  G F+ A++   +A + 
Sbjct: 68   RTAVSLELVHMASLVHDDYIDNSDMRRGNTSVHIAFDKDTAIRTGHFLLARALQNIATIN 127

Query: 739  NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
            N +  ++ S+ I +   GE  Q +  F+  V    YL +   KTA LI AS    A+ S 
Sbjct: 128  NSKFHQIFSKTILEVCFGEFDQMADRFNYPVSFTAYLRRINRKTAILIEASCHLGALSSQ 187

Query: 559  VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
            +D   +  + Q+G  +G+S+QI+DDILD+T     LGKP GSD+  G++T P++ A+
Sbjct: 188  LDEQSTYHIKQFGHCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPLMAAI 244



>pir|F86792|F86792 hypothetical protein ispB [imported] - Lactococcus
            lactis subsp. lactis (strain IL1403)>gb:AE006366_218244
            Lactococcus lactis subsp. lactis IL1403 section 128 of
            218 of the complete genome.>gb:AE005176_1095317
            Lactococcus lactis subsp. lactis IL1403, complete genome.
          Length = 319

 Score =  146 bits (368), Expect = 1e-33
 Identities = 89/254 (35%), Positives = 146/254 (57%), Gaps = 3/254 (1%)
 Frame = -1

Query: 1102 DLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEH 923
            +L+ + + ++S V  +N  + SA   IF AGGK +RPA + L S              E 
Sbjct: 17   ELVQVQQLMKSHVTIKNSDVKSAIFDIFDAGGKMLRPAYLLLFS------GFTDLSESER 70

Query: 922  RRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL 743
              LA  +EM+HTA+L+HDDV+D +D RRG  T+   YG  +AV AGD++F  + + L + 
Sbjct: 71   LALAASVEMMHTATLVHDDVIDHADTRRGVATLSAKYGPEIAVYAGDYLFI-AVFRLMSE 129

Query: 742  ENIEVIKLISQV--IKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAI 569
             ++E+  L   +  I+    GE+ Q +  F+    ++DY+     KT  L A S   A +
Sbjct: 130  HSLELSNLTKNIGSIERLLGGELGQLNHHFNLQQTLDDYIENISGKTGELFALSASVAPL 189

Query: 568  FSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
             S  ++ ++++ Y+ G N+G+SFQI+DD LD+  +A+ LGKP   D+ +G  +APV+FAL
Sbjct: 190  IS-KNNTLTKRAYKIGMNIGISFQIMDDYLDYASTAQTLGKPVLEDIKQGIYSAPVLFAL 248

Query: 388  -ETEPKLRDIIESE 350
             E    + ++I++E
Sbjct: 249  QENNALVSELIKNE 262



>gb:AE017258_418539 Wolbachia endosymbiont of Drosophila melanogaster,
            section 3 of 5 of the complete
            genome.>gb:AE017196_1059176 Wolbachia endosymbiont of
            Drosophila melanogaster, complete genome.
          Length = 328

 Score =  145 bits (366), Expect = 2e-33
 Identities = 84/248 (33%), Positives = 138/248 (55%), Gaps = 2/248 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMS-AAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            L ++V+ DL  +N  +   V  E+  L +     +  +GGK++RP LVF++ +       
Sbjct: 12   LDDIVSSDLSAMNDFVFKNVNDEDAKLATDIISHLVRSGGKKIRPKLVFIICKMLNYSG- 70

Query: 946  XXXXTKEHR-RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFA 770
                  E+R  +A  +E IH A+L+HDDVLDES+ R G +T ++I+G + ++L GD +  
Sbjct: 71   ------ENRINVAASVEFIHNATLLHDDVLDESEARHGVKTANKIWGNKSSILVGDLLLT 124

Query: 769  QSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
             +  +L    N+ ++ ++S+       GEIKQ ++ FD     E+Y      KTASL +A
Sbjct: 125  LAFRWLIECGNLNILSILSKASHLLVKGEIKQMTARFDPHTVRENYFDIIGEKTASLFSA 184

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
              + A+  SG  +  +E++  +G N G++FQIVDD+LD+T +    GK  G D  +G +T
Sbjct: 185  CCEAASTVSGATNDETERLKNFGFNFGMAFQIVDDMLDYTANQGTSGKQVGKDFFEGKVT 244

Query: 409  APVIFALE 386
             P I A E
Sbjct: 245  LPAIIAYE 252



>gb:AE016957_367188 Enterococcus faecalis V583, section 11 of 11 of
            the complete genome.>gb:AE016830_993676 Enterococcus
            faecalis V583, complete genome.
          Length = 328

 Score =  145 bits (366), Expect = 2e-33
 Identities = 91/302 (30%), Positives = 156/302 (51%), Gaps = 3/302 (0%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            +  ++ +L T  + ++  V  +N  + +A   +  +GGK +RPA   L S          
Sbjct: 10   YPTLSKELTTTLRLMEQAVQIDNQEIQAAVHDMIHSGGKLLRPAYQLLFS-----YFGEQ 64

Query: 940  XXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSS 761
               K+   LA  IE++HTA+L+HDD++DE+D RRG  T+   +G   AV  GD++F    
Sbjct: 65   RDPKKATALAASIELLHTATLVHDDIVDEADTRRGLPTLRSRFGNSTAVYTGDYLFVCCF 124

Query: 760  WYLANLEN-IEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
              L++  + ++ I+L S+ ++   +GE+ Q  + ++ +V ++ YL     KTA L A S 
Sbjct: 125  KLLSDYSSSLKSIQLNSRSMEKVLTGELGQMDNRYNFEVTIDQYLKNISGKTAELFALSC 184

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
               A  SG     +++  + G N+GL+FQI+DDILD+TQ+A+ +GKP   D+ +G  + P
Sbjct: 185  FVGAYESGTSQRFAKRCGEIGENIGLAFQIIDDILDYTQTADAIGKPVLEDVRQGVYSLP 244

Query: 403  VIFALET--EPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            +I+ALE   E  L  +++ E             V   GG+             A++ +  
Sbjct: 245  LIYALEANREVLLPLLMKKEALTDEETQEIYRLVHELGGVEKAQELATHYTEKALKEISK 304

Query: 229  LP 224
            LP
Sbjct: 305  LP 306



>gb:CQ867548_1454561 Sequence 16 from Patent WO2004074487.
          Length = 333

 Score =  144 bits (364), Expect = 4e-33
 Identities = 95/340 (27%), Positives = 165/340 (48%), Gaps = 6/340 (1%)
 Frame = -1

Query: 1168 LDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAEN-PVLMSAAEQIFSAGGKRMRP 992
            +++++D   P+    L E +  ++  +N  ++  + + + P +      +  AGGKR+RP
Sbjct: 1    MNVQEDVRKPLD--RLAEALAPEMEAVNALIRERMASRHAPRIPEVTAHLIEAGGKRLRP 58

Query: 991  ALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIY 812
             L    ++              H  LA  +E IHTA+L+HDDV+DES  RRG+ T + ++
Sbjct: 59   MLTLAAAKLLGYGGPY------HVHLAATVEFIHTATLLHDDVVDESRQRRGRPTANLLW 112

Query: 811  GTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDY 632
              + +VL GD++FA+S   +    ++  ++++S      A GE+ Q ++  D     + Y
Sbjct: 113  DNKSSVLVGDYLFARSFQLMVEPGSMRTLEILSNAAATIAEGEVLQLTAAQDLATNEDIY 172

Query: 631  LIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQL 452
            L     KTA+L +A+T+   + +GV       ++ YG  LG++FQIVDD+LD+  +AE +
Sbjct: 173  LQVVRGKTAALFSAATEVGGVIAGVPDAQVRALFDYGDALGIAFQIVDDLLDYGGTAEAI 232

Query: 451  GKPAGSDLAKGNLTAPVIFAL-ETEPKLRDI----IESEFCXXXXXXXXXXXVKRCGGIX 287
            GK  G D  +  LT PVI A+    P+ R      IE               + R G + 
Sbjct: 233  GKNTGDDFRERKLTLPVIKAVARATPEERAFWSRTIEKGDQKDGDLEHALELLARHGAMA 292

Query: 286  XXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                        A  +L+ LP  P R    ++  + +ER+
Sbjct: 293  DARRDALDWAARARASLQILPEHPIRDMLSDLADFVVERI 332



>gb:BA000021_687224 Wigglesworthia glossinidia endosymbiont of
            Glossina brevipalpis DNA, complete genome.
          Length = 323

 Score =  144 bits (364), Expect = 4e-33
 Identities = 74/246 (30%), Positives = 136/246 (55%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            +F+++  D++     L+  + +   ++    + I +  GK +RP  + L ++        
Sbjct: 6    IFKLINKDIINFQIELERSLYSNVDLIKKCNKYILNNNGKFIRPIAIILAAKSLFYNK-- 63

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                K+H  LA +IE+IH ++L+HDD++D++  RRG  +V+ ++G    +L GDF++ ++
Sbjct: 64   ----KKHIILASLIELIHMSTLLHDDIIDDAKKRRGNASVNVVFGNIPTILIGDFIYTRA 119

Query: 763  SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
               ++ L + ++ K+IS  +     GEI Q +     D+ +++Y+   Y KTA L   S 
Sbjct: 120  FQMISKLRSFKIFKIISNAVNMIVEGEILQLTYCNSVDITIKNYMQIIYKKTAKLFEVSL 179

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
            + AAI S       +    YGR LG+SFQI+DD LD+    ++ GK  G+DL +G +T P
Sbjct: 180  QSAAILSKSSYKEEQAFKNYGRYLGISFQIIDDFLDYKSDFKKFGKILGNDLKEGKVTLP 239

Query: 403  VIFALE 386
            +I A++
Sbjct: 240  LIHAMK 245



>gb:AE017241_414763 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 15 of 16 of the complete
            genome.>gb:AE016958_1058167 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 335

 Score =  144 bits (364), Expect = 4e-33
 Identities = 95/333 (28%), Positives = 167/333 (50%), Gaps = 5/333 (1%)
 Frame = -1

Query: 1153 DSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLV 974
            D G P   A+    V D +  + + + + + + + ++  +   +F AGGKR RP    L 
Sbjct: 12   DFGDPAFAAT----VRDGVGRIEQLMDTELRSADDIMTESLTHLFKAGGKRFRPLFTVLS 67

Query: 973  SRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAV 794
            ++             E      +IE++H A+L HDDV+DE+++RRG  T +  +G  VA+
Sbjct: 68   AQIGPDPDAA-----EVTIAGAVIELVHLATLYHDDVMDEAEVRRGTPTANVRWGNNVAI 122

Query: 793  LAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYY 614
            LAGD++FA +S  ++ L   E ++LI++      +G++++          +E YL   Y 
Sbjct: 123  LAGDYLFATASRLVSRL-GPEAVRLIAETFAQLVTGQMRETRGRKQGSDPIEHYLKVVYE 181

Query: 613  KTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGS 434
            KTA LIAA+ +  A+FSG D+   E++ + G  +G +FQI DDI+D    + + GK  G+
Sbjct: 182  KTACLIAAAGRFGAMFSGADADQVERLSRLGGIVGTAFQISDDIIDIDSDSHESGKLPGT 241

Query: 433  DLAKGNLTAPVIFALETEP-----KLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXX 269
            D+ +G  T P+++AL  EP     +LR+++                ++   G+       
Sbjct: 242  DVREGVHTLPMVYALR-EPGPDAARLRELLVGPIDDDEVVAEALTLLRASPGMAKAKQSL 300

Query: 268  XXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                  A + L+ LP  P R A + +V + + R
Sbjct: 301  REYAAQAHRELDQLPDVPGRRALQTLVDFTISR 333



>gb:BA000030_702751 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 336

 Score =  144 bits (363), Expect = 5e-33
 Identities = 83/243 (34%), Positives = 134/243 (55%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            L  + + L     +E P +  AA+ +  AGGKR RP LV L +R           +    
Sbjct: 24   LAAVEEGLLEATKSEVPFITEAAQHLVRAGGKRFRPLLVMLAARFGDPYAPGLVPS---- 79

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
              A ++E+ H A+L HDDV+DE+D+RRG  + +  +G  VAVL GDF+FA++S  LA+L 
Sbjct: 80   --AVVVELTHLATLYHDDVMDEADVRRGVPSANARWGNSVAVLTGDFLFARASHILADL- 136

Query: 739  NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
              E +++ ++  +   +G+I + +   D    +E YL     KT +L+A + +  A+ SG
Sbjct: 137  GPEAVRVQAEAFERLVTGQILETAGPMDGRDPVEHYLEVLSGKTGALVAVACRFGAMMSG 196

Query: 559  VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETE 380
             D  + + + QYG  LG++FQ+ DD+LD    + + GK  G+DL +G  T PV+   E  
Sbjct: 197  ADETVVDVLTQYGERLGVAFQLADDVLDIASDSHESGKTPGTDLREGIPTLPVLRLRERV 256

Query: 379  PKL 371
             +L
Sbjct: 257  ARL 259



>gb:AE017282_429681 Methylococcus capsulatus str. Bath, complete
            genome.
          Length = 340

 Score =  142 bits (359), Expect = 2e-32
 Identities = 78/217 (35%), Positives = 128/217 (58%), Gaps = 3/217 (1%)
 Frame = -1

Query: 1030 EQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDES 851
            + I  +GGKR+RP L  L ++              H  LA +IE IHTA+L+HDDV+DES
Sbjct: 55   QYIVGSGGKRLRPMLHLLSAKALGYPGD------HHITLAAVIEFIHTATLLHDDVVDES 108

Query: 850  DMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQA 671
             +RRG+++ + ++G   +VL GD+++++S   +  ++++ V+ ++S+     A GE+ Q 
Sbjct: 109  ALRRGQDSANALWGNSASVLVGDYLYSRSFELMVRVQDMRVMDILSRTTTAIAEGEVLQ- 167

Query: 670  SSLFDCDVGMED---YLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSF 500
              L +C+    D   YL     KTA L +A+ + AA+ +G    + E +  YG  LG++F
Sbjct: 168  --LLNCNNPATDEGRYLDVISRKTAILFSAAAQLAAVLAGSSHAVEESLKNYGTYLGIAF 225

Query: 499  QIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
            Q+ DD+LD+    E+ GK  G DLA+G  T P+I+AL
Sbjct: 226  QLKDDVLDYKADPEEWGKNLGDDLAEGKPTLPLIYAL 262



>gb:AE017261_420216 Picrophilus torridus DSM 9790, complete genome.
          Length = 328

 Score =  142 bits (359), Expect = 2e-32
 Identities = 86/251 (34%), Positives = 134/251 (53%), Gaps = 3/251 (1%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLA 911
            +N+ L   +  +   L   A     AGGKR RP L  L               ++   LA
Sbjct: 18   INQRLLDSIQTDEKYLYDMARYTIEAGGKRFRPLLTIL-----SFEIASGESYEKILDLA 72

Query: 910  EIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIE 731
               E+IHTASLIHDD++D SDMRRG+ T+    G   A++ GD++FA++ + L +    E
Sbjct: 73   AGYELIHTASLIHDDIIDHSDMRRGRYTLSYKEGINNAIVVGDYLFAKA-YELGSRYGKE 131

Query: 730  VIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDS 551
            V K+++    + A G+I +A ++ + ++  E YL     KTA   AA   GA   +G D 
Sbjct: 132  VSKIMADASSNLAEGQILEAENIGNLNMNEETYLKIIENKTARFFAACALGATKAAGADF 191

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALET---E 380
             IS ++  +  N+G++FQI DDILD   + + +GKPA  DL    +T P+I++L+     
Sbjct: 192  EISNRLSNFAYNMGMAFQITDDILDIIGNEKDMGKPAMVDLGHDVITLPIIYSLKNNYYN 251

Query: 379  PKLRDIIESEF 347
             K+RDI+   +
Sbjct: 252  NKIRDILTGNY 262



>gb:CP000031_84380 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 332

 Score =  142 bits (359), Expect = 2e-32
 Identities = 78/246 (31%), Positives = 135/246 (54%), Gaps = 1/246 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAEN-PVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            L   ++ ++  +N  +++ + +E+ P +      +  AGGKR+RP L    +R       
Sbjct: 13   LAATLSQEMAAVNALIRTRMASEHAPRIPEVTAHLVEAGGKRLRPMLTLAAARLCGYQG- 71

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                 ++H +LA  +E IHTA+L+HDDV+DES  RRG+ T + ++  + +VL GD++FA+
Sbjct: 72   -----EDHVKLAATVEFIHTATLLHDDVVDESGQRRGRPTANLLWDNKSSVLVGDYLFAR 126

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            S   +    ++ V+ +++      A GE+ Q ++  D       YL     KTA+L +A+
Sbjct: 127  SFQLMVETGSLRVLDILANAAATIAEGEVLQMTAASDLRTDESVYLQVVRGKTAALFSAA 186

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
            T+   + +GV       +++YG  LG++FQI DD+LD+   A+  GK  G D  +  LT 
Sbjct: 187  TEVGGVIAGVPEAQVRALFEYGDALGIAFQIADDLLDYQGDAKATGKNVGDDFRERKLTL 246

Query: 406  PVIFAL 389
            PVI A+
Sbjct: 247  PVIKAV 252



>gb:AY847292_647531 Rhodobacter sphaeroides strain 2.4.1 decaprenyl
            diphosphate synthase gene, complete cds.
          Length = 333

 Score =  142 bits (358), Expect = 2e-32
 Identities = 93/321 (28%), Positives = 155/321 (48%), Gaps = 6/321 (1%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAEN-PVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            + +D+  +N  ++  + +++ P +      +  AGGKR+RP L    +R           
Sbjct: 18   LAEDMAAVNGLIRERMASKHAPRIPEVTAHLVEAGGKRLRPLLTLAAARLCGYEGPY--- 74

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
               H  LA  +E IHTA+L+HDDV+DES  RRGK T + ++  + +VL GD++FA+S   
Sbjct: 75   ---HIHLAATVEFIHTATLLHDDVVDESHRRRGKPTANLLWDNKSSVLVGDYLFARSFQL 131

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            +    ++ V+ +++      + GE+ Q ++  D     + YL     KTA+L AA+T+  
Sbjct: 132  MVETGSLRVMDILANASATISEGEVLQLTAAQDLRTTEDIYLQVVRGKTAALFAAATEVG 191

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
             + +GV     E ++ YG  LG++FQIVDD+LD+     Q+GK  G D  +  LT PVI 
Sbjct: 192  GVVAGVPEAQVEALHAYGDALGIAFQIVDDLLDYGGVDAQIGKNTGDDFRERKLTLPVIK 251

Query: 394  AL-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLEC 230
            A+     E     + +IE               + R G +             A + L  
Sbjct: 252  AVAQADAEERAFWQRVIEKGDQREGDLEQAHAIMSRHGAMEAARQDALRWVTVAREALGQ 311

Query: 229  LPPSPFRVAXEEMVQYNLERV 167
            LP  P R    ++  + +ER+
Sbjct: 312  LPEHPLREMLHDLADFVVERI 332



>gb:AE017321_442164 Wolbachia endosymbiont strain TRS of Brugia
            malayi, complete genome.
          Length = 328

 Score =  142 bits (358), Expect = 2e-32
 Identities = 76/247 (30%), Positives = 134/247 (54%), Gaps = 1/247 (0%)
 Frame = -1

Query: 1123 LFEVVTDDLLTL-NKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            L ++V+ DL  + N   + +   +  +       +  +GGK++RP LVF++ +       
Sbjct: 12   LDDIVSSDLSAMKNFIFRDVNNGDVKLAADIISHLVRSGGKKVRPKLVFIICKMLNYSG- 70

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                 ++  ++A  +E IH A+L+HDDVLDES+ R G +T ++I+G + ++L GD +   
Sbjct: 71   -----EDRVKVAASVEFIHNATLLHDDVLDESEARHGVKTANKIWGNKSSILVGDLLLTL 125

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            +  +L    N+ ++ ++S       +GEIKQ ++ F+     ++Y      KTASL +A 
Sbjct: 126  AFRWLIECGNLNILSILSGASHSLVNGEIKQMAARFNSHTIRKNYFDIIGKKTASLFSAC 185

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
             + A++ S   S  +E++  +G N G++FQI+DD LD+T      GK  G D  +G +T 
Sbjct: 186  CEAASVISNATSNETERLKNFGLNFGMAFQIIDDTLDYTADQRTSGKQVGKDFFEGKVTL 245

Query: 406  PVIFALE 386
            P I A E
Sbjct: 246  PAIIAYE 252



>gb:PZE431695_162199 Paracoccus zeaxanthinifaciens phaA gene, phaB
            gene, ORF1 and ddsA gene.>gb:CQ867537_1454560 Sequence 5
            from Patent WO2004074487.
          Length = 333

 Score =  142 bits (357), Expect = 3e-32
 Identities = 94/340 (27%), Positives = 164/340 (48%), Gaps = 6/340 (1%)
 Frame = -1

Query: 1168 LDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAEN-PVLMSAAEQIFSAGGKRMRP 992
            +++++D   P+    L E +  ++  +N  ++  + + + P +      +  AGGKR+RP
Sbjct: 1    MNVQEDVRKPLD--RLAEALAPEMEAVNALIRERMASRHAPRIPEVTAHLIEAGGKRLRP 58

Query: 991  ALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIY 812
             L    ++              H  LA  +E IHTA+L+HDDV+DES  RRG+ T + ++
Sbjct: 59   MLTLAAAKLLGYGGPY------HVHLAATVEFIHTATLLHDDVVDESRQRRGRPTANLLW 112

Query: 811  GTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDY 632
              + +VL GD++FA+S   +    ++  ++++S      A GE+ Q ++  D     + Y
Sbjct: 113  DNKSSVLVGDYLFARSFQLMVEPGSMRTLEILSNAAATIAEGEVLQLTAAQDLATNEDIY 172

Query: 631  LIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQL 452
            L     KTA+L +A+T+   + +GV       ++ YG  LG++FQIVDD+LD+  +AE +
Sbjct: 173  LQVVRGKTAALFSAATEVGGVIAGVPDAQVRALFDYGDALGIAFQIVDDLLDYGGTAEAI 232

Query: 451  GKPAGSDLAKGNLTAPVIFAL-ETEPKLRDI----IESEFCXXXXXXXXXXXVKRCGGIX 287
             K  G D  +  LT PVI A+    P+ R      IE               + R G + 
Sbjct: 233  DKNTGDDFRERKLTLPVIKAVARATPEERAFWSRTIEKGDQKDGDLEHALELLARHGAMA 292

Query: 286  XXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLERV 167
                        A  +L+ LP  P R    ++  + +ER+
Sbjct: 293  DARRDALDWAARARASLQILPEHPIRDMLSDLADFVVERI 332



>gb:AB027705_1517527 Daucus carota mRNA for GGPP synthase, complete
            cds.
          Length = 366

 Score =  140 bits (354), Expect = 6e-32
 Identities = 96/291 (32%), Positives = 148/291 (50%), Gaps = 13/291 (4%)
 Frame = -1

Query: 1183 SSSPMLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPV-LMSAAEQIFSAGG 1007
            SS     +  DS    S       + +  +++NK L + V  + PV +  +      AGG
Sbjct: 54   SSVQTTKIVMDSSPTPSTFDFKSYMLEKAISVNKALDASVSLQEPVKIHESMRYSLLAGG 113

Query: 1006 KRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMRRGK 833
            KR+RP L                 +      A  +EMIHT SL+HDD+  +D  D+RRGK
Sbjct: 114  KRVRPLLSIAACELFGGHEAVAMPS------ACAVEMIHTMSLMHDDLPFMDNDDLRRGK 167

Query: 832  ETVHQIYGTRVAVLAGDFMFAQSSWYLANLE-----NIEVIKLISQVIK-----DFASGE 683
             T H++YG  VAVLAGD M A ++++L   E     + +V+++I ++ K        +G+
Sbjct: 168  PTNHKVYGESVAVLAGDAMLALAAFHLVATETRGVSSDQVVRVIVELAKAIGAEGLVAGQ 227

Query: 682  IKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLS 503
            I    S  D ++G+ED       KTA+L+  S    AI  G +    E++ +Y R +GL 
Sbjct: 228  IVDVCSEGDPNLGLEDLEFIHRSKTAALLEGSVVMGAILGGANDEEVEKVRKYARCIGLL 287

Query: 502  FQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESE 350
            FQ+VDDILD T+S+++LGK AG DL     T P +  +E   +  D ++ E
Sbjct: 288  FQVVDDILDVTKSSKELGKTAGKDLVADKTTYPKLIGIEKSREFSDELKRE 338



>pir|F69535|F69535 geranylgeranyl diphosphate synthase [validated] -
            Archaeoglobus fulgidus>gb:AE000947_29642 Archaeoglobus
            fulgidus DSM 4304 section 160 of 172 of the complete
            genome.>gb:AE000782_976161 Archaeoglobus fulgidus DSM
            4304 complete genome.
          Length = 326

 Score =  140 bits (354), Expect = 6e-32
 Identities = 106/332 (31%), Positives = 153/332 (46%), Gaps = 9/332 (2%)
 Frame = -1

Query: 1132 VASLFEVVTDDLLTLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXX 956
            +A L E +      +NK ++ ++    P+ L  AA  +  AGGKR+RP +  L       
Sbjct: 8    IAMLKEEIAKRAEIINKAIEELLPEREPIGLYKAARHLIKAGGKRLRPVISLLAVEALG- 66

Query: 955  XXXXXXXTKEHRRL---AEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAG 785
                    K++R++   A  IE IH  +L+HDD++D  +MRRG  TVH++YG   A+LAG
Sbjct: 67   --------KDYRKIIPAAVSIETIHNFTLVHDDIMDRDEMRRGVPTVHRVYGEATAILAG 118

Query: 784  DFMFAQSSWYLANL----ENI-EVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKS 620
            D +FA++   L       E I +  +++S V      G+    S      V  E+YL   
Sbjct: 119  DTLFAEAFKLLTKCDVESEGIRKATEMLSDVCIKICEGQYYDMSFEKKESVSEEEYLRMV 178

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
              KT  LIAAS    A+  G    I + ++ YG   G+ FQI DD+LD T   E+ GK  
Sbjct: 179  ELKTGVLIAASAALPAVLFGESEEIVKALWDYGVLSGIGFQIQDDLLDLT---EETGKDW 235

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXX 260
            GSDL KG  T  VI A E   KL+     E             ++ CG I          
Sbjct: 236  GSDLLKGKKTLIVIKAFEKGVKLK-TFGKEKADVSEIRDDIEKLRECGAIDYAASMARKM 294

Query: 259  XXXAIQNLECLPPSPFRVAXEEMVQYNLERVK 164
               A + LE LP S  +    E+  + + R K
Sbjct: 295  AEEAKRKLEVLPESKAKETLLELTDFLVTRKK 326



>gb:AE012881_286680 Chlorobium tepidum TLS section 102 of 194 of the
            complete genome.>gb:AE006470_933848 Chlorobium tepidum
            TLS complete genome.
          Length = 324

 Score =  140 bits (352), Expect = 1e-31
 Identities = 86/319 (26%), Positives = 159/319 (49%), Gaps = 5/319 (1%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            VT++L    +  ++++ + N ++      +    GK++RP LV L ++            
Sbjct: 10   VTEELKQFQERYKTVLHSSNSLVDKVTRYVLRQQGKQIRPTLVILAAKVCGGVHDVTY-- 67

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
                R A ++E++H+A+LIHDDV+D ++MRRG  +++ ++  +++VL GD++ ++   Y 
Sbjct: 68   ----RGAIMVELLHSATLIHDDVVDGAEMRRGIPSINALWKNKISVLIGDYLLSKGLLYS 123

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
               ++   + L+S+ ++  + GEI Q       D+  EDYL     KT SLIA S    A
Sbjct: 124  LENKDYRSLHLVSEAVRRMSEGEILQIQKTRSLDITEEDYLSVIADKTGSLIATSCAIGA 183

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
              S         +  YG  LGL+FQI DD+LD+T  +++ GK  G D+    +T P+I+A
Sbjct: 184  ASSTDSEDEIASLKSYGEFLGLAFQIRDDLLDYTGDSKKTGKQLGIDIKDRKITLPLIYA 243

Query: 391  L-----ETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECL 227
            L       + K++ I++S              V R GG+             A++++   
Sbjct: 244  LRQSDKSEQNKIKSILKSSRKRSVRSGEVIDFVTRKGGLDYAAEVAEGFADKALESIAHF 303

Query: 226  PPSPFRVAXEEMVQYNLER 170
            P S  + + + +V + ++R
Sbjct: 304  PESDAKRSLQLLVDFVMKR 322



>pir|B75457|B75457 polyprenyl synthase - Deinococcus radiodurans
            (strain R1)>gb:AE001946_41206 Deinococcus radiodurans R1
            section 83 of 229 of the complete chromosome
            1.>gb:AE000513_882101 Deinococcus radiodurans R1 complete
            chromosome 1.
          Length = 320

 Score =  140 bits (352), Expect = 1e-31
 Identities = 87/309 (28%), Positives = 147/309 (47%), Gaps = 6/309 (1%)
 Frame = -1

Query: 1078 LQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXX---XXXXXXXTKEHRRLAE 908
            ++ ++ ++   +    E + +AGGKR+RP +  L ++                E  RL+ 
Sbjct: 10   MREVLRSDVEFIAIIGEDLVTAGGKRVRPLVTLLAAQALGAGPDALATSHSWDELLRLSV 69

Query: 907  IIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEV 728
             +E++H+ASL+HDD++D+SD RRG+ET  + +G  V+V++GDFM A+    L+ +     
Sbjct: 70   CVELLHSASLLHDDLIDDSDKRRGQETAFRRFGNVVSVMSGDFMLARLLGELSGMPGSPA 129

Query: 727  I-KLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDS 551
            + +   Q       GE+ Q       D   E+Y    + KTA+L+  + +  A+  G D 
Sbjct: 130  LTRAFGQAASVICEGEVLQFQVASYADYSFENYFQVIHGKTAALLELAAQAPAMLLGADD 189

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL--ETEP 377
               + +  +GR  G++FQ+ DD+LD      Q+GKP G DL +G  T PV+  L    + 
Sbjct: 190  SARDALSTFGREYGMAFQMQDDLLDLLGEEAQIGKPVGGDLREGKATYPVLCLLGGPHDA 249

Query: 376  KLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXE 197
            ++R I+E                ++                 AI  L+ LPPSP R A  
Sbjct: 250  EVRAILERRAGEDGDVARMIALARQERTDDCTREEIRRRARLAIAALDALPPSPARTALA 309

Query: 196  EMVQYNLER 170
             + +  L R
Sbjct: 310  ALAERELNR 318



>gb:AE016939_362628 Bacteroides thetaiotaomicron VPI-5482, section 14
            of 21 of the complete genome.>gb:AE015928_989116
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 324

 Score =  139 bits (350), Expect = 2e-31
 Identities = 86/226 (38%), Positives = 126/226 (55%), Gaps = 2/226 (0%)
 Frame = -1

Query: 1054 NPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLI 875
            N +L S    I    GK MRP LV LV+R                  A  +E++HTASL+
Sbjct: 30   NALLDSVITHIRKRNGKMMRPILVLLVARLYGAVTPATLHA------AVSLELLHTASLV 83

Query: 874  HDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDF 695
            HDDV+DES  RRG+ +V+ I+  +V+VLAGD++ A S  +     N E+I+L+S + +  
Sbjct: 84   HDDVVDESTERRGQLSVNAIFNNKVSVLAGDYLLATSLVHAEQTNNYEIIRLVSSLGQKL 143

Query: 694  ASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQ--YG 521
            A GE+ Q S++ +     E Y      KTA+L AA  + AA+   V  G  E  +    G
Sbjct: 144  AEGELLQLSNVSNHSFSEEVYFDVIRKKTAALFAACAEAAAL--SVQVGEEEVAFARLLG 201

Query: 520  RNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALET 383
              +G+ FQI DDI D+  S +++GKP G+D+ +G LT P ++AL T
Sbjct: 202  EYIGICFQIKDDIFDYFDS-KKIGKPTGNDMLEGKLTLPALYALNT 246



>gb:CQ793218_1452960 Sequence 34 from Patent
            WO2004018694.>gb:CQ793220_1452961 Sequence 36 from Patent
            WO2004018694.
          Length = 317

 Score =  139 bits (349), Expect = 2e-31
 Identities = 103/318 (32%), Positives = 148/318 (46%), Gaps = 9/318 (2%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +NK ++ ++    P+ L  AA  +  AGGKR+RP +  L               K++R++
Sbjct: 13   INKAIEELLPEREPIGLYKAARHLIKAGGKRLRPVISLLAVEALG---------KDYRKI 63

Query: 913  ---AEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL 743
               A  IE IH  +L+HDD++D  +MRRG  TVH++YG   A+LAGD +FA++   L   
Sbjct: 64   IPAAVSIETIHNFTLVHDDIMDRDEMRRGVPTVHRVYGEATAILAGDTLFAEAFKLLTKC 123

Query: 742  ----ENI-EVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKG 578
                E I +  +++S V      G+    S      V  E+YL     KT  LIAAS   
Sbjct: 124  DVESEGIRKATEMLSDVCIKICEGQYYDMSFEKKESVSEEEYLRMVELKTGVLIAASAAL 183

Query: 577  AAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVI 398
             A+  G    I + ++ YG   G+ FQI DD+LD T   E+ GK  GSDL KG  T  VI
Sbjct: 184  PAVLFGESEEIVKALWDYGVLSGIGFQIQDDLLDLT---EETGKDWGSDLLKGKKTLIVI 240

Query: 397  FALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPS 218
             A E   KL+     E             ++ CG I             A + LE LP S
Sbjct: 241  KAFEKGVKLK-TFGKEKADVSEIRDDIEKLRECGAIDYAASMARKMAEEAKRKLEVLPES 299

Query: 217  PFRVAXEEMVQYNLERVK 164
              +    E+  + + R K
Sbjct: 300  KAKETLLELTDFLVTRKK 317



>gb:BX294145_769015 Pirellula sp. strain 1 complete genome; segment
            13/24.
          Length = 397

 Score =  139 bits (349), Expect = 2e-31
 Identities = 92/281 (32%), Positives = 139/281 (49%), Gaps = 12/281 (4%)
 Frame = -1

Query: 1186 ASSSPMLDLKKDSGSPISVASLFEVVTDDLLT----LNKNLQSIVGAENPVLMSAAEQIF 1019
            ASS  +      SG    + S++  + + L      L++ LQS   A  PVL    +   
Sbjct: 46   ASSDAVSSAHGTSGEVSPLRSIYAPIVESLAAVDARLHRELQSRYEALVPVLRHGTQ--- 102

Query: 1018 SAGGKRMRPALVFLVSRXXXXXXXXX--------XXTKEHRRLAEIIEMIHTASLIHDDV 863
              GGKR+RPAL+ L                      T++H  +A ++EM+HTA+LIHDDV
Sbjct: 103  -LGGKRLRPALLLLSGAAMHADRTSKNPLTTEELATTEDHIVMATVVEMVHTATLIHDDV 161

Query: 862  LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGE 683
            LD++  RR   T++  +    ++L GD++FAQS +  A L +    +L+ Q  +    GE
Sbjct: 162  LDKAATRRHVPTINARWNDDTSILLGDYLFAQSFYLAATLPSTLACRLVGQAAQKVCEGE 221

Query: 682  IKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLS 503
            ++Q       D+  E YL     KTA L   S +  A  SG D    E   ++G +LG++
Sbjct: 222  LRQVLGRDWLDIDEETYLDIIRGKTAELTRVSCQIGADLSGGDESQVEAFARFGNDLGIA 281

Query: 502  FQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETE 380
            FQI DD LD     + +GK  G+DL +G +T P+I  L  E
Sbjct: 282  FQIADDFLDLWGDDDDVGKTLGTDLQQGKITLPLIRLLRHE 322



>gb:AF120272_480639 Archaeoglobus fulgidus geranylgeranyl diphosphate
            synthase (gps) gene, complete cds.
          Length = 317

 Score =  139 bits (349), Expect = 2e-31
 Identities = 103/318 (32%), Positives = 148/318 (46%), Gaps = 9/318 (2%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +NK ++ ++    P+ L  AA  +  AGGKR+RP +  L               K++R++
Sbjct: 13   INKAIEELLPEREPIGLYKAARHLIKAGGKRLRPVISLLAVEALG---------KDYRKI 63

Query: 913  ---AEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL 743
               A  IE IH  +L+HDD++D  +MRRG  TVH++YG   A+LAGD +FA++   L   
Sbjct: 64   IPAAVSIETIHNFTLVHDDIMDRDEMRRGVPTVHRVYGEATAILAGDTLFAEAFKLLTKC 123

Query: 742  ----ENI-EVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKG 578
                E I +  +++S V      G+    S      V  E+YL     KT  LIAAS   
Sbjct: 124  DVESEGIRKATEMLSDVCIKICEGQYYDMSFEKKESVSEEEYLRMVELKTGVLIAASAAL 183

Query: 577  AAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVI 398
             A+  G    I + ++ YG   G+ FQI DD+LD T   E+ GK  GSDL KG  T  VI
Sbjct: 184  PAVLFGESEEIVKALWDYGVLSGIGFQIQDDLLDLT---EETGKDWGSDLLKGKKTLIVI 240

Query: 397  FALETEPKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPS 218
             A E   KL+     E             ++ CG I             A + LE LP S
Sbjct: 241  KAFEKGVKLK-TFGKEKADVSEIRDDIEKLRECGAIDYAASMARKMAEEAKRKLEVLPES 299

Query: 217  PFRVAXEEMVQYNLERVK 164
              +    E+  + + R K
Sbjct: 300  KAKETLLELTDFLVTRKK 317



>gb:AY534687_1612249 Antirrhinum majus geranyl diphosphate synthase
            large subunit mRNA, complete cds.
          Length = 372

 Score =  137 bits (345), Expect = 7e-31
 Identities = 94/290 (32%), Positives = 146/290 (50%), Gaps = 12/290 (4%)
 Frame = -1

Query: 1183 SSSPMLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENPV-LMSAAEQIFSAGG 1007
            + +P    +K S  P         + +   ++NK L+  V  + P+ +  +      AGG
Sbjct: 61   TKNPQESSQKTSKDPTFTLDFKTYMLEKASSVNKALEQAVLLKEPLKIHESMRYSLLAGG 120

Query: 1006 KRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMRRGK 833
            KR+RP L                 +      A  +EMIHT SLIHDD+  +D  D+RRGK
Sbjct: 121  KRVRPMLCIAACELVGGLESTAMPS------ACAVEMIHTMSLIHDDLPCMDNDDLRRGK 174

Query: 832  ETVHQIYGTRVAVLAGDFMFAQSSWYLAN----LENIEVIKLISQVIKDFAS-----GEI 680
             T H+IYG  VAVLAGD + A S  ++A     + +  ++++I ++ K   S     G++
Sbjct: 175  PTNHKIYGEDVAVLAGDALLAFSFEHVAKSTKGVSSDRIVRVIGELAKCIGSEGLVAGQV 234

Query: 679  KQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSF 500
               SS    +VG+E       +KTA+L+ AS    AI  G D    E++ ++ R +GL F
Sbjct: 235  VDISSEGMTEVGLEHLEFIHVHKTAALLEASVVLGAIVGGADDEDVEKLRKFARCIGLLF 294

Query: 499  QIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESE 350
            Q+VDDILD T+S+++LGK AG DL     T P +  +E   +  + +  E
Sbjct: 295  QVVDDILDVTKSSQELGKTAGKDLVADKTTYPKLLGIEKSREFAEKLNRE 344



>gb:CR522870_100588 Desulfotalea psychrophila LSv54 chromosome.
          Length = 336

 Score =  137 bits (345), Expect = 7e-31
 Identities = 78/233 (33%), Positives = 120/233 (51%)
 Frame = -1

Query: 1063 GAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTA 884
            G+  P+L    E    +GGKR+RP LV + +R             E  RLA   E +H A
Sbjct: 31   GSMEPLLCDILEYGLLSGGKRIRPLLVLMAARLCGNNGL------ETYRLATGFEYLHAA 84

Query: 883  SLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVI 704
            +L HDD++D SD+RRG+E++ + +G   A+LAGDF+  ++  ++  +   E ++   +  
Sbjct: 85   TLFHDDIIDHSDLRRGQESIAKKFGMEAAILAGDFLHTRAMIFVGEMVGAEGLRRFGKAT 144

Query: 703  KDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQY 524
                 GE  Q  +  + ++   DY      KT  LIAA+ +  A++ G        +  Y
Sbjct: 145  SAMVDGEFLQLRNAQEYNISELDYYRAVMGKTGVLIAAACELGALYGGGSEAEIAALRSY 204

Query: 523  GRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRD 365
            G  LG +FQIVDD+LD+       GK  G+DLA+G +T P+I AL    K  D
Sbjct: 205  GEKLGSAFQIVDDLLDYQGDTALTGKAVGNDLAEGKMTLPLILALSQAKKRGD 257



>gb:AL935255_551000 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 4/11.
          Length = 325

 Score =  137 bits (344), Expect = 9e-31
 Identities = 81/251 (32%), Positives = 130/251 (51%), Gaps = 1/251 (0%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            +V  +L  L   L + V  +N  +      + +AGGK +RP   +L S+           
Sbjct: 11   LVAKELAALKPYLATNVKIDNAAINDRVHDLLAAGGKFLRPGFFYLFSQFGPDHNTARL- 69

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFA-QSSW 758
                R  A  +E++H A+LIHDDV+DES  RR   T+HQ YG R A+ AGD +F      
Sbjct: 70   ----RAGAAAMELLHVATLIHDDVIDESPERRHVTTIHQDYGQRNAIYAGDLLFTCYFDQ 125

Query: 757  YLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKG 578
             L   +  + +K+ +  ++    GE+ Q +  FD    ++DYL  +  KTA L + S + 
Sbjct: 126  VLIAAKTADDVKINTAAMRAILQGELDQMAHNFDPTTTVDDYLAIARGKTARLFSLSCEQ 185

Query: 577  AAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVI 398
             A F+G D+ + +   Q G  +GL++Q++DD+LD+        KP  +DL  G  + P+I
Sbjct: 186  GAHFAGADASVVKLAQQIGERMGLAYQMLDDVLDYAGDEALTQKPVLNDLRDGVYSLPLI 245

Query: 397  FALETEPKLRD 365
            +AL  EP+L +
Sbjct: 246  YALTAEPQLAE 256



>pir|D97790|D97790 octaprenyl-diphosphate synthase (EC 2.5.1.-)
            [imported] - Rickettsia conorii (strain Malish
            7)>gb:AE008630_239088 Rickettsia conorii str. Malish 7,
            section 62 of 114 of the complete
            genome.>gb:AE006914_1121206 Rickettsia conorii str.
            Malish 7, complete genome.
          Length = 371

 Score =  136 bits (343), Expect = 1e-30
 Identities = 76/249 (30%), Positives = 142/249 (57%), Gaps = 3/249 (1%)
 Frame = -1

Query: 1132 VASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXX 953
            +  + + + D++  LN  + S + ++  ++    + +  AGGKR+RP L  + ++     
Sbjct: 48   IVKIQQDLKDEVTKLNNLIISCLKSDEELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYK 107

Query: 952  XXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMF 773
                     H +LA  +E IHTA+L+HDDV+D+S +RR K T + I+G++ ++L GDF+F
Sbjct: 108  GD------NHIKLASAVEFIHTATLLHDDVVDDSTLRRFKPTANVIWGSKTSILVGDFLF 161

Query: 772  AQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCD-VGMEDY--LIKSYYKTAS 602
            +QS   +    +I+ + ++++     ++GE+ Q   L +   + +++Y  ++KS  KTA 
Sbjct: 162  SQSFKLMVASGSIKAMNVLAKASAIISAGEVVQLVKLNERRIITIDEYQQIVKS--KTAE 219

Query: 601  LIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAK 422
            L   +    AI +     IS+ M  +G+ LG  FQ++DD+LD+  + +Q+GK  G D  +
Sbjct: 220  LFGTACAVGAIIAEQVDHISKDMQDFGKLLGTIFQVIDDLLDYLGNDKQVGKNIGDDFLE 279

Query: 421  GNLTAPVIF 395
            G +T P+IF
Sbjct: 280  GKVTLPLIF 288



>gb:SCO939120_178255 Streptomyces coelicolor A3(2) complete genome;
            segment 17/29.
          Length = 336

 Score =  136 bits (342), Expect = 1e-30
 Identities = 81/243 (33%), Positives = 133/243 (54%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            L+ + + L     +E P +  AA+ +  AGGKR RP LV L ++           +    
Sbjct: 24   LVAVEEGLLEATKSEVPFITEAAQHLVRAGGKRFRPLLVMLSAQFGDPYAPGIVPS---- 79

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
              A ++E+ H A+L HDDV+DE+ +RRG  + +  +   VAVL GDF+FA++S  LA+L 
Sbjct: 80   --AVVVELTHLATLYHDDVMDEAAVRRGVPSANTRWDNSVAVLTGDFLFARASQILADL- 136

Query: 739  NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
              E +++ +   +   +G+I + +   D    ++ YL     KT SL+A S +  A+ SG
Sbjct: 137  GPEAVRVQALAFERLVTGQILETAGPQDGRDPVDHYLDVLGGKTGSLVAVSCRFGAMMSG 196

Query: 559  VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETE 380
             D  + + + QYG  LG++FQ+ DD+LD    +++ GK  G+DL +G  T PV+   E  
Sbjct: 197  ADETVVDVLTQYGERLGVAFQLADDVLDIASDSDESGKTPGTDLREGIPTLPVLRLRERA 256

Query: 379  PKL 371
             +L
Sbjct: 257  ARL 259



>gb:AY661706_1620418 Adonis palaestina geranylgeranyl diphosphate
            synthase (Ggps1) mRNA, complete cds.
          Length = 364

 Score =  135 bits (341), Expect = 2e-30
 Identities = 90/254 (35%), Positives = 133/254 (52%), Gaps = 18/254 (7%)
 Frame = -1

Query: 1057 ENPVLMSAAEQIFSA-------GGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIE 899
            +N +L+   E+I  A       GGKR+RP L    S            +      A  +E
Sbjct: 89   DNAILIREPEKIHEAMRYSLLAGGKRVRPILCIAASELVGGNESMAMPS------ACAVE 142

Query: 898  MIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN----LEN 737
            MIHT SLIHDD+  +D  D+RRGK T H++YG  VAVLAGD + A +  Y+AN    +  
Sbjct: 143  MIHTMSLIHDDLPCMDNDDLRRGKPTNHKVYGENVAVLAGDALLAFAFEYVANATVGVSP 202

Query: 736  IEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
              V++ I ++ KD  S     G++    S    ++G++       +KTA+L+ AS    A
Sbjct: 203  SRVVRAIGELAKDIGSEGLVAGQVVDILSAGMSNIGLDHLEFIHLHKTAALLEASVVIGA 262

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            I  G      E++ ++ R +GL FQ+VDDILD T S+E+LGK AG DL     T P +  
Sbjct: 263  ILGGGTDEQVERLRKFARCIGLLFQVVDDILDVTMSSEELGKTAGKDLVADKATYPKLLG 322

Query: 391  LETEPKLRDIIESE 350
            LE   +  + +++E
Sbjct: 323  LEKAREFAEKLKNE 336



>gb:ATHGERPYRS_1553195 Arabidopsis thaliana geranylgeranyl
            pyrophosphate synthase mRNA, complete cds.
          Length = 371

 Score =  135 bits (341), Expect = 2e-30
 Identities = 108/320 (33%), Positives = 161/320 (50%), Gaps = 23/320 (7%)
 Frame = -1

Query: 1240 CHVFSTKAPESFLNGVTPASSSPMLD----LKKDS---GSPISVASLFEVVTDDLLTLNK 1082
            C +  TK P SF +  T +SSS ++      K+D+     P S   +  ++T   L +NK
Sbjct: 32   CPITLTK-PISFRSKRTVSSSSSIVSSSVVTKEDNLRQSEPSSFDFMSYIITKAEL-VNK 89

Query: 1081 NLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEI 905
             L S V    P+ +  A      AGGKR+RP L                  +        
Sbjct: 90   ALDSAVPLREPLKIHEAMSYSLLAGGKRVRPVLCIAACELVGGEESTAMPARC------A 143

Query: 904  IEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN-- 737
            +EMIHT SLIHDD+  +D  D+RRGK T H+++G  VAVLAGD + + S  +LA+  +  
Sbjct: 144  VEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALLSFSFEHLASATSSD 203

Query: 736  ----IEVIKLISQVIK-----DFASGEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAA 590
                + V++ + ++ K        +G++   SS  L   DVG+E       +KTA+L+ A
Sbjct: 204  VVSPVRVVRAVGELAKAIGTEGLVAGQVVDISSEGLDLNDVGLEHLEFIHLHKTAALLEA 263

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    AI  G      E++ ++ R +GL FQ+VDDILD T+S+++LGK AG DL    LT
Sbjct: 264  SAVLGAIVGGGSDDEIERLRKFARCIGLLFQVVDDILDVTKSSKELGKTAGKDLIADKLT 323

Query: 409  APVIFALETEPKLRDIIESE 350
             P I  LE   +  + +  E
Sbjct: 324  YPKIMGLEKSREFAEKLNRE 343



>sp|P34802|GGPP_ARATH Geranylgeranyl pyrophosphate synthetase,
            chloroplast precursor (GGPP synthetase) (GGPS) [Includes:
            Dimethylallyltransferase (EC 2.5.1.1);
            Geranyltranstransferase (EC 2.5.1.10);
            Farnesyltranstransferase (EC
            2.5.1.29)].>pir|F85434|F85434 geranylgeranyl
            pyrophosphate synthase [imported] - Arabidopsis
            thaliana>gb:AX544387_1470102 Sequence 40 from Patent
            WO02066660.>gb:ATAP22_1544016 Arabidopsis thaliana DNA
            chromosome 4, ESSA I AP2 contig fragment No.
            2.>gb:ATCHRIV86_1547636 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 86.
          Length = 371

 Score =  135 bits (340), Expect = 3e-30
 Identities = 108/320 (33%), Positives = 161/320 (50%), Gaps = 23/320 (7%)
 Frame = -1

Query: 1240 CHVFSTKAPESFLNGVTPASSSPMLD----LKKDS---GSPISVASLFEVVTDDLLTLNK 1082
            C +  TK P SF +  T +SSS ++      K+D+     P S   +  ++T   L +NK
Sbjct: 32   CPITLTK-PISFRSKRTVSSSSSIVSSSVVTKEDNLRQSEPSSFDFMSYIITKAEL-VNK 89

Query: 1081 NLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEI 905
             L S V    P+ +  A      AGGKR+RP L                        A  
Sbjct: 90   ALDSAVPLREPLKIHEAMRYSLLAGGKRVRPVLCIAACELVGGEESTAMPA------ACA 143

Query: 904  IEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN-- 737
            +EMIHT SLIHDD+  +D  D+RRGK T H+++G  VAVLAGD + + +  +LA+  +  
Sbjct: 144  VEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALLSFAFEHLASATSSD 203

Query: 736  ----IEVIKLISQVIK-----DFASGEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAA 590
                + V++ + ++ K        +G++   SS  L   DVG+E       +KTA+L+ A
Sbjct: 204  VVSPVRVVRAVGELAKAIGTEGLVAGQVVDISSEGLDLNDVGLEHLEFIHLHKTAALLEA 263

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    AI  G      E++ ++ R +GL FQ+VDDILD T+S+++LGK AG DL    LT
Sbjct: 264  SAVLGAIVGGGSDDEIERLRKFARCIGLLFQVVDDILDVTKSSKELGKTAGKDLIADKLT 323

Query: 409  APVIFALETEPKLRDIIESE 350
             P I  LE   +  + +  E
Sbjct: 324  YPKIMGLEKSREFAEKLNRE 343



>gb:AE017197_402446 Rickettsia typhi str. Wilmington complete genome.
          Length = 327

 Score =  134 bits (338), Expect = 4e-30
 Identities = 80/260 (30%), Positives = 146/260 (56%), Gaps = 6/260 (2%)
 Frame = -1

Query: 1132 VASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXX 953
            +  + + + +++  LN  + S + ++  ++    + +  AGGKR+RP L  + ++     
Sbjct: 4    IVKIQQDLKEEVTQLNDLIISCLKSDTELIEKVGKYLLEAGGKRIRPLLTIITAKMFDYK 63

Query: 952  XXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMF 773
                     H +LA  +E IH A+L+HDDV+D+S +RR K TV+ I+G++ ++L GDF+F
Sbjct: 64   GD------NHIKLASAVEFIHAATLLHDDVVDDSTLRRFKPTVNVIWGSKTSILVGDFLF 117

Query: 772  AQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCD-VGMEDY--LIKSYYKTAS 602
            +QS   +     I+ + ++++     + GE+ Q   L +   + +++Y  ++KS  KTA 
Sbjct: 118  SQSFKLMIASGCIKAMNVLARASVIISEGEVVQLVKLNERRIITIDEYQQIVKS--KTAE 175

Query: 601  LIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAK 422
            L  A+ +  AI +     +SE +  +G  LG  FQ++DD+LD+  S +Q+GK  G D  +
Sbjct: 176  LFGAACEVGAIIAEQVDRVSEDVQDFGMLLGTIFQVIDDLLDYLGSDKQVGKNIGDDFLE 235

Query: 421  GNLTAPVIF---ALETEPKL 371
            G +T P+IF    LE + KL
Sbjct: 236  GKVTLPLIFLYHKLEQDKKL 255



>pir|A70377|A70377 octoprenyl-diphosphate synthase - Aquifex
            aeolicus>gb:AE000712_26396 Aquifex aeolicus VF5 section
            44 of 109 of the complete genome.>gb:AE000657_976927
            Aquifex aeolicus VF5 complete genome.
          Length = 304

 Score =  134 bits (338), Expect = 4e-30
 Identities = 84/239 (35%), Positives = 128/239 (53%), Gaps = 6/239 (2%)
 Frame = -1

Query: 1048 VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHD 869
            +++     I  +GGKR+RP    LVS                  L   +E IH ASL+HD
Sbjct: 21   LVLETGRYIVESGGKRLRPLFTLLVSGMCGGDPSKALP------LGVALEYIHVASLLHD 74

Query: 868  DVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFAS 689
            DV+D +  RRG+E+ + ++G  VAVL GD+M+A+S    +   N+E+I+L+S V+ D A 
Sbjct: 75   DVVDRAKTRRGRESANLVFGNGVAVLTGDYMYAKSLHLFSTYGNMEMIRLVSGVVMDMAE 134

Query: 688  GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLG 509
            G++ + S + D  +  E+Y      KT  L  A   G    SG + G   ++Y+ G  LG
Sbjct: 135  GQVLEISKVGDI-ISEEEYFQIIDGKTGVLFGACF-GVGAMSG-ECGDWRELYEAGLRLG 191

Query: 508  LSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL------ETEPKLRDIIESE 350
             +FQ++DD LD+    + LGKP G+DL +G  T P+I  L      E +  LR + +SE
Sbjct: 192  RAFQLIDDALDYEGDPKVLGKPVGNDLREGKCTYPLISVLDNLDREEVKRVLRGLEDSE 250



>gb:AY661707_1620419 Adonis palaestina geranylgeranyl diphosphate
            synthase (Ggps2) mRNA, partial cds.
          Length = 310

 Score =  133 bits (335), Expect = 1e-29
 Identities = 90/254 (35%), Positives = 132/254 (51%), Gaps = 18/254 (7%)
 Frame = -1

Query: 1057 ENPVLMSAAEQIFSA-------GGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIE 899
            +N VL+   E+I  A       GGKR+RP L                 +      A  +E
Sbjct: 35   DNAVLIREPEKIHEAMRYSLLAGGKRVRPILCIAACELVGGNESMAMPS------ACAVE 88

Query: 898  MIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN----LEN 737
            MIHT SL+HDD+  +D  D+RRGK T H++YG  VAVLAGD + A +  Y+AN    +  
Sbjct: 89   MIHTMSLMHDDLPCMDNDDLRRGKPTNHKVYGENVAVLAGDALLAFAFEYVANATVGVSP 148

Query: 736  IEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
              VI+ I ++ KD  S     G++    S    ++G++       +KTA+L+ AS    A
Sbjct: 149  SRVIRAIGELAKDIGSEGLVAGQVVDILSAGMSNIGLDHLEFIHLHKTAALLEASVVIGA 208

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            I  G      E++ ++ R +GL FQ+VDDILD T S+E+LGK AG DL     T P +  
Sbjct: 209  ILGGGTDEQVERLRKFARCIGLLFQVVDDILDVTMSSEELGKTAGKDLVADKATYPKLLG 268

Query: 391  LETEPKLRDIIESE 350
            LE   +  + +++E
Sbjct: 269  LEKAREFAEKLKNE 282



>gb:AE014270_307034 Streptococcus agalactiae 2603V/R section 80 of 100
            of the complete genome.>gb:AE009948_937147 Streptococcus
            agalactiae 2603V/R complete genome.
          Length = 326

 Score =  133 bits (334), Expect = 1e-29
 Identities = 74/240 (30%), Positives = 128/240 (53%), Gaps = 1/240 (0%)
 Frame = -1

Query: 1087 NKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAE 908
            N+ +Q  +   N  + +A  Q+ +AGGK++RPA  +L S+            K   ++A 
Sbjct: 19   NQLIQERIQVRNKDIEAALSQLTAAGGKQLRPAFFYLFSQLGNKENQDTQQLK---KIAA 75

Query: 907  IIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS-SWYLANLENIE 731
             +E++H A+LIHDDV+D+S +RRG  T+   +G  +AV  GD +F       L ++ +  
Sbjct: 76   SLEILHVATLIHDDVIDDSPLRRGNMTIQSKFGKDIAVYTGDLLFTVFFDLILESMADTP 135

Query: 730  VIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDS 551
             +++ ++ ++    GE+ Q    ++   G+  YL     KTA L   ++K  A F G + 
Sbjct: 136  FMRINAKSMRKILMGELDQMHLRYNQQQGIHHYLRAISGKTAELFKLASKEGAYFGGAEK 195

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKL 371
             +       G N+G++FQI+DDILD+T   +   KP   DLA+G  + P++ A+E  P +
Sbjct: 196  EVVRLAGHIGFNIGMTFQILDDILDYTADKKTFNKPVLEDLAQGIYSLPLLLAIEENPDI 255



>pir|D71651|D71651 octaprenyl-diphosphate synthase (ispB) RP479 -
            Rickettsia prowazekii>gb:RPXX03_167268 Rickettsia
            prowazekii strain Madrid E, complete genome; segment 3/4.
          Length = 327

 Score =  133 bits (334), Expect = 1e-29
 Identities = 76/249 (30%), Positives = 140/249 (56%), Gaps = 3/249 (1%)
 Frame = -1

Query: 1132 VASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXX 953
            +  + + + D++  LN  + S + ++  ++    + +  AGGKR+RP L  + ++     
Sbjct: 4    IVKIQQNLKDEVTQLNDLIISCLKSDAELIEKVGKYLVEAGGKRIRPLLTIITAKMFDYK 63

Query: 952  XXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMF 773
                     H +LA  +E IH A+L+HDDV+D S +RR K T + I+G++ ++L GDF+F
Sbjct: 64   G------NNHIKLASAVEFIHAATLLHDDVVDNSTLRRFKPTANVIWGSKTSILVGDFLF 117

Query: 772  AQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCD-VGMEDY--LIKSYYKTAS 602
            +QS   +     I+ + ++++     + GE+ Q   L +   + +++Y  ++KS  KTA 
Sbjct: 118  SQSFKLMVASGCIKAMNVLAKASVIISEGEVVQLVKLNERRIITIDEYQQIVKS--KTAE 175

Query: 601  LIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAK 422
            L  A+ +  AI +     +S+ +  +GR LG  FQ++DD+LD+  S +Q+GK  G D  +
Sbjct: 176  LFGAACEVGAIIAEQVDRVSKDVQNFGRLLGTIFQVIDDLLDYLGSDKQVGKNIGDDFLE 235

Query: 421  GNLTAPVIF 395
            G +T P+IF
Sbjct: 236  GKVTLPLIF 244



>gb:AL935254_550946 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 3/11.
          Length = 330

 Score =  132 bits (333), Expect = 2e-29
 Identities = 82/243 (33%), Positives = 135/243 (55%), Gaps = 1/243 (0%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            L+T N N+Q      +  +  A  ++   GGK +RPA   L S+                
Sbjct: 27   LMTANINIQ------DADINDAILEMIHGGGKLLRPAYCLLFSQFTTTDRQRMVA----- 75

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
             LA  +E +HTA+LIHDD++D++ +RR   T+ + +G   AV AGD++F      LA+  
Sbjct: 76   -LAASLETLHTATLIHDDIVDDAALRRHHVTIQERFGKDTAVYAGDYLFVVVFKILAHYS 134

Query: 739  N-IEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFS 563
            +  + I++ S+ ++    GE++Q    +  D+ M +YL +   KTA L A S    A  S
Sbjct: 135  SSFKSIQMNSENMEKILVGEVQQKDRHYHLDITMAEYLQQIQGKTAELFALSCFLGAYES 194

Query: 562  GVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALET 383
            G  S  +++  + G  +G++FQI+DDILD+ + +++ GKP   D+A+G  T+P+IFAL+T
Sbjct: 195  GQSSHFAQRARKAGLAIGMAFQILDDILDYQEVSQETGKPILEDVAEGVYTSPLIFALQT 254

Query: 382  EPK 374
            E K
Sbjct: 255  EAK 257



>pir|AH1780|AH1780 heptaprenyl diphosphate synthase component II
            homolog lin2790 [imported] - Listeria innocua (strain
            Clip11262)>gb:AL596173_540130 Listeria innocua Clip11262
            complete genome, segment 11/12.
          Length = 326

 Score =  132 bits (333), Expect = 2e-29
 Identities = 78/246 (31%), Positives = 132/246 (53%), Gaps = 1/246 (0%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            +  ++ DL  + + ++S +   +  +    + +  AGGK +RPA   L ++         
Sbjct: 10   YPALSKDLQEVLQTIESNIQIRDKHVEKNVKDLIHAGGKLLRPAFALLSAQAGPEFDKER 69

Query: 940  XXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSS 761
              +     +A  +E++H A+LIHDDV+D+S +RRG  T+H  YG   AV  GD++F    
Sbjct: 70   AVS-----IAAALEVLHMATLIHDDVVDDSPLRRGIPTIHSKYGRNYAVYTGDYLFCICF 124

Query: 760  WYL-ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
              L A+  ++E I+  S+ I+    GE+ Q  + +  DV + +YL +   KTA L A S 
Sbjct: 125  KILSAHASSVENIEFNSKNIEKILMGELDQMRTSYKMDVTVREYLSRISGKTAQLFALSC 184

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
               A  S        + Y  G  LG++FQI+DD+LD+T + E LGKP  +D+ +G  + P
Sbjct: 185  YSGATGSKAPRMTVAKCYNIGHYLGMAFQIIDDVLDYTSTDEGLGKPVLNDMKQGIYSLP 244

Query: 403  VIFALE 386
            +I+A++
Sbjct: 245  LIYAMK 250



>gb:AE016953_366051 Enterococcus faecalis V583, section 7 of 11 of the
            complete genome.>gb:AE016830_992539 Enterococcus faecalis
            V583, complete genome.
          Length = 326

 Score =  132 bits (332), Expect = 2e-29
 Identities = 78/235 (33%), Positives = 125/235 (53%), Gaps = 1/235 (0%)
 Frame = -1

Query: 1078 LQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIE 899
            ++  +   N  +  A   +  +GGK +RPA  FL ++            ++  ++A  +E
Sbjct: 22   IEQTLHTRNEDIEEALVTLARSGGKLLRPAFFFLFAQLGDEEKQEK---QQLLKIAASLE 78

Query: 898  MIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN-IEVIK 722
            ++H A+LIHDD++D+S +RRG  T+   YG  VAV  GD +F +    +A+  N  E +K
Sbjct: 79   ILHMATLIHDDIIDDSPLRRGAVTIQSQYGKDVAVYTGDLLFTEFFTLIADAMNGSEFMK 138

Query: 721  LISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGIS 542
            + +Q +K    GE+ Q S  FD  + +  YL     KTA L + S    A F      + 
Sbjct: 139  INAQGMKRLLLGELDQMSHRFDRRMSIPAYLRSVNGKTAELFSLSCLEGAYFGHSSKEVQ 198

Query: 541  EQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEP 377
                + GR++G++FQ+ DDILD+T   E L KPA  DL++G  T P++FA +  P
Sbjct: 199  RLAKRIGRHIGIAFQVYDDILDYTADTETLKKPALEDLSQGVYTLPLLFAYQAAP 253



>sp|Q43133|GGPP_SINAL Geranylgeranyl pyrophosphate synthetase,
            chloroplast precursor (GGPP synthetase) (GGPS) [Includes:
            Dimethylallyltransferase (EC 2.5.1.1);
            Geranyltranstransferase (EC 2.5.1.10);
            Farnesyltranstransferase (EC
            2.5.1.29)].>pir|T10452|T10452 farnesyltranstransferase
            (EC 2.5.1.29) precursor, chloroplast - white
            mustard>gb:CQ793422_1453001 Sequence 125 from Patent
            WO2004017749.>gb:CQ793591_1453040 Sequence 113 from
            Patent WO2004018693.>gb:SAGGPS_1704706 S.alba mRNA for
            geranylgeranyl-pyrophosphate synthase.
          Length = 366

 Score =  132 bits (332), Expect = 2e-29
 Identities = 101/310 (32%), Positives = 156/310 (50%), Gaps = 18/310 (5%)
 Frame = -1

Query: 1225 TKAPESFLNGVTPASSSPMLDLKKDSGSPISVASLFEVVTDDLL---TLNKNLQSIVGAE 1055
            T  P S     T +SSS    + K+  +  S +S F+ ++  +    ++NK L S V   
Sbjct: 35   TLKPISLTPKRTVSSSSSSSLITKEDNNLKSSSSSFDFMSYIIRKADSVNKALDSAVPLR 94

Query: 1054 NPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASL 878
             P+ +  A      AGGKR+RP L                  +        +EMIHT SL
Sbjct: 95   EPLKIHEAMRYSLLAGGKRVRPVLCIAACELVGGEESLAMPARC------AVEMIHTMSL 148

Query: 877  IHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEV-----IKL 719
            IHDD+  +D  D+RRGK T H++YG  VAVLAGD + + +  +LA+  + EV     ++ 
Sbjct: 149  IHDDLPCMDNDDLRRGKPTNHKVYGEDVAVLAGDALLSFAFEHLASATSSEVSPARVVRA 208

Query: 718  ISQVIK-----DFASGEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
            + ++ K        +G++   SS  L   +VG+E       +KTA+L+ AS     I  G
Sbjct: 209  VGELAKAIGTEGLVAGQVVDISSEGLDLNNVGLEHLKFIHLHKTAALLEASAVLGGIIGG 268

Query: 559  VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETE 380
                  E++ ++ R +GL FQ+VDDILD T+S+++LGK AG DL    LT P +  LE  
Sbjct: 269  GSDEEIERLRKFARCIGLLFQVVDDILDVTKSSQELGKTAGKDLIADKLTYPKLMGLEKS 328

Query: 379  PKLRDIIESE 350
             +  + + +E
Sbjct: 329  REFAEKLNTE 338



>gb:AY372454_614059 Uncultured marine gamma proteobacterium
            EB000-45B06 fosmid clone.>gb:AY458644_619831 Uncultured
            bacterium 562 clone EBAC000-45B06 genomic sequence.
          Length = 316

 Score =  132 bits (331), Expect = 3e-29
 Identities = 75/243 (30%), Positives = 128/243 (52%)
 Frame = -1

Query: 1114 VVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            ++  DL  +N  L+  +  E  +    A  IF   GK++R  L  + S            
Sbjct: 6    LINKDLKEVNNLLRKNIIKEKTISNLYA-YIFKKNGKQLRARLSLIAS------SADRRQ 58

Query: 934  TKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWY 755
             K+  +LA IIE++H A+L+HDDV+DES  RRG ++V+ I+     VL GD++++++   
Sbjct: 59   GKKRLKLAAIIELLHNATLVHDDVVDESPTRRGVKSVNNIWTNAHGVLIGDYIYSKAFML 118

Query: 754  LANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            +  L N ++++ +S    D + GE+ Q  ++ +  + + +    SY+KT  L  AS K  
Sbjct: 119  MVELGNSKILEELSNATNDISKGELIQLDAIANTGISLSELEDISYFKTGRLFEASAKCG 178

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
            A+           + +  +NLG+ FQI DD+LD+    + LGKPA  D+ +G +T P  F
Sbjct: 179  ALLCNSKKSYVNSISECAKNLGIVFQIKDDLLDYLGKEDALGKPAFQDIKEGKVTYPFYF 238

Query: 394  ALE 386
            A +
Sbjct: 239  AYQ 241



>gb:AY087565_1572595 Arabidopsis thaliana clone 36701 mRNA, complete
            sequence.
          Length = 371

 Score =  131 bits (330), Expect = 4e-29
 Identities = 107/320 (33%), Positives = 160/320 (50%), Gaps = 23/320 (7%)
 Frame = -1

Query: 1240 CHVFSTKAPESFLNGVTPASSSPMLD----LKKDS---GSPISVASLFEVVTDDLLTLNK 1082
            C +  TK P SF +  T +SSS ++      K+D+     P S   +  ++T   L +NK
Sbjct: 32   CPITLTK-PISFRSKRTVSSSSSIVSSSVVTKEDNLRQSEPSSFDFMSYIITKAEL-VNK 89

Query: 1081 NLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEI 905
             L S V    P+ +  A      AGGKR+RP L                        A  
Sbjct: 90   ALDSAVPLREPLKIHEAMRYSLLAGGKRVRPVLCIAACELVGGEESTAMPA------ACA 143

Query: 904  IEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN-- 737
            +EMIHT SLIHDD+  +D  D+RRGK T H+++G  VAVLAGD + + +  +LA+  +  
Sbjct: 144  VEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALLSFAFEHLASATSSD 203

Query: 736  ----IEVIKLISQVIK-----DFASGEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAA 590
                + V++ + ++ K        +G++   SS  L   DVG+E       +KTA+L+ A
Sbjct: 204  VVSPVRVVRAVGELAKAIGTEGLVAGQVVDISSEGLDLNDVGLEHLEFIHLHKTAALLEA 263

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    AI  G      E++ ++ R +GL FQ+VDDIL  T+S+++LGK AG DL    LT
Sbjct: 264  SAVLRAIVGGGSDDEIERLRKFARCIGLLFQVVDDILYVTKSSKELGKTAGKDLIADKLT 323

Query: 409  APVIFALETEPKLRDIIESE 350
             P I  LE   +  + +  E
Sbjct: 324  YPKIMGLEKSREFAEKLNRE 343



>gb:SAG766853_171311 Streptococcus agalactiae NEM316 complete genome,
            segment 11.
          Length = 326

 Score =  131 bits (330), Expect = 4e-29
 Identities = 73/240 (30%), Positives = 127/240 (52%), Gaps = 1/240 (0%)
 Frame = -1

Query: 1087 NKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAE 908
            N+ +Q  +   N  + +A  Q+ +AGGK++RPA  +L S+            K   ++A 
Sbjct: 19   NQLIQERIQVRNKDIEAALSQLTAAGGKQLRPAFFYLFSQLGNKENQDTQQLK---KIAA 75

Query: 907  IIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS-SWYLANLENIE 731
             +E++H A+LIHDDV+D+S +RRG  T+   +G  +AV  GD +F       L ++ +  
Sbjct: 76   SLEILHVATLIHDDVIDDSPLRRGNMTIQSKFGKDIAVYTGDLLFTVFFDLILESMADTP 135

Query: 730  VIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDS 551
             +++ ++ ++    GE+ Q    ++   G+  YL     KTA L   ++K  A F G + 
Sbjct: 136  FMRINAKSMRKILMGELDQMHLRYNQQQGIHHYLRAISGKTAELFKLASKEGAYFGGAEK 195

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKL 371
             +       G N+G++FQI+DDILD+T   +   KP   DL +G  + P++ A+E  P +
Sbjct: 196  EVVRLAGHIGFNIGMTFQILDDILDYTADKKTFNKPVLEDLTQGVYSLPLLLAIEENPDI 255



>sp|Q58270|IDSA_METJA Bifunctional short chain isoprenyl diphosphate
            synthase [Includes: Farnesyl pyrophosphate synthetase (EC
            2.5.1.1) (FPP synthetase) (Dimethylallyltransferase);
            Geranyltranstransferase (EC 2.5.1.10)].>pir|D64407|D64407
            bifunctional short chain isoprenyl diphosphate synthase
            homolog - Methanococcus jannaschii>gb:U67530_206970
            Methanocaldococcus jannaschii DSM 2661 section 72 of 150
            of the complete genome.>gb:L77117_1099728
            Methanocaldococcus jannaschii DSM 2661, complete genome.
          Length = 327

 Score =  131 bits (330), Expect = 4e-29
 Identities = 83/254 (32%), Positives = 141/254 (55%), Gaps = 6/254 (2%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            L  +++ L++ V  ++  L +A++ +  AGGKR+RP L  +               +E  
Sbjct: 18   LQKIDEELKTYVDKDDK-LYNASKHLLFAGGKRIRPYLTVVT------YMLKKDDIEEVL 70

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
              A  +E+IH  +LIHDD++D  D RRGK TVH +YG  +A+LAGD ++A++   ++ ++
Sbjct: 71   PAAAAVELIHNYTLIHDDIMDNDDERRGKPTVHVVYGEPMAILAGDLLYAKAFEAVSRIK 130

Query: 739  NI----EVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
            +     EV+K++S+   +   G+        +    ME+YL     KT +L+ AS    A
Sbjct: 131  DNKKAHEVLKILSKACVEVCEGQAMDME-FENYYPTMEEYLDMIRKKTGALLEASVGIGA 189

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            + +  +    E + +Y + +GL+FQI DD+LD     ++LGKP GSD+ +G  T  VI A
Sbjct: 190  VMADCNEEEREALKEYAKRIGLTFQIQDDVLDLIGDQKKLGKPVGSDIREGKKTIIVIHA 249

Query: 391  LET--EPKLRDIIE 356
            L+T  E K + ++E
Sbjct: 250  LKTLDEDKKKRLLE 263



>gb:AE013412_292097 Methanosarcina mazei strain Goe1, section 194 of
            379 of the complete genome.>gb:AE008384_966206
            Methanosarcina mazei strain Goe1, complete genome.
          Length = 324

 Score =  131 bits (329), Expect = 5e-29
 Identities = 87/297 (29%), Positives = 137/297 (46%), Gaps = 5/297 (1%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            L  A+  +  AGGKR+RPA++ L +                   A  +E++H  +LIHDD
Sbjct: 33   LYKASRYLVDAGGKRLRPAVLILAAEAVGSNLRSVLPA------AVAVELVHNFTLIHDD 86

Query: 865  VLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN--IEVIK---LISQVIK 701
            ++D  D+RRG   VH  +G   A+LAGD +++++   L+ +EN  + V+K   ++S+   
Sbjct: 87   IMDRDDIRRGMPAVHVKWGEAGAILAGDTLYSKAFEILSKVENEPVRVLKCMDVLSKTCT 146

Query: 700  DFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYG 521
            +   G+           V   +YL     KT+ L AA+ K  A+  G    ++E + +YG
Sbjct: 147  EICEGQWLDMDFETRKKVTESEYLEMVEKKTSVLYAAAAKIGALLGGASDEVAEALSEYG 206

Query: 520  RNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESEFCX 341
            R +G+ FQ+ DD+LD T   E LGK  GSDL +G  T  VI A E   KL DI       
Sbjct: 207  RLIGIGFQMYDDVLDMTAPEEVLGKVRGSDLMEGKYTLIVINAFEKGVKL-DIFGKGEAT 265

Query: 340  XXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                      +  CG +               + L+ L   P +    ++  Y + R
Sbjct: 266  LEETEAAVRTLTECGSLDYVKNLAISYIEEGKEKLDVLRDCPEKTLLLQIADYMISR 322



>gb:AB028617_1518025 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone:MOA2.
          Length = 306

 Score =  130 bits (328), Expect = 6e-29
 Identities = 88/236 (37%), Positives = 127/236 (53%), Gaps = 14/236 (5%)
 Frame = -1

Query: 1015 AGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMR 842
            AGGKR+RP L   V                    A  +EMIHT+SLIHDD+  +D +D+R
Sbjct: 49   AGGKRVRPLLCIAVCELVGGDEATAMSA------ACAVEMIHTSSLIHDDLPCMDNADLR 102

Query: 841  RGKETVHQIYGTRVAVLAGDFMFAQ--------SSWYLANLENIEVIKLISQVI--KDFA 692
            RGK T H+++G  +AVLAGD + A         SS  +A+   I  +  +++ I  K   
Sbjct: 103  RGKPTNHKVFGEDMAVLAGDALLALAFEHMTVVSSGLVASERMIRAVVELARAIGTKGLV 162

Query: 691  SGEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGR 518
            +G++   SS  L   DVG+E       +KTA+L+ A+    AI  G      E++ +Y R
Sbjct: 163  AGQVVDLSSERLNPHDVGLERLEFIHLHKTAALLEAAAVIGAIMGGGTEEEIEKLRKYAR 222

Query: 517  NLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIESE 350
             +GL FQ+VDDILD T+S E+LGK AG D+  G LT P +  LE   ++ + +  E
Sbjct: 223  CIGLLFQVVDDILDVTKSTEELGKTAGKDVMAGKLTYPRLIGLERSREVAEKLSRE 278



>pir|E70549|E70549 probable heptaprenyl diphosphate syntetase -
            Mycobacterium tuberculosis (strain
            H37RV)>gb:AE000516_20581 Mycobacterium tuberculosis
            CDC1551, complete genome.>gb:BX248335_757934
            Mycobacterium bovis subsp. bovis AF2122/97 complete
            genome; segment 2/14.>gb:BX842573_818609 Mycobacterium
            tuberculosis H37Rv complete genome; segment 2/13.
          Length = 335

 Score =  130 bits (327), Expect = 8e-29
 Identities = 86/297 (28%), Positives = 143/297 (48%), Gaps = 4/297 (1%)
 Frame = -1

Query: 1048 VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHD 869
            V+  +   +F+AGGKR RP    L ++                    +IEMIH A+L HD
Sbjct: 43   VMSDSLLHLFNAGGKRFRPLFTVLSAQIGPQPDAAAVTVA-----GAVIEMIHLATLYHD 97

Query: 868  DVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFAS 689
            DV+DE+ +RRG  + +  +G  VA+LAGD++ A +S  +A L   E +++I+       +
Sbjct: 98   DVMDEAQVRRGAPSANAQWGNNVAILAGDYLLATASRLVARL-GPEAVRIIADTFAQLVT 156

Query: 688  GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLG 509
            G++++     +    +E YL     KT SLI A+ +   +FSG      E++ + G  +G
Sbjct: 157  GQMRETRGTSENVDSIEQYLKVVQEKTGSLIGAAGRLGGMFSGATDEQVERLSRLGGVVG 216

Query: 508  LSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL-ETEP---KLRDIIESEFCX 341
             +FQI DDI+D    +++ GK  G+D+ +G  T P+++AL E+ P   +LR ++      
Sbjct: 217  TAFQIADDIIDIDSESDESGKLPGTDVREGVHTLPMLYALRESGPDCARLRALLNGPVDD 276

Query: 340  XXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                      ++   G+             A   L  LP  P R A   +V Y + R
Sbjct: 277  DAEVREALTLLRASPGMARAKDVLAQYAAQARHELALLPDVPGRRALAALVDYTVSR 333



>gb:AE017331_445030 Listeria monocytogenes str. 4b F2365, section 10
            of 10 of the complete genome.>gb:AE017262_1077386
            Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 326

 Score =  130 bits (326), Expect = 1e-28
 Identities = 79/239 (33%), Positives = 128/239 (53%), Gaps = 1/239 (0%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            L T+ KN+Q      +  +    + +  AGGK +RPA   L ++           +    
Sbjct: 21   LQTIEKNIQ----IRDKHVEQNVKDLIHAGGKLLRPAFALLSAQAGPDYDKERAVS---- 72

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL-ANL 743
             +A  +E++H A+LIHDDV+D+S +RRG  T+H  YG   AV  GD++F      L A+ 
Sbjct: 73   -IAAALEVLHMATLIHDDVVDDSPLRRGIPTIHSKYGRNYAVYTGDYLFCICFKILSAHA 131

Query: 742  ENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFS 563
             ++E I+  S+ I+    GE+ Q  + +  +V + +YL +   KTA L A S    A  S
Sbjct: 132  SSVENIEFNSKNIEKILMGELDQMRTSYKMNVTVREYLTRISGKTAQLFALSCYSGATGS 191

Query: 562  GVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
                    + Y  G  LG++FQI+DD+LD+T + E LGKP  +D+ +G  + P+I+A++
Sbjct: 192  KATRMTVAKCYNIGHYLGMAFQIIDDVLDYTSTDEGLGKPVLNDMKQGIYSLPLIYAMK 250



>pir|AI1404|AI1404 heptaprenyl diphosphate synthase component II
            homolog lmo2641 [imported] - Listeria monocytogenes
            (strain EGD-e)>gb:AL591983_537132 Listeria monocytogenes
            strain EGD, complete genome segment 11/12.
          Length = 326

 Score =  130 bits (326), Expect = 1e-28
 Identities = 79/239 (33%), Positives = 128/239 (53%), Gaps = 1/239 (0%)
 Frame = -1

Query: 1099 LLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHR 920
            L T+ KN+Q      +  +    + +  AGGK +RPA   L ++           +    
Sbjct: 21   LQTIEKNIQ----IRDKHVEQNVKDLIHAGGKLLRPAFALLSAQAGPDYDKDRAVS---- 72

Query: 919  RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL-ANL 743
             +A  +E++H A+LIHDDV+D+S +RRG  T+H  YG   AV  GD++F      L A+ 
Sbjct: 73   -IAAALEVLHMATLIHDDVVDDSPLRRGIPTIHSKYGRNYAVYTGDYLFCICFKILSAHA 131

Query: 742  ENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFS 563
             ++E I+  S+ I+    GE+ Q  + +  +V + +YL +   KTA L A S    A  S
Sbjct: 132  SSVENIEFNSKNIEKILMGELDQMRTSYKMNVTVREYLTRISGKTAQLFALSCYSGATGS 191

Query: 562  GVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
                    + Y  G  LG++FQI+DD+LD+T + E LGKP  +D+ +G  + P+I+A++
Sbjct: 192  KATRMTVAKCYNIGHYLGMAFQIIDDVLDYTSTDEGLGKPVLNDMKQGIYSLPLIYAMK 250



>sp|P80042|GGPP_CAPAN Geranylgeranyl pyrophosphate synthetase,
            chloroplast precursor (GGPP synthetase) (GGPS) [Includes:
            Dimethylallyltransferase (EC 2.5.1.1);
            Geranyltranstransferase (EC 2.5.1.10);
            Farnesyltranstransferase (EC
            2.5.1.29)].>pir|S53722|S53722 farnesyltranstransferase
            (EC 2.5.1.29) precursor - pepper>gb:CAGERDIS_1644898
            C.annuum gene for geranyl-diphosphate synthase.
          Length = 369

 Score =  130 bits (326), Expect = 1e-28
 Identities = 87/254 (34%), Positives = 132/254 (51%), Gaps = 12/254 (4%)
 Frame = -1

Query: 1111 VTDDLLTLNKNL-QSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXX 935
            VT+  +++NK L ++I+  E  V+  A      AGGKR+RP L                 
Sbjct: 82   VTEKAISVNKALDEAIIVKEPHVIHEAMRYSLLAGGKRVRPMLCLAACELVGGNQENAMA 141

Query: 934  TKEHRRLAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSS 761
                   A  +EMIHT SLIHDD+  +D  D+RRGK T H+IYG  VAVLAGD + A + 
Sbjct: 142  A------ACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKIYGEDVAVLAGDSLLAFAF 195

Query: 760  WYLAN----LENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKT 608
             ++ N    +    ++  ++++ K   +     G++       +  V +E       +KT
Sbjct: 196  EHIVNSTAGVTPSRIVGAVAELAKSIGTEGLVAGQVADIKCTGNASVSLETLEFIHVHKT 255

Query: 607  ASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDL 428
            A+L+ +S    AI  G  +   E++ ++ R +GL FQ+VDDILD T+S+E+LGK AG DL
Sbjct: 256  AALLESSVVLGAILGGGTNVEVEKLRRFARCIGLLFQVVDDILDVTKSSEELGKTAGKDL 315

Query: 427  AKGNLTAPVIFALE 386
                 T P +  LE
Sbjct: 316  VVDKTTYPKLLGLE 329



>gb:AY552545_627880 Uncultured marine gamma proteobacterium EBAC20E09
            clone EBAC20E09, complete sequence.
          Length = 314

 Score =  129 bits (324), Expect = 2e-28
 Identities = 69/242 (28%), Positives = 131/242 (54%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            +T +L  + K ++S +  E  +L      IF + GK++R  L  + S             
Sbjct: 7    ITKELKAVEKLIKSDINKEKTIL-GLYNYIFKSDGKKIRSRLNLIAS--------SSSKN 57

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
             +  +LA IIE++HTA+L+HDDV+D +  RRG  +V+ ++     VL GD++++++   +
Sbjct: 58   SDRYKLASIIELLHTATLVHDDVVDNASTRRGAISVNSLWSNAHGVLIGDYIYSKAFMLM 117

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
              +   +++  ++    D + GE+ Q  ++ +  + +      SY+KT  L  AS K  A
Sbjct: 118  VEIGKTDILAELADATNDISQGELIQLDAISNIKISLNKLKKISYFKTGRLFEASAKTGA 177

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFA 392
            + +G +    + + +  +N+G+ FQI DD+LD++ S+ + GK +  DL +G +T P  FA
Sbjct: 178  MLAGANKNFIKNISESAKNIGILFQIKDDLLDYSNSS-KTGKQSFQDLKEGKITYPFFFA 236

Query: 391  LE 386
            L+
Sbjct: 237  LK 238



>pir|A87194|A87194 polyprenyl diphosphate synthase component
            [imported] - Mycobacterium leprae>gb:MLEPRTN9_148082
            Mycobacterium leprae strain TN complete genome; segment
            9/10.
          Length = 330

 Score =  129 bits (324), Expect = 2e-28
 Identities = 86/324 (26%), Positives = 157/324 (48%), Gaps = 4/324 (1%)
 Frame = -1

Query: 1129 ASLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXX 950
            A+    V D ++ + + + + +   + V+  +   +F+AGGKR RP    L ++      
Sbjct: 11   AAFAATVQDRVVRIEQLMDAELRDTDEVMTESVLHLFAAGGKRFRPLFTVLSAQIGPRPD 70

Query: 949  XXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFA 770
                   E      +IE++H ASL HDDV+DE+++RRG  + +  +   VA+LAGD++FA
Sbjct: 71   A-----PEVIIAGAVIELVHLASLYHDDVMDEAEVRRGAPSANLRWSNSVAILAGDYLFA 125

Query: 769  QSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
             +S  ++ L  ++ +++I+       +G++++   + +    +E YL   Y KT  LI +
Sbjct: 126  TASRLVSQL-GLDAVRIIADTFAQLVTGQMRETRGVPEGADSIEQYLKVVYEKTGCLIGS 184

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            + +   +F+G  +   E++ + G  +G +FQI DDI+D      + GK  G+D+ +G  T
Sbjct: 185  AGRLGGLFAGAHAEQVERLSRLGSIVGTAFQISDDIIDIDSDYTKSGKLPGTDVREGVRT 244

Query: 409  APVIFAL-ETEP---KLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQ 242
             P+++AL ET P   +LR ++                ++   G+             A  
Sbjct: 245  LPILYALRETGPDSERLRALLAGPVDNDAEVVEALALLRASPGMARARQVLAHYADQASG 304

Query: 241  NLECLPPSPFRVAXEEMVQYNLER 170
             L  LP  P R A   +V Y   R
Sbjct: 305  ELAQLPDGPSRDALATLVDYTTNR 328



>pir|E71101|E71101 probable geranylgeranyl pyrophosphate synthetase -
            Pyrococcus horikoshii>gb:BA000001_649733 Pyrococcus
            horikoshii OT3 DNA, complete genome.
          Length = 342

 Score =  129 bits (323), Expect = 2e-28
 Identities = 96/342 (28%), Positives = 155/342 (45%), Gaps = 24/342 (7%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENP-VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            LF  + +    +++ +  ++  ++P VL  AA     AGGKR+RP +V   +        
Sbjct: 7    LFARIKEKAKLIDEKIFELIPEKDPRVLYEAARHYPLAGGKRVRPFVVLTSTEAVGGDPL 66

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                       A  IE+IH  SL+HDD++D  + RRGK TVH+I+G  +A+LAGD +F++
Sbjct: 67   RAIYP------AVAIELIHNYSLVHDDIMDMDETRRGKPTVHRIWGVNMAILAGDLLFSK 120

Query: 766  SSWYLANLE-----NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTAS 602
            +   +A  E        V+++I +   +   G+ +         V +E+Y+     KT +
Sbjct: 121  AFEAVARAEIPPEKKARVLEVIVKASNELCEGQARDLEFEKKSTVTIEEYMEMISGKTGA 180

Query: 601  LIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAK 422
            L  AS K   I    +    + +  +GRN+G++FQI DD+LD     ++LGKP GSD+ K
Sbjct: 181  LFEASAKVGGIIGTDNEEYIKALSSWGRNVGIAFQIWDDVLDLIADEKKLGKPVGSDIRK 240

Query: 421  GNLTAPVIFALET------------------EPKLRDIIESEFCXXXXXXXXXXXVKRCG 296
            G  T  V    E                   + K R IIE +             +K+ G
Sbjct: 241  GKKTLIVAHFFENADEKDKQRFLKIFGKYAGDVKGRGIIEEDI--KSDVMEAIDLLKKYG 298

Query: 295  GIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
             I             A + L  LP S  R+  E + ++ +ER
Sbjct: 299  SIDYAAEIAKDMIKKANEALRILPKSKARMDLELLAKFIVER 340



>pir|E86647|E86647 prenyl transferase [imported] - Lactococcus lactis
            subsp. lactis (strain IL1403)>gb:AE006256_217083
            Lactococcus lactis subsp. lactis IL1403 section 18 of 218
            of the complete genome.>gb:AE005176_1094156 Lactococcus
            lactis subsp. lactis IL1403, complete genome.
          Length = 326

 Score =  128 bits (322), Expect = 3e-28
 Identities = 90/301 (29%), Positives = 142/301 (47%), Gaps = 6/301 (1%)
 Frame = -1

Query: 1054 NPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEI---IEMIHTA 884
            N  + +A E+  S GGK +RPAL  L +            +K+  ++ +I   +EM+H+A
Sbjct: 30   NQEIEAALEKFASRGGKMVRPALFLLFA------GIVPNGSKDEEKIIKIAASLEMLHSA 83

Query: 883  SLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFA-QSSWYLANLENIEVIKLISQV 707
            +LIHDD++D+S +RRG  ++   +G  VAV AGDF++       +  +     +   +Q 
Sbjct: 84   TLIHDDIIDDSPLRRGLPSIESQFGKDVAVYAGDFVYTVYFELLIETMNGTSFVAKNAQS 143

Query: 706  IKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQ 527
            +K    GE+ Q  S FD +     Y+     KTA L++ S      F+G D  +     +
Sbjct: 144  MKKILQGELTQMQSAFDKNNTARRYMKAISGKTAELLSLSCLEGVYFAGGDKKLQHSARK 203

Query: 526  YGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE-TEPKLRDIIES- 353
             GR +GL+FQ+ DDIL+FT   ++  KP  +D  +G  T P++ A E  +  +   +E+ 
Sbjct: 204  IGRAIGLAFQVYDDILNFTVGLDEADKPILTDFRQGIYTLPLLLAREVNDEAIAPYLEAP 263

Query: 352  EFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLE 173
            E             V   GGI             A+  +  LP S  R   EE  Q  LE
Sbjct: 264  ENLSRQECLDLAELVTESGGIAGALLVAGRLTELALNEIRKLPESTNRQILEEATQILLE 323

Query: 172  R 170
            R
Sbjct: 324  R 324



>gb:AB055496_1521476 Hevea brasiliensis ggps mRNA for geranylgeranyl
            diphosphate synthase, complete cds.
          Length = 370

 Score =  128 bits (321), Expect = 4e-28
 Identities = 81/260 (31%), Positives = 134/260 (51%), Gaps = 12/260 (4%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++N+ L++ +  + P  +  +      AGGKR+RPAL                       
Sbjct: 89   SINQALEAAIPLQEPAKIHESMRYSLLAGGKRVRPALCLAACELVGGNDSMAMPA----- 143

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA-- 749
             A  +EMIHT SLIHDD+  +D  D+RRGK T H ++G  VAVLAGD + A +  ++A  
Sbjct: 144  -ACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHIVFGEDVAVLAGDALLAFAFEHIAVS 202

Query: 748  --NLENIEVIKLISQVIK-----DFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
              N+ +  +++ + ++ K        +G++   +S    +V +E       +KTA L+  
Sbjct: 203  TLNVSSARIVRAVGELAKAIGAEGLVAGQVVDINSEGSSEVDLEKLEFIHIHKTAKLLEG 262

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            +    AI  G      E++ +Y R++GL FQ+VDDILD T+S+++LGK AG DL    +T
Sbjct: 263  AVVLGAILGGGTDEEVEKLRKYARDIGLLFQVVDDILDVTKSSQELGKTAGKDLVADKVT 322

Query: 409  APVIFALETEPKLRDIIESE 350
             P +  +E   +  + +  E
Sbjct: 323  YPKLLGIEKSREFAEKLNKE 342



>sp|P39464|GGPP_SULAC Geranylgeranyl pyrophosphate synthetase (GGPP
            synthetase) (GGPS) [Includes: Dimethylallyltransferase
            (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10);
            Farnesyltranstransferase (EC
            2.5.1.29)].>pir|A54058|A54058 farnesyltranstransferase
            (EC 2.5.1.29) - Sulfolobus
            acidocaldarius>gb:SSOGDS_190715 Sulfolobus acidocaldarius
            gds gene for geranylgeranyl diphosphate synthase,
            complete cds.
          Length = 330

 Score =  128 bits (321), Expect = 4e-28
 Identities = 79/243 (32%), Positives = 131/243 (53%), Gaps = 7/243 (2%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            ++N  ++S +  + P L  A+  +F++GGKR+RP ++ + S                   
Sbjct: 14   SVNDIIKSYISGDVPKLYEASYHLFTSGGKRLRPLILTISSDLFGGQRERAYYA------ 67

Query: 913  AEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS----SWYLAN 746
               IE++HT +L+HDD++D+ ++RRG  TVH  YG  +A+LAGD + A++    +  L  
Sbjct: 68   GAAIEVLHTFTLVHDDIMDQDNIRRGLPTVHVKYGLPLAILAGDLLHAKAFQLLTQALRG 127

Query: 745  LENIEVIK---LISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
            L +  +IK   + ++ I   + G+          D+  ++YL     KTA+L +AS+   
Sbjct: 128  LPSETIIKAFDIFTRSIIIISEGQAVDMEFEDRIDIKEQEYLDMISRKTAALFSASSSIG 187

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
            A+ +G +      M  +G NLG++FQIVDDIL  T   ++LGKP  SD+ +G  T  VI 
Sbjct: 188  ALIAGANDNDVRLMSDFGTNLGIAFQIVDDILGLTADEKELGKPVFSDIREGKKTILVIK 247

Query: 394  ALE 386
             LE
Sbjct: 248  TLE 250



>gb:AF020041_1761615 Helianthus annuus geranylgeranyl pyrophosphate
            synthase (ggps) mRNA, complete cds.
          Length = 356

 Score =  127 bits (320), Expect = 5e-28
 Identities = 85/253 (33%), Positives = 126/253 (49%), Gaps = 11/253 (4%)
 Frame = -1

Query: 1075 QSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEM 896
            +SI+    P +  A      AGGKR+RP L                        A  +EM
Sbjct: 81   ESIMIKNPPTIHEAMRYSLLAGGKRVRPILCIAACELVGGEEATAMPA------ACAVEM 134

Query: 895  IHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN----I 734
            IHT SLIHDD+  +D  D RRGK T H++YG  VAVLAGD + A +  Y+++        
Sbjct: 135  IHTMSLIHDDLPCMDNDDFRRGKPTNHKVYGEDVAVLAGDSLLAFAFEYVSSRTEGASPA 194

Query: 733  EVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAI 569
             V+  I ++ K   +     G++   +S    D+G++       +KTA+L+ AS    AI
Sbjct: 195  RVLAAIGELAKSIGTEGLVAGQVVDIASTGGQDIGLDQLEFIHIHKTAALLEASVVLGAI 254

Query: 568  FSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
              G      E++  + R +GL FQ+VDDILD T+S+E+LGK AG DL     T P +  L
Sbjct: 255  LGGGSDAQVEKLRTFARCIGLLFQVVDDILDVTKSSEELGKTAGKDLLVDKTTYPKLLGL 314

Query: 388  ETEPKLRDIIESE 350
            +   +  + + +E
Sbjct: 315  DKSRQFAEELLAE 327



>gb:AE010463_263368 Fusobacterium nucleatum subsp. nucleatum ATCC
            25586, section 5 of 197 of the complete
            genome.>gb:AE009951_910536 Fusobacterium nucleatum subsp.
            nucleatum ATCC 25586, complete genome.
          Length = 326

 Score =  127 bits (320), Expect = 5e-28
 Identities = 77/225 (34%), Positives = 128/225 (56%), Gaps = 1/225 (0%)
 Frame = -1

Query: 1030 EQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDES 851
            + + +  GK +R  L+ L +             ++  +LA ++E+ H ASLIHDD++D+S
Sbjct: 35   DDVLNLSGKMLRSKLLLLCA---FLGTNWKNNKEKICKLAAMVELTHLASLIHDDIVDDS 91

Query: 850  DMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENI-EVIKLISQVIKDFASGEIKQ 674
              RRGK ++   YG   AV AGDF+ A+  +Y A +EN+ E + ++S+ ++    GEI+Q
Sbjct: 92   PYRRGKVSIQGKYGKDAAVFAGDFLIARIFYYGA-VENLNEAVSILSKTVEYMCIGEIEQ 150

Query: 673  ASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQI 494
                +  ++  + Y      KTA+L  A++   A  +G    I +++  + +NLGL FQ+
Sbjct: 151  DLCRYQENISEKKYFENIERKTAALFQAASYIGAKEAGCSEEIIQKLELFVKNLGLMFQL 210

Query: 493  VDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDII 359
             DDILDFT ++++LGK    D   G  T PVI AL+  PK R+++
Sbjct: 211  KDDILDFTSNSKELGKETHKDFQNGIYTFPVIMALK-NPKAREVL 254



>pir|E84566|E84566 probable geranylgeranyl pyrophosphate synthase
            [imported] - Arabidopsis thaliana>gb:AC006135_1533474
            Arabidopsis thaliana chromosome 2 clone F24H14 map
            CIC06E08, complete sequence.
          Length = 347

 Score =  127 bits (320), Expect = 5e-28
 Identities = 91/260 (35%), Positives = 132/260 (50%), Gaps = 13/260 (5%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +N+ L S V    P+ +  A      A GKR+RP L                        
Sbjct: 66   VNEALDSAVSLREPIKIHEAIRYSLLARGKRVRPVLCIAACELVGGEESVALPA------ 119

Query: 913  AEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
            A  +EMIHT SLIHDD+  +D  D+RRGK T H+++G  VAVLAGD + + +  +LA   
Sbjct: 120  ACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALISFAFEHLATST 179

Query: 739  NIE---VIKLISQVIKDFAS-----GEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAA 590
             +    V++ I ++ K   S     G++   +S  +   DVG+E       +KTA L+ A
Sbjct: 180  AVSPARVVRAIGELAKAIGSKGLVAGQVVDLTSGGMDQNDVGLEVLEFIHVHKTAVLLEA 239

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            +T   AI  G      E++ ++ R +GL FQ+VDDILD T+S+E+LGK AG DL    LT
Sbjct: 240  ATVLGAIVGGGSDEEVEKLRRFARCIGLLFQVVDDILDVTKSSEELGKTAGKDLIADKLT 299

Query: 409  APVIFALETEPKLRDIIESE 350
             P +  LE      D + S+
Sbjct: 300  YPKLMGLEKSKDFADKLLSD 319



>gb:BT015110_1642080 Arabidopsis thaliana At3g32040 gene, complete
            cds.>gb:AP002033_1821496 Arabidopsis thaliana genomic
            DNA, chromosome 3, BAC clone: F1M23.
          Length = 360

 Score =  127 bits (319), Expect = 7e-28
 Identities = 88/247 (35%), Positives = 131/247 (53%), Gaps = 15/247 (6%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            +  A      AGGKR+RP L                        A  +EMIHT+SLIHDD
Sbjct: 93   IQEAVRYSLLAGGKRVRPLLCIAACELVGGDEATAMSA------ACAVEMIHTSSLIHDD 146

Query: 865  V--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ--------SSWYLANLENIEVIKLI 716
            +  +D++D+RRGK T H+++G  +AVLAGD + A         SS  +A    I  +  +
Sbjct: 147  LPCMDDADLRRGKPTNHKVFGEHMAVLAGDALLALAFEHMTVVSSGLVAPERMIRSVTEL 206

Query: 715  SQVI--KDFASGEIKQASS--LFDCDVGMEDYLIKSYYKTASLI-AASTKGAAIFSGVDS 551
            ++ I  K   +G++    S  L   DVG+E       +KTA+L+ AA+  GA I  G + 
Sbjct: 207  AKAIGTKGLVAGQVSDLCSQGLNPYDVGLERLEFIHLHKTAALLEAAAVLGAIIGGGTEE 266

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKL 371
             I +++ +YGR +GL FQ+VDDI+D T+S E+LGK AG D+    LT P +  LE   ++
Sbjct: 267  EI-QKLRKYGRCIGLLFQVVDDIIDVTESTEELGKTAGKDVMARKLTYPRLIGLERSREV 325

Query: 370  RDIIESE 350
             + +  E
Sbjct: 326  AEKLRRE 332



>gb:AY515700_1610755 Plectranthus barbatus geranylgeranyl
            pyrophosphate synthase mRNA, partial cds.
          Length = 359

 Score =  127 bits (319), Expect = 7e-28
 Identities = 86/261 (32%), Positives = 130/261 (49%), Gaps = 12/261 (4%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +N+ L + V    P  +  +      AGGKR+RP L                        
Sbjct: 79   VNRALDAAVAQREPRWIHESMRYSLLAGGKRVRPLLCIASCELVGGDERTAMPA------ 132

Query: 913  AEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL- 743
            A   EMIHT SLIHDD+  +D  D+RRGK T H++YG  VAVLAGD + A +  ++A   
Sbjct: 133  ACATEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVYGENVAVLAGDALLALAFEHVAAAT 192

Query: 742  ENIEVIKLISQVIK--------DFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
            E +   +++  V++            G++    S    +VG+E       +KTA+L+ A+
Sbjct: 193  EGVAPERVVRAVVEFGRYIGSEGLVGGQVVDIHSEGLAEVGVEQLEYIHLHKTAALLEAA 252

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
                AI  G D    E++ ++ R +GL FQ+VDDILD T+S+E+LGK AG DL     T 
Sbjct: 253  VVMGAILGGADDEAVEKLRKFARCIGLLFQVVDDILDVTKSSEELGKTAGKDLLTDKTTY 312

Query: 406  PVIFALETEPKLRDIIESEFC 344
            P +  LE   +  + + ++ C
Sbjct: 313  PKLLGLEKSREFAEKLRADAC 333



>pir|C75139|C75139 bifunctional short chain isoprenyl diphosphate
            synthase  (idsa) PAB2389 - Pyrococcus abyssi (strain
            Orsay)>gb:CNSPAX03_849677 Pyrococcus abyssi complete
            genome; segment 3/6.
          Length = 346

 Score =  127 bits (319), Expect = 7e-28
 Identities = 84/255 (32%), Positives = 134/255 (52%), Gaps = 9/255 (3%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENP-VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            LF  + +    +++ L  ++  + P VL  AA     AGGKR+RP +V   +        
Sbjct: 11   LFNRIKERAKLVDEKLFELIPEKEPKVLYEAARHYPLAGGKRIRPFVVLTATEAVGGNAL 70

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                       A  IE+IH  SL+HDD++D  + RRGK TVH+++G  +A+LAGD +F++
Sbjct: 71   KAIYP------AVAIELIHNYSLVHDDIMDMDETRRGKPTVHKVWGINMAILAGDLLFSK 124

Query: 766  SSWYL--ANLENIEVIKLISQVIKDFASGEIKQASSLFDCD------VGMEDYLIKSYYK 611
            +   +  A +   +  K++  ++K  AS E+ +  +L D +      V +E+Y+     K
Sbjct: 125  AFEAISRAEISPEKKAKVLETIVK--ASNELCEGQAL-DLEFENREMVSIEEYMRMISGK 181

Query: 610  TASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSD 431
            T +L  AS K   I    +    E + ++GRN+G++FQI DD+LD     E+LGKP GSD
Sbjct: 182  TGALFDASAKVGGIVGTENEEYIEALSRWGRNVGMAFQIWDDVLDLIADEEKLGKPVGSD 241

Query: 430  LAKGNLTAPVIFALE 386
            + KG  T  V    E
Sbjct: 242  IRKGKKTLIVAHFFE 256



>pir|T11021|T11021 farnesyltranstransferase (EC 2.5.1.29) - white
            lupine>gb:LAU15778_1683928 Lupinus albus geranylgeranyl
            pyrophosphate synthase (ggps1) mRNA, complete cds.
          Length = 316

 Score =  127 bits (319), Expect = 7e-28
 Identities = 83/248 (33%), Positives = 126/248 (50%), Gaps = 12/248 (4%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENP-VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++N+ L   V    P  +  A      AGGKR+RP L                       
Sbjct: 35   SVNQALNDAVSLREPHKIHEAMRYSLLAGGKRVRPVLCIAACEVVGGNESTAMAA----- 89

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA-- 749
             A  IEMIHT SLIHDD+  +D  D+RRGK T H+++G  +AVLAGD + A +  ++A  
Sbjct: 90   -ACSIEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVFGENIAVLAGDALLAFAFEHIAVS 148

Query: 748  --NLENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
               +    +I  I ++ K   +     G++   +S   CD+G+E       +KTA+L+  
Sbjct: 149  TSGVSPERIIGAIGELAKSIGTEGLVAGQVVDINSEGLCDIGLEKLEFIHLHKTAALLEG 208

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    AI  G  +   E++  + R +GL FQ+VDD+LD T+S+++LGK AG DL    +T
Sbjct: 209  SVVVGAILGGGCNEEVEKLRMFARYIGLMFQVVDDVLDVTKSSKELGKTAGKDLVADKVT 268

Query: 409  APVIFALE 386
             P +  +E
Sbjct: 269  YPKLLGIE 276



>pir|G84566|G84566 probable geranylgeranyl pyrophosphate synthase
            [imported] - Arabidopsis thaliana>gb:AC005724_1532942
            Arabidopsis thaliana chromosome 2 clone MSF3 map
            CIC06E08, complete sequence.>gb:AC006135_1533472
            Arabidopsis thaliana chromosome 2 clone F24H14 map
            CIC06E08, complete sequence.
          Length = 372

 Score =  127 bits (319), Expect = 7e-28
 Identities = 87/258 (33%), Positives = 135/258 (52%), Gaps = 12/258 (4%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            T+N+ L   +    P+ +  A      AGGKR+RP L                      +
Sbjct: 91   TINRALDEAIPLIEPLNIHKAMRYAILAGGKRVRPILCLAACELVGGEERLAI------Q 144

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL--A 749
             A  +EMIHT SLI DD+  +D  D+RRGK T H+++G  VA+L+G  + A +  +L  A
Sbjct: 145  AACAVEMIHTMSLIKDDLPCMDNDDLRRGKPTTHKVFGESVAILSGGALLALAFEHLTEA 204

Query: 748  NLENIEVIKLISQVIKDFAS-----GEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAA 590
            ++ + ++++ + ++ K   +     G+ K  SS  L   DVG+ED      +KT SL+ A
Sbjct: 205  DVSSKKMVRAVKELAKSIGTKGLVAGQAKDLSSEGLEQNDVGLEDLEYIHVHKTGSLLEA 264

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    A+  G      E++  + R +GL FQ+VDDILD T+S+E+LGK AG D   G LT
Sbjct: 265  SAVIGAVIGGGTEKEIEKVRNFARCIGLLFQVVDDILDETKSSEELGKTAGKDKVAGKLT 324

Query: 409  APVIFALETEPKLRDIIE 356
             P +  +E   K ++ +E
Sbjct: 325  YPKVIGVE---KSKEFVE 339



>gb:AP004185_1838690 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1301_C12.>gb:AP004276_1839653 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0453G03.
          Length = 366

 Score =  127 bits (318), Expect = 9e-28
 Identities = 90/270 (33%), Positives = 136/270 (50%), Gaps = 23/270 (8%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENP--VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            +N+ L + + A+ P   L  A      AGGKR+RPAL                       
Sbjct: 77   VNRALDASIPADEPPAALHEAMRYALLAGGKRVRPALCLAACAVVGGREAWAMPA----- 131

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL 743
             A  +EM+HT SL+HDD+  +D+ D+RRGK T H +YG  +AVL GD + + S  ++A  
Sbjct: 132  -AAAVEMVHTMSLVHDDLPCMDDDDLRRGKPTCHVVYGEPIAVLTGDALLSLSFHHMARF 190

Query: 742  EN----IEVIKLISQVIKDFASGEIKQ--------ASSLFDCD-------VGMEDYLIKS 620
            ++    I+  K  ++V++  A GE+ +        A  + D +       V +E      
Sbjct: 191  DSYPPDIDADKHPARVVR--AIGELARCIGSEGLVAGQVVDLEMTGSTETVPLERLEYIH 248

Query: 619  YYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPA 440
             +KTA+L+ AS    AI  G      E +  Y R++GL FQ+VDDILD T+S+E+LGK A
Sbjct: 249  LHKTAALLEASVVIGAILGGGSDEQIESLRMYARSIGLLFQVVDDILDVTKSSEELGKTA 308

Query: 439  GSDLAKGNLTAPVIFALETEPKLRDIIESE 350
            G DLA    T P +  LE   +  + + S+
Sbjct: 309  GKDLASDKTTYPKLLGLEKSREFAEKLLSD 338



>gb:AF251012_1780932 Tagetes erecta GGDP synthase mRNA, complete cds.
          Length = 361

 Score =  126 bits (317), Expect = 1e-27
 Identities = 82/246 (33%), Positives = 125/246 (50%), Gaps = 11/246 (4%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +N+ L   V  ++P+ +  +      AGGKR+RP L                        
Sbjct: 82   VNQALDLAVPLKDPIKIHESMRYSLLAGGKRVRPVLCIAACELVGGDGLTAMPA------ 135

Query: 913  AEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN-- 746
            A  +EMIHT SL+HDD+  +D  D RRGK T H +YG  +AVL GD M + +  ++A   
Sbjct: 136  ACAVEMIHTMSLMHDDLPCMDNDDFRRGKPTNHMVYGEEIAVLGGDAMLSFAFEHMATAT 195

Query: 745  --LENIEVIKLISQVIKDFASGEIKQASSLFDC----DVGMEDYLIKSYYKTASLIAAST 584
              + +  +++ I ++ K   S  +     +  C    DVG+E       +KTA+L+  S 
Sbjct: 196  KGVSSDRILRAIGELAKCIGSEGLVAGQVVDICSEGADVGLEHLEFIHLHKTAALLEGSV 255

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
               AI  G   G  E++ ++ R++GL FQ+VDDILD T+S+E+LGK AG DL     T P
Sbjct: 256  VLGAILGGGSDGEIEKLRKFARSIGLLFQVVDDILDVTKSSEELGKTAGKDLVSDKTTYP 315

Query: 403  VIFALE 386
             +  +E
Sbjct: 316  KLLGIE 321



>gb:AE010369_262406 Methanopyrus kandleri AV19 section 68 of 157 of
            the complete genome.>gb:AE009439_903187 Methanopyrus
            kandleri AV19, complete genome.
          Length = 324

 Score =  126 bits (317), Expect = 1e-27
 Identities = 86/297 (28%), Positives = 137/297 (46%), Gaps = 5/297 (1%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            L  A   +  AGGKR+RP L                  ++    A  +E+IHT +LIHDD
Sbjct: 32   LYDACWHLIEAGGKRIRPLLAI------KSCLMLGGSEEDVLPEAVAVELIHTFTLIHDD 85

Query: 865  VLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASG 686
            ++DE D RRG   VH  +G  VA+LAGD +F+++    A   ++E +K +++   +   G
Sbjct: 86   IMDEDDERRGVPAVHVKWGVPVAILAGDTLFSKAFEVAAEGGDVEAVKELARACTEICEG 145

Query: 685  EIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGL 506
            +          +V  +++L     KTA+LI  S     + +G +    E + +YG NLG+
Sbjct: 146  QAMDIGFENRTEVTEDEFLEMIRKKTAALIRTSCVVGGLKAGANREQLEALREYGENLGI 205

Query: 505  SFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL-----ETEPKLRDIIESEFCX 341
            +FQI DD+LD      +LGKP GSD+ +G  T  VI  L     E   ++  ++ +E   
Sbjct: 206  AFQIQDDVLDLVGDESELGKPVGSDIVEGKKTLIVIKGLELADEEQRERILSVLGNEDAS 265

Query: 340  XXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAXEEMVQYNLER 170
                      ++  G I             A   L  LP +  R   E++  + +ER
Sbjct: 266  REDVREVIQILEDLGAIDYAKKRAREYADRAKAALRELPENEHREFLEKLADFVVER 322



>gb:AB034249_1518858 Croton sublyratus mRNA for geranylgeranyl
            pyrophosphate synthase, complete cds.
          Length = 368

 Score =  126 bits (316), Expect = 2e-27
 Identities = 82/259 (31%), Positives = 132/259 (50%), Gaps = 12/259 (4%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +N+ L++ V    P+ +  +      AGGKR+RPAL                        
Sbjct: 88   INQALEAAVSLREPLKIHESMRYSLLAGGKRVRPALCLAACELVGGDESMAMPA------ 141

Query: 913  AEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA--- 749
            A  +EMIHT SLIHDD+  +D  D+RRGK T H ++G  VAVLAGD + A +  ++A   
Sbjct: 142  ACAVEMIHTMSLIHDDLPCMDNDDLRRGKPTNHIVFGENVAVLAGDALLAFAFEHIAVST 201

Query: 748  -NLENIEVIKLISQVIK-----DFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
             N+  + +++ + ++ K        +G++    S    +V +E       +KTA L+  +
Sbjct: 202  LNVSPVRIVRGVGELAKAIGAEGLVAGQVVDICSEGLSEVDLEKLEFIHIHKTAKLLEGA 261

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
                AI  G      E++ +Y R++GL FQ+VDDILD T+S+++LGK AG DL    +T 
Sbjct: 262  VVLGAIMGGGTDEEVEKLRKYARDIGLLFQVVDDILDVTKSSQELGKTAGKDLVADKVTY 321

Query: 406  PVIFALETEPKLRDIIESE 350
            P +  +E   +  + +  E
Sbjct: 322  PKLMGIEKSREFAEKLNKE 340



>gb:BX248355_761725 Corynebacterium diphtheriae gravis NCTC13129,
            complete genome; segment 2/8.
          Length = 330

 Score =  126 bits (316), Expect = 2e-27
 Identities = 89/324 (27%), Positives = 147/324 (45%), Gaps = 4/324 (1%)
 Frame = -1

Query: 1126 SLFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            +L E +   ++ +   L+  +      L+     +  AGGKR RP    L S+       
Sbjct: 13   NLNEEIAAGMIRVEDLLREELSKGEDFLVEKVMHLAEAGGKRFRPMFALLASQYGSQPMS 72

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                     + A ++EM H A+L HDDV+DE+D RRG ++ +  +   VA+LAGD + A 
Sbjct: 73   ENVI-----KAAVVVEMTHLATLYHDDVMDEADKRRGVDSANFRWNNSVAILAGDILLAH 127

Query: 766  SSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAS 587
             +  +A+L  +E +   S+   +  +G++++     D D  +E YL     KT  LIA++
Sbjct: 128  VARLMADL-GVETVAHFSETFAELVTGQMRETIGARDGDP-IEHYLNVINEKTGVLIASA 185

Query: 586  TKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTA 407
                ++ +G  +   E +  YGR +G+ FQIVDDI+D        GK  G+DL +G  T 
Sbjct: 186  GFLGSMHAGASAEHVEALRAYGRAIGMVFQIVDDIIDIFSDTTDSGKTPGTDLREGVFTL 245

Query: 406  PVIFALETE----PKLRDIIESEFCXXXXXXXXXXXVKRCGGIXXXXXXXXXXXXXAIQN 239
            PV++AL  +     +LR I+                + R  G              A + 
Sbjct: 246  PVLYALSEDTAVGEELRSILTGPLTDDATVAHALDLLARSTGRERALADVHRYLEEAERQ 305

Query: 238  LECLPPSPFRVAXEEMVQYNLERV 167
            L  LP +    A   +  Y ++RV
Sbjct: 306  LALLPQNSTTDALRSLAHYTVKRV 329



>gb:BX957219_843298 Methanococcus maripaludis S2 complete genome;
            segment 1/5.
          Length = 317

 Score =  125 bits (315), Expect = 2e-27
 Identities = 74/224 (33%), Positives = 120/224 (53%), Gaps = 4/224 (1%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            L  A++ +  AGGKR+RP L  L                E    A  +E+IH  +L+HDD
Sbjct: 25   LYGASKHLLLAGGKRVRPYLSILT------YLLKKDELTEIMAPALSVELIHNYTLVHDD 78

Query: 865  VLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENI----EVIKLISQVIKD 698
            ++D  D RRG  TVH +YG  +A+LAGD ++A++   L+N+E+     EV+K++S+   +
Sbjct: 79   IMDNDDQRRGIPTVHTVYGEPIAILAGDLLYAKAFEALSNIEDSNKAHEVLKVLSKACVE 138

Query: 697  FASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGR 518
               G+ +      +    +++YL     KT +LI A  +  A+ +       E +  Y +
Sbjct: 139  VCEGQTED-MEFEERFPTLDEYLEMISKKTGALIVAPVEIGAVMADCTPEEREALCNYAK 197

Query: 517  NLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
             +G++FQI DD+LD     + +GKP GSD+ +G  T  VI A+E
Sbjct: 198  RIGMTFQIQDDVLDLIGDQKTIGKPVGSDIVEGKKTMMVIHAME 241



>gb:AY596297_631624 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 346

 Score =  125 bits (315), Expect = 2e-27
 Identities = 88/310 (28%), Positives = 139/310 (44%), Gaps = 18/310 (5%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL----------AEIIEM 896
            L  A+  +  AGGKR+RP ++ LV+             ++   L          A  IE+
Sbjct: 35   LYEASRYLLDAGGKRLRPTVLLLVAESLLDVDPLTADYRDFPTLEGGQADMMSAALAIEV 94

Query: 895  IHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL-----ANLENIE 731
            I T +LIHDD++D+  +RRG   VH+ Y    A+LAGD +++++  +L     A+   ++
Sbjct: 95   IQTFTLIHDDIMDDDALRRGVPAVHKEYDLSTAILAGDTLYSKAFEFLLETGAAHERTVD 154

Query: 730  VIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDS 551
              K ++        G+           V  E+YL     KTA L  A+    A   G D 
Sbjct: 155  ANKRLATTCTRICEGQSLDIEFEQRDVVTPEEYLEMVELKTAVLYGAAASIPATLLGADE 214

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKL 371
               + +Y YG ++G +FQI DD+LD T  +E+LGK  GSDL +   T   + A +    +
Sbjct: 215  QTVDALYNYGLDVGRAFQIQDDLLDLTTPSEKLGKQRGSDLVENKQTLVTLHARQQGVDV 274

Query: 370  RDIIESEFCXXXXXXXXXXXVKR---CGGIXXXXXXXXXXXXXAIQNLECLPPSPFRVAX 200
             D+++++             V+R    G I               QNLE LP +  R   
Sbjct: 275  GDLVDTDSVEAVSEAEIDDAVERLREVGSIEYARQTGQDLIASGKQNLEVLPDNEARYLL 334

Query: 199  EEMVQYNLER 170
            E +  Y +ER
Sbjct: 335  EGIANYLVER 344



>gb:AE016822_339475 Leifsonia xyli subsp. xyli str. CTCB07, complete
            genome.
          Length = 353

 Score =  125 bits (315), Expect = 2e-27
 Identities = 76/239 (31%), Positives = 124/239 (51%), Gaps = 1/239 (0%)
 Frame = -1

Query: 1111 VTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXT 932
            V D L  + + L   V   + +       +  AGGKR+RP L  L ++            
Sbjct: 30   VDDGLALVEEALHREVRFADNLADVTTRYLLEAGGKRVRPMLTLLTAQLGKGNT------ 83

Query: 931  KEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYL 752
             E  + A+ +E+ H ASL HDDV+D+S MRRG  T   ++G  VAVL GD +FA++S  +
Sbjct: 84   PEVLQAAQAVEITHLASLYHDDVMDDSQMRRGVPTAQFVWGNSVAVLTGDLLFARASKLV 143

Query: 751  ANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAA 572
            ++L     I+L +   +    G++ +     D +  +  Y+     KT SLIA + +   
Sbjct: 144  SSLGE-RAIQLQADTFERLCLGQLHETIGPQDGEDAVAHYIRVLEDKTGSLIAVAAQMGI 202

Query: 571  IFSGVDSGISEQMYQYGRNLGLSFQIVDDILDF-TQSAEQLGKPAGSDLAKGNLTAPVI 398
            +FSG DS   E +  +G  +G++FQ++DD++D  ++   + GK  G+DL  G  T PV+
Sbjct: 203  VFSGADSSYEEPVVTFGEKIGVAFQLIDDVIDLSSEGVAETGKTPGNDLRAGVATLPVL 261



>gb:AF492022_1804889 Cistus incanus subsp. creticus geranylgeranyl
            pyrophosphate synthase (GGPPS1) mRNA, complete cds.
          Length = 364

 Score =  125 bits (314), Expect = 3e-27
 Identities = 82/260 (31%), Positives = 129/260 (49%), Gaps = 12/260 (4%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++N+ L++ V    P+ +  A      AGGKR+RP L                       
Sbjct: 83   SVNQALETAVSLREPLKIHEAMRYSVLAGGKRVRPVLCIAACELVGGEESMAMPA----- 137

Query: 916  LAEIIEMIHTASLIHDD--VLDESDMRRGKETVHQIYGTRVAVLAGD----FMFAQSSWY 755
             A  +EMIHT SLIHDD   +D  D+RRGK T H+++G  +AVLAGD    F F   +  
Sbjct: 138  -ACAVEMIHTMSLIHDDPPCMDNDDLRRGKPTNHKVFGEDIAVLAGDALLAFSFEHMTGS 196

Query: 754  LANLENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
               +    +++ + ++ K   S     G++    S    DVG+E       +KTA+L+  
Sbjct: 197  TVGVSPARIVRAVGELAKSIGSEGLVAGQVVDICSEGLTDVGLEHLEFIHVHKTAALLEG 256

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    AI  G      E++ ++ R +GL FQ+VDDILD T+S+ +LGK AG DL    +T
Sbjct: 257  SVVLGAILGGGSDEEVEKLRKFARCIGLLFQVVDDILDVTKSSTELGKTAGKDLVADKVT 316

Query: 409  APVIFALETEPKLRDIIESE 350
             P +  +E   +  + ++++
Sbjct: 317  YPKLMGIEKSREFAEELKND 336



>gb:CP000025_878413 Campylobacter jejuni RM1221, complete genome.
          Length = 297

 Score =  125 bits (314), Expect = 3e-27
 Identities = 66/178 (37%), Positives = 107/178 (60%)
 Frame = -1

Query: 919 RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
           ++   IE+IH ASL+HDD++DES++RRG  +V+  +GT+ A++ GD +++++ + L+ ++
Sbjct: 50  KICAAIELIHLASLLHDDIIDESELRRGARSVNAEFGTKNALMLGDILYSKAFYELSKMD 109

Query: 739 NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
                 +IS  +   A GE+         ++  E YL   Y KTA LI AS +  AI +G
Sbjct: 110 -ARFASIISDAVVKLAIGELMDVDLGEKFNINKEAYLKMIYNKTAVLIEASARCGAILAG 168

Query: 559 VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
           +     +   +YG+NLGL+FQ++DDILD     + LGKPA +D  +G  T P I+  E
Sbjct: 169 L---YEKDFAEYGKNLGLAFQMIDDILDIKSDEKILGKPAMNDFKEGKTTLPYIYLYE 223



>gb:BA000011_665526 Thermoplasma volcanium GSS1 DNA, complete genome.
          Length = 326

 Score =  125 bits (314), Expect = 3e-27
 Identities = 80/234 (34%), Positives = 117/234 (50%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLA 911
            +N+ L  +V +E P L   A+    AGGKR RP L  L                    LA
Sbjct: 18   VNERLFEVVKSEEPDLDRMAKYTIEAGGKRFRPLLTILAFESSTDDPYFKILD-----LA 72

Query: 910  EIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIE 731
               E+IHTASLIHDD++D+S MRRG+ T+    G   A++  D++FA++ + L +     
Sbjct: 73   AGYELIHTASLIHDDIIDDSPMRRGRPTLSYKEGINNAIVVADYLFAKA-YELGSRYGPL 131

Query: 730  VIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDS 551
            V K+++      A G+I +A +L + D+  + Y      KTA    A   GA I +  D 
Sbjct: 132  VSKVMADASSRLAEGQILEAVNLGNLDITEDTYYKIIENKTAHFFEACALGATIVAEADR 191

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
               E +  +  NLG++FQ+ DDILD        GKP   D+    LT P+I+AL
Sbjct: 192  PTREILSNFAFNLGMAFQVTDDILDIVGDDRYTGKPTFVDIKHDALTLPIIYAL 245



>pir|E81400|E81400 polyprenyl synthetase (EC 2.5.1.-) Cj0541
           [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X2_846942 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment 2/6.
          Length = 297

 Score =  125 bits (314), Expect = 3e-27
 Identities = 66/178 (37%), Positives = 107/178 (60%)
 Frame = -1

Query: 919 RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
           ++   IE+IH ASL+HDD++DES++RRG  +V+  +GT+ A++ GD +++++ + L+ ++
Sbjct: 50  KICAAIELIHLASLLHDDIIDESELRRGARSVNAEFGTKNALMLGDILYSKAFYELSKMD 109

Query: 739 NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
                 +IS  +   A GE+         ++  E YL   Y KTA LI AS +  AI +G
Sbjct: 110 -ARFASIISDAVVKLAIGELMDVDLGEKFNINKEAYLKMIYNKTAVLIEASARCGAILAG 168

Query: 559 VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
           +     +   +YG+NLGL+FQ++DDILD     + LGKPA +D  +G  T P I+  E
Sbjct: 169 L---YEKDFAEYGKNLGLAFQMIDDILDIKSDEKILGKPAMNDFKEGKTTLPYIYLYE 223



>gb:AP001309_1821137 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone:MUO10.
          Length = 357

 Score =  125 bits (313), Expect = 3e-27
 Identities = 84/246 (34%), Positives = 127/246 (51%), Gaps = 14/246 (5%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            +  A      AGGKR+RP L                        A  +EMIHT+SLIHDD
Sbjct: 90   IQEAVRYSLLAGGKRVRPLLCIAACELVGGDEATAMSA------ACAVEMIHTSSLIHDD 143

Query: 865  V--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN--------IEVIKLI 716
            +  +D++D+RRGK T H+ +G  +AVLAGD + A +  ++  + N        I  +  +
Sbjct: 144  LPCMDDADLRRGKPTNHKEFGEDMAVLAGDALLALAFEHMTFVSNGLVAPERMIRAVMEL 203

Query: 715  SQVI--KDFASGEIKQASS--LFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSG 548
            ++ I  K   +G++    S  L   DVG+E       +KTA+L+ A+    AI  G    
Sbjct: 204  AKAIGTKGLVAGQVTDLCSQGLNPDDVGLERLEFIHLHKTAALLEAAAVLGAIMGGGTEE 263

Query: 547  ISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLR 368
              E++ +Y R +GL FQ+VDDILD T+S ++LGK AG D+  G LT P +  LE   ++ 
Sbjct: 264  EIEKLRKYARCIGLLFQVVDDILDVTESTKELGKTAGKDVMAGKLTYPRLIGLERSREVA 323

Query: 367  DIIESE 350
            + +  E
Sbjct: 324  EKLRRE 329



>gb:AF513111_1807389 Abies grandis geranyl diphosphate synthase
            (GPPS1) mRNA, complete cds.
          Length = 383

 Score =  125 bits (313), Expect = 3e-27
 Identities = 88/264 (33%), Positives = 132/264 (50%), Gaps = 13/264 (4%)
 Frame = -1

Query: 1117 EVVTDDLLTLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            E +    +++N+ L+  V    P  +  A      AGGKR+RP L               
Sbjct: 93   EYLHSKAISVNEALERAVPLRYPEKIHEAMRYSLLAGGKRIRPILTIAACELVGGSEELA 152

Query: 940  XXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
              T      A  +EMIHT SLIHDD+  +D  D+RRGK T H+++G   AVLAGD + + 
Sbjct: 153  MPT------ACAMEMIHTMSLIHDDLPSMDNDDLRRGKLTNHKVFGEGTAVLAGDALLSF 206

Query: 766  SSWYLA-----NLENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSY 617
            +  ++A      + +  V++++S++ K   S     G++   +S  D  VG+E       
Sbjct: 207  AFEHIAVSTRKTVASHRVLRVVSELGKAIGSQGVAGGQVADITSEGDPSVGLETLEWIHI 266

Query: 616  YKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAG 437
            +KTA L+  +    AI  G      E+  +Y R +GL FQ+VDDILD T+S+E+LGK AG
Sbjct: 267  HKTAVLLECAVVSGAIIGGASENEIERTGRYARCVGLLFQVVDDILDVTRSSEELGKTAG 326

Query: 436  SDLAKGNLTAPVIFALETEPKLRD 365
             DL     T P +  LE   +  D
Sbjct: 327  KDLVSDKATYPKLMGLEKAKEFAD 350



>sp|Q42698|GGPP_CATRO Geranylgeranyl pyrophosphate synthetase,
            chloroplast precursor (GGPP synthetase) (GGPS) [Includes:
            Dimethylallyltransferase (EC 2.5.1.1);
            Geranyltranstransferase (EC 2.5.1.10);
            Farnesyltranstransferase (EC
            2.5.1.29)].>pir|T09966|T09966 farnesyltranstransferase
            (EC 2.5.1.29) - Madagascar periwinkle>gb:CRGGPPS_1673406
            C.roseus GGPP synthase gene.
          Length = 357

 Score =  125 bits (313), Expect = 3e-27
 Identities = 81/260 (31%), Positives = 134/260 (51%), Gaps = 12/260 (4%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++NK L+  V    P+ +  +      AGGKR+RP L                 +     
Sbjct: 76   SVNKALEDAVLVREPLKIHESMRYSLLAGGKRVRPMLCIAACELFGGTESVAMPS----- 130

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN- 746
             A  +EMIHT SL+HDD+  +D  D+RRGK T H+++G  VAVLAGD + A +  ++A  
Sbjct: 131  -ACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHKVFGEDVAVLAGDALLAFAFEHIATA 189

Query: 745  ---LENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
               + +  +++++ ++ K   S     G++    S    DVG+E       +KTA+L+  
Sbjct: 190  TKGVSSERIVRVVGELAKCIGSEGLVAGQVVDVCSEGIADVGLEHLEFIHIHKTAALLEG 249

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    AI  G +     ++ ++ R +GL FQ+VDDILD T+S+++LGK AG DL    +T
Sbjct: 250  SVVLGAIVGGANDEQISKLRKFARCIGLLFQVVDDILDVTKSSQELGKTAGKDLVADKVT 309

Query: 409  APVIFALETEPKLRDIIESE 350
             P +  ++   +  + +  E
Sbjct: 310  YPKLLGIDKSREFAEKLNRE 329



>gb:AK117933_1815940 Arabidopsis thaliana At3g14550 mRNA for putative
            geranylgeranyl pyrophosphate synthase (GGPS3), complete
            cds, clone: RAFL19-12-M11.
          Length = 360

 Score =  124 bits (312), Expect = 5e-27
 Identities = 92/263 (34%), Positives = 131/263 (49%), Gaps = 15/263 (5%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++N  L   V    P+ +  A      AGGKR+RP L   V                   
Sbjct: 76   SVNAALDVSVPLREPLTVQEAVRYSLLAGGKRVRPLLCIAVCELVGGDEATAMSA----- 130

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ-------- 767
             A  +EMIHT+SLIHDD+  +D +D+RRGK T H++YG  +AVLAGD + A         
Sbjct: 131  -ACAVEMIHTSSLIHDDLPCMDNADLRRGKPTNHKVYGEDMAVLAGDALLALAFEHMTVV 189

Query: 766  SSWYLANLENIEVIKLISQVIKD---FASGEIKQASSLFDCD-VGMEDYLIKSYYKTASL 599
            SS  +A    I  +  +++ I      A   I  AS   + D VG+E       +KTA+L
Sbjct: 190  SSGLVAPERMIRAVVELARTIGTTGLVAGQMIDLASERLNPDKVGLEHLEFIHLHKTAAL 249

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            + A+     I  G      E++ +Y R +GL FQ+VDDILD T+S E+LGK AG D+  G
Sbjct: 250  LEAAAVLGVIMGGGTEEEIEKLRKYARCIGLLFQVVDDILDVTKSTEELGKTAGKDVMAG 309

Query: 418  NLTAPVIFALETEPKLRDIIESE 350
             LT P +  LE   ++ + +  E
Sbjct: 310  KLTYPRLIGLERSKEVAEKLRRE 332



>gb:AB023038_1515398 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MIE1.
          Length = 360

 Score =  124 bits (312), Expect = 5e-27
 Identities = 92/263 (34%), Positives = 131/263 (49%), Gaps = 15/263 (5%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++N  L   V    P+ +  A      AGGKR+RP L   V                   
Sbjct: 76   SVNAALDVSVPLREPLTVQEAVRYSLLAGGKRVRPLLCIAVCELVGGDEATAMSA----- 130

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ-------- 767
             A  +EMIHT+SLIHDD+  +D +D+RRGK T H++YG  +AVLAGD + A         
Sbjct: 131  -ACAVEMIHTSSLIHDDLPCMDNADLRRGKPTNHKVYGEDMAVLAGDALLALAFEHMTVV 189

Query: 766  SSWYLANLENIEVIKLISQVIKD---FASGEIKQASSLFDCD-VGMEDYLIKSYYKTASL 599
            SS  +A    I  +  +++ I      A   I  AS   + D VG+E       +KTA+L
Sbjct: 190  SSGLVAPERMIRAVVELARAIGTTGLVAGQMIDLASERLNPDKVGLEHLEFIHLHKTAAL 249

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            + A+     I  G      E++ +Y R +GL FQ+VDDILD T+S E+LGK AG D+  G
Sbjct: 250  LEAAAVLGVIMGGGTEEEIEKLRKYARCIGLLFQVVDDILDVTKSTEELGKTAGKDVMAG 309

Query: 418  NLTAPVIFALETEPKLRDIIESE 350
             LT P +  LE   ++ + +  E
Sbjct: 310  KLTYPRLIGLERSKEVAEKLRRE 332



>gb:AE017178_398109 Porphyromonas gingivalis W83 section 7 of 8 of the
            complete genome.>gb:AE015924_1033720 Porphyromonas
            gingivalis W83 complete genome.
          Length = 292

 Score =  124 bits (312), Expect = 5e-27
 Identities = 77/216 (35%), Positives = 120/216 (55%), Gaps = 1/216 (0%)
 Frame = -1

Query: 1009 GKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKE 830
            GK +RP L  LV+                   A ++EMIHTA+LIHDDV+D +  RRG  
Sbjct: 13   GKHVRPLLTGLVAAVCAGKTNSTTL-----EAAVLLEMIHTATLIHDDVIDMASTRRGVP 67

Query: 829  TVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCD 650
            T++  +  RVAVL GDF+ + +      L +I +I +IS++ ++ + GEI+Q  +     
Sbjct: 68   TLNAFFDNRVAVLMGDFVLSSALMRAIALNDIRIITIISRLGRELSEGEIRQFETADKVI 127

Query: 649  VGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFT 470
            +  + Y+     KTA L +A  +  AI       I E++ + G  LG +FQI DDI D+ 
Sbjct: 128  IDEDIYMGVIRQKTAMLFSACAEVGAITVQAPVEIVERVKRVGELLGYAFQIRDDIFDYY 187

Query: 469  QSAEQLGKPAGSDLAKGNLTAPVIFALETEPK-LRD 365
            ++   +GKP G+D+ +G +T P++FAL+ E   LRD
Sbjct: 188  RN--DVGKPTGNDIREGKITLPLLFALKNEQSALRD 221



>gb:TACID2_196208 Thermoplasma acidophilum complete genome; segment
            2/5.
          Length = 322

 Score =  124 bits (312), Expect = 5e-27
 Identities = 79/234 (33%), Positives = 115/234 (49%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLA 911
            +N  L   V +E P L   A     AGGKR RP L  L                    LA
Sbjct: 14   VNARLLETVKSEEPDLDRMARYTIEAGGKRFRPLLTILAYESSTDEPYFKILD-----LA 68

Query: 910  EIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIE 731
               E+IHTASLIHDD++D S MRRG+ T+    G   A++  D++FA++ + L +     
Sbjct: 69   TGYELIHTASLIHDDIIDNSPMRRGRPTLSYKEGVNNAIVVADYLFAKA-YELGSRYGPI 127

Query: 730  VIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDS 551
            V K+++      A G+I +A +L + ++  + Y      KTA    A  +GA I +  D 
Sbjct: 128  VSKVMADASSRLAEGQILEAVNLGNLNISEDTYYRIIENKTAHFFEACARGATIAANADL 187

Query: 550  GISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL 389
                 +  +  NLG++FQ+ DDILD T   +  GKP   D+    LT P+I+AL
Sbjct: 188  NTRNMLSGFAFNLGMAFQVTDDILDITGDDKYTGKPTFVDIKHDALTLPIIYAL 241



>pir|B72560|B72560 probable geranyltranstransferase APE1764 -
            Aeropyrum pernix  (strain K1)>gb:BA000002_652511
            Aeropyrum pernix K1 DNA, complete genome.
          Length = 337

 Score =  124 bits (312), Expect = 5e-27
 Identities = 81/264 (30%), Positives = 129/264 (48%), Gaps = 8/264 (3%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXX 944
            LFE  +   + ++  +   +      L  A+  +  AGGKR+RP +  L +R        
Sbjct: 11   LFEASSRYSMLIDHYIMDFMSITPDRLSGASLHLIKAGGKRLRPLITLLTARMLGGLEAE 70

Query: 943  XXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS 764
                     LA  IE  HT SLIHDD++D  ++RRG  T H +YG   A+LAGD + A +
Sbjct: 71   ARAIP----LAASIETAHTFSLIHDDIMDRDEVRRGVPTTHVVYGDDWAILAGDTLHAAA 126

Query: 763  --------SWYLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKT 608
                     W +++ +     K++S+     + G+          DV + DYL     KT
Sbjct: 127  FKMIADSREWGMSHEQAYRAFKVLSEAAIQISRGQAYDMLFEETWDVDVADYLNMVRLKT 186

Query: 607  ASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDL 428
             +LI A+ +  A+ +G  S I + M + G N G++FQI DDIL      +  GKP  +DL
Sbjct: 187  GALIEAAARIGAVAAGAGSEIEKMMGEVGMNAGIAFQIRDDILGVIGDPKVTGKPVYNDL 246

Query: 427  AKGNLTAPVIFALETEPKLRDIIE 356
             +G  T  VI+A++   + R+I++
Sbjct: 247  RRGKKTLLVIYAVKKAGR-REIVD 269



>gb:AE017201_403786 Lactobacillus johnsonii NCC 533, section 2 of 7 of
            the complete genome.>gb:AE017198_1122273 Lactobacillus
            johnsonii NCC 533, complete genome.
          Length = 350

 Score =  124 bits (310), Expect = 8e-27
 Identities = 75/248 (30%), Positives = 132/248 (53%), Gaps = 1/248 (0%)
 Frame = -1

Query: 1120 FEVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            F     D++ +N+ +   V     +L  A +  F++ GK +RPA V L            
Sbjct: 30   FPETQKDMIAINRIILKHVNTVPGLLGDALKDTFASPGKMLRPACVMLFG---SFGPNGH 86

Query: 940  XXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSS 761
               KE +++A  IE +H A+LIHDD++DES MR G+ ++   YG  +AV AGD++FA S 
Sbjct: 87   EKRKELQKIATSIETLHNATLIHDDIIDESSMRHGRPSIQTKYGKHIAVYAGDYLFALSL 146

Query: 760  WYLA-NLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAAST 584
              L+ N +++  +    + +++   GE +Q ++ +  ++  ++YL +   KT  L   + 
Sbjct: 147  TLLSENAQSLHSVIADGKTMQNILVGETEQYNNAYKINISEKEYLDQIKGKTGVLFGLAC 206

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
               A  SG+    + +  ++G  LG +FQ+ DDILD+T ++    KP   D+  G  + P
Sbjct: 207  FIGAYESGLKVTKALKAKKFGDYLGQAFQLRDDILDYTTTSSTFKKPVLLDVKDGIYSGP 266

Query: 403  VIFALETE 380
            +IFAL+ +
Sbjct: 267  LIFALQND 274



>gb:AB052679_1521219 Eucommia ulmoides EUGGPS mRNA for putative GGPP
            synthase, complete cds.
          Length = 288

 Score =  123 bits (309), Expect = 1e-26
 Identities = 84/260 (32%), Positives = 129/260 (49%), Gaps = 12/260 (4%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++NK L++ V    P+ +  +      AGGKR+RP L                       
Sbjct: 7    SVNKALEATVLLRYPIKIHESMRYSILAGGKRVRPLLCIAACELVGGQESTAMPA----- 61

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLAN- 746
             A  +EMIHT SL+HDD+  +D  D+RRGK T H ++G  VAVLAGD + A +   +A  
Sbjct: 62   -ACAVEMIHTMSLMHDDLPCMDNDDLRRGKPTNHMVFGEDVAVLAGDSLLAFAFELIATS 120

Query: 745  ---LENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAA 590
               +    ++++I ++ K   S     G++    S    DVG+E       +KTA+L+  
Sbjct: 121  TTGVPADRIVRVIGELAKSIGSEGLVAGQVIDICSEGMTDVGLEHLEFIHVHKTAALLEG 180

Query: 589  STKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLT 410
            S    AI  G      E++ ++ R +G  FQ+VDDILD T+S+++LGK AG DL     T
Sbjct: 181  SVVLGAILGGATDPEVEKLRKFARCIGFLFQVVDDILDVTKSSQELGKTAGKDLVADKTT 240

Query: 409  APVIFALETEPKLRDIIESE 350
             P +  LE   +  + +  E
Sbjct: 241  YPKLIGLEKSREFAEKLNRE 260



>gb:AB034250_1518859 Scoparia dulcis mRNA for geranylgeranyl
            pyrophosphate synthase, complete cds.
          Length = 351

 Score =  123 bits (309), Expect = 1e-26
 Identities = 95/305 (31%), Positives = 146/305 (47%), Gaps = 12/305 (3%)
 Frame = -1

Query: 1228 STKAPESFLNGVTPASSSPMLDLKKDSGSPISVASLFEVVTDDLLTLNKNLQSIVGAENP 1049
            +T  P SFL    P S+   +  K+ S    S     + + +   ++NK L+S V  + P
Sbjct: 28   TTHLPISFLFAGKPISA---VLTKEYSHQTSSTFDFKKYMLEKASSVNKALESAVSLKEP 84

Query: 1048 V-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIH 872
            + +  +      AGGKR+RP L                        A  IEMIHT SL+H
Sbjct: 85   LKIHESMRYSLLAGGKRVRPMLCLAACELVGGHPSTAMPA------ACSIEMIHTMSLMH 138

Query: 871  DDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLENIEVIKLISQVIKD 698
            DD+  +D   +RRG  T H ++G  VAVLAGD + A S  YLA      + + I +VI +
Sbjct: 139  DDLPCMDNDHLRRGHPTNHIVFGEDVAVLAGDALLAYSFEYLATATEGVLPERIVRVIAE 198

Query: 697  FA---------SGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGI 545
             A         +G++    S    ++G+E       +KTA+L+  S    AI  G +   
Sbjct: 199  LAKCIRSEGLLAGQVVDICSEGVSEIGLEHLEYIHLHKTAALLEGSVVLGAILGGGNDEE 258

Query: 544  SEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRD 365
             E++ ++ R +GL FQ+VDDILD T+++ +LGK AG DL     T P +  +E   +  +
Sbjct: 259  VERLRKFARCIGLLFQVVDDILDVTKTSVELGKTAGKDLVADKTTYPKLIGIEKSREFAE 318

Query: 364  IIESE 350
             +  E
Sbjct: 319  KLNRE 323



>gb:AP008231_580455 Synechococcus elongatus PCC 6301 DNA, complete
            genome.
          Length = 301

 Score =  123 bits (309), Expect = 1e-26
 Identities = 78/245 (31%), Positives = 121/245 (49%), Gaps = 11/245 (4%)
 Frame = -1

Query: 1051 PVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIH 872
            P++  +      A GKR+RP L                 T      A  +EM+HT SLIH
Sbjct: 36   PLIYESMRYSLLAEGKRLRPILCLASCELAGGTAAIALPT------ACALEMVHTMSLIH 89

Query: 871  DDV--LDESDMRRGKETVHQIYGTRVAVLAGD----FMFAQSSWYLANLENIEVIKLISQ 710
            DD+  +D  D RRG+ T H++YG  +A+LAGD    + F   + +   +    V+K+I+ 
Sbjct: 90   DDLPSMDNDDFRRGRPTNHKVYGEDIAILAGDALLTYAFEAIARHTPEVPADRVLKVIAA 149

Query: 709  VIK-----DFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGI 545
            + +         G++    S    DV +E       +KT +L+  S    AI +G    +
Sbjct: 150  LARAVGAEGLVGGQVVDLQSEGRDDVNLETLHYIHTHKTGALLEVSVVSGAILAGASEEL 209

Query: 544  SEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRD 365
             EQ+  Y + +GL+FQ++DDILD T +AE+LGK AG DLA    T P +  L+   +  D
Sbjct: 210  QEQLRTYAQKIGLAFQVIDDILDITATAEELGKTAGKDLAAKKATYPSLLGLDASREYAD 269

Query: 364  IIESE 350
             + +E
Sbjct: 270  QLITE 274



>gb:AE016934_361426 Bacteroides thetaiotaomicron VPI-5482, section 9
            of 21 of the complete genome.>gb:AE015928_987914
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 324

 Score =  123 bits (309), Expect = 1e-26
 Identities = 82/239 (34%), Positives = 119/239 (49%), Gaps = 4/239 (1%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +N +L  I     P  L    E I S GGKR+RP L+ +                     
Sbjct: 11   INNHLSEIQITRTPEGLYEPIEYILSLGGKRIRPVLMLMAYNLYKEDVSSIYDP------ 64

Query: 913  AEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL--E 740
            A  IE+ H  +L+HDD++D SDMRRGK TVH+++    A+L+GD M   +  Y+A    E
Sbjct: 65   ATGIEVYHNHTLLHDDLMDRSDMRRGKPTVHKVWNDNTAILSGDTMLILAFRYVAGCAPE 124

Query: 739  NI-EVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFS 563
            ++ EVI L S    +   G+          DV  ++Y+     KTA L+AAS K  AI +
Sbjct: 125  HLKEVIDLFSLTALEICEGQQLDMEFESRNDVAEDEYIEMIRLKTAVLLAASLKIGAILA 184

Query: 562  GVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
            G  +  +E +Y +G  +G++FQ+ DD+LD     E  GK  G D+     T  +I ALE
Sbjct: 185  GASAADAENLYNFGMQIGVAFQLQDDLLDVYGDPEVFGKKIGGDILCNKKTYMLIKALE 243



>gb:AE010220_260669 Pyrococcus furiosus DSM 3638, section 95 of 173 of
            the complete genome.>gb:AE009950_901450 Pyrococcus
            furiosus DSM 3638, complete genome.
          Length = 340

 Score =  123 bits (309), Expect = 1e-26
 Identities = 77/252 (30%), Positives = 126/252 (50%), Gaps = 6/252 (2%)
 Frame = -1

Query: 1123 LFEVVTDDLLTLNKNLQSIVGAENP-VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXX 947
            LF+ + +    +++ L S++  + P +L  AA     AGGKR+RP +V   +        
Sbjct: 5    LFKKIKEKAKFVDEKLLSLIPEKEPKILYEAARHYPLAGGKRVRPFVVLTATEAVGGEWE 64

Query: 946  XXXXTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
                       A  IE+IH  SL+HDD++D  + RRG+ TVH+++G  +A+LAGD +F++
Sbjct: 65   KAIYP------AVAIELIHNYSLVHDDIMDMDETRRGRPTVHKVWGINMAILAGDLLFSK 118

Query: 766  SSWYLANLE-----NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTAS 602
            +   ++  E        V++ + +   +   G+           V +E+Y+     KT +
Sbjct: 119  AFEAISRAEIPPEKKARVLETVVKASNELCEGQAMDLEFEKRDTVTIEEYMRMISGKTGA 178

Query: 601  LIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAK 422
            L  AS K   I    +      +  +GRN+G++FQI DD+LD     E+LGKP GSD+ K
Sbjct: 179  LFDASAKVGGIVGTDNEEYINALSTWGRNVGIAFQIWDDVLDLIADEEKLGKPVGSDIRK 238

Query: 421  GNLTAPVIFALE 386
            G  T  V    E
Sbjct: 239  GKKTLIVAHFFE 250



>gb:AB025791_4341 Aeropyrum pernix fgs gene for farnesylgeranyl
            diphosphate synthase, complete cds.
          Length = 318

 Score =  123 bits (309), Expect = 1e-26
 Identities = 78/238 (32%), Positives = 120/238 (50%), Gaps = 8/238 (3%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            L  A+  +  AGGKR+RP +  L +R                 LA  IE  HT SLIHDD
Sbjct: 18   LSGASLHLIKAGGKRLRPLITLLTARMLGGLEAEARAIP----LAASIETAHTFSLIHDD 73

Query: 865  VLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQS--------SWYLANLENIEVIKLISQ 710
            ++D  ++RRG  T H +YG   A+LAGD + A +         W +++ +     K++S+
Sbjct: 74   IMDRDEVRRGVPTTHVVYGDDWAILAGDTLHAAAFKMIADSREWGMSHEQAYRAFKVLSE 133

Query: 709  VIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMY 530
                 + G+          DV + DYL     KT +LI A+ +  A+ +G  S I + M 
Sbjct: 134  AAIQISRGQAYDMLFEETWDVDVADYLNMVRLKTGALIEAAARIGAVAAGAGSEIEKMMG 193

Query: 529  QYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLRDIIE 356
            + G N G++FQI DDIL      +  GKP  +DL +G  T  VI+A++   + R+I++
Sbjct: 194  EVGMNAGIAFQIRDDILGVIGDPKVTGKPVYNDLRRGKKTLLVIYAVKKAGR-REIVD 250



>gb:AB027706_1517528 Daucus carota mRNA for GGPP synthase, complete
            cds.
          Length = 367

 Score =  122 bits (307), Expect = 2e-26
 Identities = 84/246 (34%), Positives = 124/246 (50%), Gaps = 11/246 (4%)
 Frame = -1

Query: 1090 LNKNLQSIVGAENPVLMSAAEQI-FSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRL 914
            +NK L   V  + P ++  A +    AGGKR+RP L                       +
Sbjct: 87   INKALDEAVPVQKPAIIHEAMRYSLLAGGKRVRPVLCIASCELVGGLESWAMP------M 140

Query: 913  AEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
            A  +EMIHT SLIHDD+  +D  D+RRGK T H++YG   A+LAGD + + +  ++A+  
Sbjct: 141  ACALEMIHTMSLIHDDLPCMDNDDLRRGKPTNHKVYGEETAILAGDALLSLAFEHVADAT 200

Query: 739  NIEVIKLISQVIKDFASGEIKQ---ASSLFDC-----DVGMEDYLIKSYYKTASLIAAST 584
            ++     + + I +  S    Q   A  + D      DV + D      +KT+ L+ AS 
Sbjct: 201  DMVTPGRVVRAIAELGSAVGSQGLVAGQIMDICNQGKDVDLNDLEYIHVHKTSKLLEASV 260

Query: 583  KGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAP 404
               AI  G +    E++ +Y R +GL FQ+VDDILD T+S+ +LGK AG DL     T P
Sbjct: 261  VCGAILGGGNVIEVERLRKYARCIGLLFQVVDDILDVTKSSAELGKTAGKDLVTDKTTYP 320

Query: 403  VIFALE 386
             +  LE
Sbjct: 321  KLMGLE 326



>gb:AE017283_431673 Propionibacterium acnes KPA171202, complete
            genome.
          Length = 324

 Score =  122 bits (307), Expect = 2e-26
 Identities = 78/240 (32%), Positives = 122/240 (50%)
 Frame = -1

Query: 1117 EVVTDDLLTLNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXX 938
            ++V+  L  +   L    GA+ P +  AA  I SAGGKR RP LV L S+          
Sbjct: 11   DLVSAKLALIEDELGRQAGADTPFVTEAANHIISAGGKRFRPLLVVLCSQFGDAVNDADL 70

Query: 937  XTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSW 758
                  R A ++E+ H ASL HDDV+DE+  RRG  + +  +G  VA++ GD++F+++S 
Sbjct: 71   V-----RAAVVMELTHVASLYHDDVMDEASRRRGAPSANLRWGNSVAIMVGDYLFSKASL 125

Query: 757  YLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKG 578
             +A L  ++ +KL ++       G+I +          +  YL     KT SLIAAS   
Sbjct: 126  AVAEL-GVDFVKLQARTFSRLVQGQIAETRGPSQGQDPLAHYLKVVADKTGSLIAASAVF 184

Query: 577  AAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVI 398
             A+ S   +     + Q+G ++G  FQ+ DD++D T +    GK  G+DL +   T P +
Sbjct: 185  GAMVSHASAENVAALEQFGEDIGEVFQLADDLIDITSTV--TGKTPGTDLREKVPTLPTL 242



>gb:AB023038_1515396 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MIE1.>gb:BT010463_1640409 Arabidopsis thaliana
            At3g14530 gene, complete cds.
          Length = 360

 Score =  122 bits (306), Expect = 2e-26
 Identities = 85/246 (34%), Positives = 127/246 (51%), Gaps = 14/246 (5%)
 Frame = -1

Query: 1045 LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDD 866
            +  A      AGGKR+RP L                        A  +EMIHT+SLIHDD
Sbjct: 93   IQEAVRYSLLAGGKRVRPLLCIAACELVGGDEATAMSA------ACAVEMIHTSSLIHDD 146

Query: 865  V--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLEN--IEVIKLISQVIK- 701
            +  +D +D+RRGK T H++YG  +AVLAGD + A +  ++  + +  +   K+I  V++ 
Sbjct: 147  LPCMDNADLRRGKPTNHKVYGEDMAVLAGDALLALAFEHMTVVSSGLVAPEKMIRAVVEL 206

Query: 700  -------DFASGE-IKQASSLFDCD-VGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSG 548
                      +G+ I  AS   + D VG+E       +KTA+L+ A+     I  G    
Sbjct: 207  ARAIGTTGLVAGQMIDLASERLNPDKVGLEHLEFIHLHKTAALLEAAAVLGVIMGGGTEQ 266

Query: 547  ISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALETEPKLR 368
              E++ +Y R +GL FQ+VDDILD T+S E+LGK AG D+  G LT P +  LE   ++ 
Sbjct: 267  EIEKLRKYARCIGLLFQVVDDILDVTKSTEELGKTAGKDVMAGKLTYPRLIGLEGSREVA 326

Query: 367  DIIESE 350
            + +  E
Sbjct: 327  EKLRRE 332



>gb:AY086932_1571970 Arabidopsis thaliana clone 29678 mRNA, complete
            sequence.
          Length = 360

 Score =  122 bits (305), Expect = 3e-26
 Identities = 91/263 (34%), Positives = 130/263 (49%), Gaps = 15/263 (5%)
 Frame = -1

Query: 1093 TLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRR 917
            ++N  L   V    P+ +  A      AGGKR+RP L   V                   
Sbjct: 76   SVNAALDVSVPLREPLTVQEAVRYSLLAGGKRVRPLLCIAVCELVGGDEATAMSA----- 130

Query: 916  LAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ-------- 767
             A  +EMIHT+SLIHDD+  +D +D+RRGK T H++YG  +AVLAGD + A         
Sbjct: 131  -ACAVEMIHTSSLIHDDLPCMDNADLRRGKPTNHKVYGEDMAVLAGDALLALAFEHMTVV 189

Query: 766  SSWYLANLENIEVIKLISQVIKD---FASGEIKQASSLFDCD-VGMEDYLIKSYYKTASL 599
            SS  +A    I  +  +++ I      A   I  AS   + D VG+E       +KTA+L
Sbjct: 190  SSGLVAPERMIRAVVELARAIGTTGLVAGQMIDLASERLNPDKVGLEHLEFIHLHKTAAL 249

Query: 598  IAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKG 419
            + A+     I  G      E++ +Y R +GL FQ+VDDI D T+S E+LGK AG D+  G
Sbjct: 250  LEAAAVLGVIMGGGTEEEIEKLRKYARCIGLLFQVVDDIPDVTKSTEELGKTAGKDVMAG 309

Query: 418  NLTAPVIFALETEPKLRDIIESE 350
             LT P +  LE   ++ + +  E
Sbjct: 310  KLTYPRLIGLERSKEVAEELRRE 332



>gb:BA000039_725805 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 307

 Score =  122 bits (305), Expect = 3e-26
 Identities = 86/261 (32%), Positives = 133/261 (50%), Gaps = 20/261 (7%)
 Frame = -1

Query: 1108 TDDLLTLNKNLQSIVGA--ENPVLMSAAEQIFSA-------GGKRMRPALVFLVSRXXXX 956
            T DL    K  Q++V A  E  + ++  E+I+ A       GGKR+RP L          
Sbjct: 14   TFDLKAYLKERQALVEAALEASIPVAYPEKIYDAMRYSLMAGGKRLRPILCLATCELMGG 73

Query: 955  XXXXXXXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGD 782
                   T      A  +EMIHT SLIHDD+  +D  D RRGK T H++YG  +A+LAGD
Sbjct: 74   TVEMAMPT------ACALEMIHTMSLIHDDLPAMDNDDYRRGKPTNHKVYGEDIAILAGD 127

Query: 781  FMFAQSSWYLA----NLENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYL 629
             + A +  Y+     N+    ++K+++++    A+     G++         D+G+E   
Sbjct: 128  GLLAYAFEYVVEQTKNVPAEYLLKIVARLGHAVAATGLVGGQVVDLECEGQPDIGLETLH 187

Query: 628  IKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLG 449
                +KT +L+ AS    A+ +G       ++ +Y  N+GL+FQIVDDILD T + + LG
Sbjct: 188  FIHSHKTGALLEASVVSGALLTGAHESDVARLSRYAANIGLAFQIVDDILDITSTRDVLG 247

Query: 448  KPAGSDLAKGNLTAPVIFALE 386
            K  G D+A   +T P ++ LE
Sbjct: 248  KTVGKDVAAQKMTYPRLWGLE 268



>pir|H84270|H84270 geranylgeranyl diphosphate synthase [imported] -
            Halobacterium sp. NRC-1>gb:AE005044_62692 Halobacterium
            sp. NRC-1 section 75 of 170 of the complete
            genome.>gb:AE004437_887611 Halobacterium sp. NRC-1
            complete genome.
          Length = 347

 Score =  122 bits (305), Expect = 3e-26
 Identities = 85/314 (27%), Positives = 137/314 (43%), Gaps = 17/314 (5%)
 Frame = -1

Query: 1060 AENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTK---------EHRRLAE 908
            AE   L  A+  I  AGGKR+RPA++ L +             +         +    A 
Sbjct: 32   AEPERLYEASRYILEAGGKRLRPAVLLLTAEALADTSDTPPYREFPDCIGGHVDVMSAAV 91

Query: 907  IIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANL----- 743
             IE+I + +LIHDD++D+ D+RRG   VH+ Y T  A+LAGD +++++   +        
Sbjct: 92   SIEVIQSFTLIHDDIMDDDDLRRGSPAVHREYDTETAILAGDTLYSKAFEIMLETGAPPE 151

Query: 742  ENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFS 563
              +  ++ +++       G+          DV  ++YL     KTA L AA+     +  
Sbjct: 152  RGLRAMRTLAETCTHICEGQAMDIDFETRGDVVTDEYLEMVELKTAVLYAAAATLPGLLL 211

Query: 562  GVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALET 383
              D    E +Y YG  +G +FQI DD+LD T  + +LGK  GSDL +   T   + A E 
Sbjct: 212  SADEETVEALYNYGLRVGQAFQIQDDVLDLTVPSAELGKQRGSDLVEDKTTIITLHAAEH 271

Query: 382  EPKLRDIIESEFCXXXXXXXXXXXVKR---CGGIXXXXXXXXXXXXXAIQNLECLPPSPF 212
               +  ++++E             V+     G I                +LE LP +  
Sbjct: 272  GVDVDGLLDAEDPADVTEAAVQAAVQALQDAGSIQYASDLAEDLVEEGKAHLEVLPENEA 331

Query: 211  RVAXEEMVQYNLER 170
            R   E++  Y +ER
Sbjct: 332  RHRLEQIADYLIER 345



>pir|AE1833|AE1833 geranylgeranyl diphosphate synthase [imported] -
            Nostoc sp.  (strain PCC 7120)>gb:BA000019_681205 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 309

 Score =  122 bits (305), Expect = 3e-26
 Identities = 79/234 (33%), Positives = 126/234 (53%), Gaps = 13/234 (5%)
 Frame = -1

Query: 1015 AGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMR 842
            AGGKR+RP L    S            T      A  +EMIHT SLIHDD+  +D  D R
Sbjct: 55   AGGKRLRPILCLATSEMMGGTIEIAMPT------ACAVEMIHTMSLIHDDLPAMDNDDYR 108

Query: 841  RGKETVHQIYGTRVAVLAGDFMFAQSSWYLA-----NLENIEVIKLISQVIKDFAS---- 689
            RG  T H++YG  +A+LAGD + A +  ++A     ++    V+++++++ +   +    
Sbjct: 109  RGMLTNHKVYGEDIAILAGDGLLAYAFEFVAIRTPESVPRDRVLQVVARLGRALGAAGLV 168

Query: 688  -GEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNL 512
             G++    S    D  +E       +KTA+L+ A      I +G  S   +++ +Y +N+
Sbjct: 169  GGQVVDLDSEGKSDTSLETLNFIHNHKTAALLEACVVCGGILAGASSENVQRLSRYSQNI 228

Query: 511  GLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE-TEPKLRDIIES 353
            GL+FQI+DDILD T + EQLGK AG DL    +T P ++ +E +  K + +IE+
Sbjct: 229  GLAFQIIDDILDITSTQEQLGKTAGKDLLAKKVTYPSLWGIEQSRVKAQQLIEA 282



>gb:AF425235_1799057 Abies grandis geranylgeranyl diphosphate synthase
            mRNA, complete cds.
          Length = 383

 Score =  121 bits (303), Expect = 5e-26
 Identities = 83/257 (32%), Positives = 129/257 (50%), Gaps = 13/257 (5%)
 Frame = -1

Query: 1117 EVVTDDLLTLNKNLQSIVGAENPV-LMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXX 941
            E +    + +N+ L   V    P  +  A      AGGKR+RP L               
Sbjct: 93   EYLRSKAMAVNEALDRAVPLRYPERIHEAMRYSLLAGGKRVRPVLCISACELVGGTEEVA 152

Query: 940  XXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQ 767
              T      A  +EMIHT SLIHDD+  +D  D RRGK T H+++G   A+LAGD + + 
Sbjct: 153  MPT------ACAMEMIHTMSLIHDDLPCMDNDDFRRGKPTNHKVFGEGTAILAGDALLSF 206

Query: 766  SSWYLA-----NLENIEVIKLISQVIKDFAS-----GEIKQASSLFDCDVGMEDYLIKSY 617
            +  ++A     ++    +++++S++ +   S     G++   +S  D  V ++       
Sbjct: 207  AFEHIAVSTSKSVGTDRILRVVSELGRTIGSQGLVGGQVADITSEGDASVDLDTLEWIHI 266

Query: 616  YKTASLIAASTKGAAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAG 437
            +KTA L+  S    AI SG      E++ +Y R++GL FQ+VDDILD T+S+++LGK AG
Sbjct: 267  HKTAVLLECSVMCGAIISGASDNEIERIQRYARSVGLLFQVVDDILDVTKSSKELGKTAG 326

Query: 436  SDLAKGNLTAPVIFALE 386
             DL     T P +  LE
Sbjct: 327  KDLISDKATYPKLMGLE 343



>gb:AE017164_395585 Prochlorococcus marinus subsp. marinus str.
            CCMP1375 section 4 of 6 of the complete
            genome.>gb:AE017126_1031254 Prochlorococcus marinus
            subsp. marinus str. CCMP1375 complete genome.
          Length = 300

 Score =  121 bits (303), Expect = 5e-26
 Identities = 84/253 (33%), Positives = 126/253 (49%), Gaps = 13/253 (5%)
 Frame = -1

Query: 1078 LQSIVGAENP-VLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEII 902
            L + +G E P  L  A      AGGKR+RP L                 T      A  I
Sbjct: 26   LDASLGPERPNQLREAMRYSLLAGGKRLRPILCLAACELTGSDSENAIST------AVAI 79

Query: 901  EMIHTASLIHDDV--LDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLA----NLE 740
            EMIHT SLIHDD+  +D  D+RRG+ T H++YG  +A+LAGD +  ++   +A    N+ 
Sbjct: 80   EMIHTMSLIHDDLPSMDNDDLRRGRPTNHKVYGEAIAILAGDALLTRAFEMVALRSPNVP 139

Query: 739  NIEVIKLISQV-----IKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGA 575
               ++K++ ++           G+++   S     V ++       +KT +L+ AS    
Sbjct: 140  KDRLLKVVGELSLVAGAPGLVGGQVEDLESEGKA-VDLDTLEFIHIHKTGALLKASVVCG 198

Query: 574  AIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIF 395
            A+  G D  +   +  Y + +GL+FQIVDDILD T S+E LGK AG DL     T P + 
Sbjct: 199  ALIGGADEDLLIALSTYAKGIGLAFQIVDDILDVTASSEVLGKTAGKDLLADKSTYPKLL 258

Query: 394  AL-ETEPKLRDII 359
             L E+  K +++I
Sbjct: 259  GLDESRKKAKELI 271



>gb:AE017149_391477 Helicobacter hepaticus ATCC 51449 section 6 of 6
           of the complete genome.>gb:AE017125_1025739 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 303

 Score =  121 bits (303), Expect = 5e-26
 Identities = 65/178 (36%), Positives = 107/178 (60%)
 Frame = -1

Query: 919 RLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSWYLANLE 740
           R+  +IEMI +ASL+HDDV+DES  RRG  +++  +G + A++ GD +++++ + L+ L+
Sbjct: 56  RVCALIEMIQSASLLHDDVIDESLTRRGIPSINATFGNKNAIMLGDVLYSKAFYELSCLD 115

Query: 739 NIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSG 560
            + + + +S  +   + GEI+            E Y+     KTA+LI A+ +  AI  G
Sbjct: 116 -VRLAQSVSSAVVRLSVGEIEDVKLSLSFHTDKERYIRMCADKTAALIVAAAECGAILKG 174

Query: 559 VDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFALE 386
           ++  I      YG NLG++FQI+DDILD TQ ++ LGKP+ SD  +G  T P ++  E
Sbjct: 175 LNKNIYRI---YGENLGIAFQIIDDILDITQDSQTLGKPSMSDFKEGKTTLPYMYLYE 229



>gb:AE017290_433137 Leptospira interrogans serovar Copenhageni str.
            Fiocruz L1-130, chromosome I, section 4 of 14 of the
            complete sequence.>gb:AE016823_1066148 Leptospira
            interrogans serovar Copenhageni str. Fiocruz L1-130,
            chromosome I, complete sequence.
          Length = 319

 Score =  120 bits (302), Expect = 7e-26
 Identities = 78/244 (31%), Positives = 128/244 (52%), Gaps = 1/244 (0%)
 Frame = -1

Query: 1114 VVTDDLLT-LNKNLQSIVGAENPVLMSAAEQIFSAGGKRMRPALVFLVSRXXXXXXXXXX 938
            V+ D L+   +K L++I+  +  +L         +GGKR+RP L + + +          
Sbjct: 5    VLKDSLIRKFDKKLETIIREDLKILSEIKTYTIQSGGKRIRPILHYCLCQLLGYSG---- 60

Query: 937  XTKEHRRLAEIIEMIHTASLIHDDVLDESDMRRGKETVHQIYGTRVAVLAGDFMFAQSSW 758
              K    +  I E+IH ASL+HDDV+DE++ RRG ++V   +G + A+LAGD++ A    
Sbjct: 61   --KHWLDVGAIAELIHAASLLHDDVVDEAETRRGLQSVGSKFGNKTAILAGDYLLACGID 118

Query: 757  YLANLENIEVIKLISQVIKDFASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKG 578
            +L  L   E++++ +QVIKD +  E+ Q     +  + ++ Y    Y KTASL A     
Sbjct: 119  HLNGLGYPELMEVFTQVIKDLSVSELIQMEWEKNPKITLDIYNKIIYGKTASLFAVVCVS 178

Query: 577  AAIFSGVDSGISEQMYQYGRNLGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVI 398
            A I S  +    +++ Q+G +LG  FQ  DD +D+  SA + GK    D   G  T P++
Sbjct: 179  AGILSDKNEKEKKKLRQFGIDLGSFFQKKDDAIDYFTSASKSGKIPLKDFYNGLYTHPIL 238

Query: 397  FALE 386
              L+
Sbjct: 239  LLLD 242



>gb:AE017180_400061 Geobacter sulfurreducens PCA, complete genome.
          Length = 297

 Score =  120 bits (302), Expect = 7e-26
 Identities = 75/234 (32%), Positives = 123/234 (52%), Gaps = 14/234 (5%)
 Frame = -1

Query: 1015 AGGKRMRPALVFLVSRXXXXXXXXXXXTKEHRRLAEIIEMIHTASLIHDDV--LDESDMR 842
            AGGKR+RP L+                       A  +EMIHT SLIHDD+  +D+ D R
Sbjct: 42   AGGKRVRPILMLAACDAVGGDTALALPA------ACAMEMIHTYSLIHDDLPAMDDDDFR 95

Query: 841  RGKETVHQIYGTRVAVLAGD------FMFAQSSWYLANLENIEVIKLISQVI-----KDF 695
            RG+ T H+++G  +A+LAGD      F+   S  Y A + +  ++ +I ++      +  
Sbjct: 96   RGRPTNHKVFGEAIAILAGDALLTEAFILISSPSYAAAVGSDRLLPVIHEIALCAGSRGM 155

Query: 694  ASGEIKQASSLFDCDVGMEDYLIKSYYKTASLIAASTKGAAIFSGVDSGISEQMYQYGRN 515
              G++    S  + ++ +         KT +LI AS K  A+  G ++   + + +YG  
Sbjct: 156  VGGQVVDMESEGNKEIDLATVQYIHTRKTGALIKASIKAGAVLGGANADAVKAVTRYGEA 215

Query: 514  LGLSFQIVDDILDFTQSAEQLGKPAGSDLAKGNLTAPVIFAL-ETEPKLRDIIE 356
            +GL+FQI DDILD   + EQ+GK AGSD A+G  T P +  L E++ + +++++
Sbjct: 216  IGLAFQIADDILDIEGTTEQIGKDAGSDEARGKATYPAVLGLAESKRRAQELLD 269


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,656,872,900
Number of Sequences: 1806583
Number of extensions: 35079503
Number of successful extensions: 98166
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 89816
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 96928
length of database: 581,917,975
effective HSP length: 130
effective length of database: 347,062,185
effective search space used: 149236739550
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)