BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13960
         (1096 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T45834|T45834 hypothetical protein F2K15.150 - Arabidopsis t...   194   3e-48   Arabidopsis thaliana [mouse-ear cress]
gb:AY817014_1628696 Arabidopsis thaliana Abl interactor-like pro...   182   1e-44   
gb:AB006701_1509929 Arabidopsis thaliana genomic DNA, chromosome...   177   3e-43   
gb:AB017067_1513412 Arabidopsis thaliana genomic DNA, chromosome...   146   6e-34   
gb:AY084395_1569485 Arabidopsis thaliana clone 106836 mRNA, comp...   145   2e-33   
gb:AP003933_1835460 Oryza sativa (japonica cultivar-group) genom...   139   1e-31   
gb:AP001539_1821286 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:AK118876_1816830 Arabidopsis thaliana At2g46225 mRNA for unkn...   119   1e-25   
gb:AC005397_1532653 Arabidopsis thaliana chromosome 2 clone T3F1...   119   1e-25   
gb:AP002819_1822898 Oryza sativa (japonica cultivar-group) genom...   110   6e-23   
pir|B84900|B84900 hypothetical protein At2g46220 [imported] - Ar...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC137608_1743474 Oryza sativa (japonica cultivar-group) chrom...   101   2e-20   
gb:AP003274_1826972 Oryza sativa (japonica cultivar-group) genom...    63   9e-09   
gb:AP003256_1826462 Oryza sativa (japonica cultivar-group) genom...    54   7e-06   
gb:AK118112_1816107 Arabidopsis thaliana At3g49290 mRNA for unkn...    47   5e-04   
gb:AE014297_1139492 Drosophila melanogaster chromosome 3R, compl...    42   0.028   
gb:AE016827_343894 Mannheimia succiniciproducens MBEL55E, comple...    36   1.6     
gb:AE006132_215813 Pasteurella multocida subsp. multocida str. P...    36   1.6     
gb:BX950851_842565 Erwinia carotovora subsp. atroseptica SCRI104...    35   2.0     
sp|Q9VM33|EFGM_DROME|EFGM_DROME Probable elongation factor G, mitochondrial...    35   2.0     Drosophila melanogaster
gb:CR382126_1658379 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   3.5     
gb:AY296057_2525448 Danio rerio Bcl9-2 mRNA, complete cds.             34   4.5     
gb:AF465545_2261521 Sunflower mosaic virus polyprotein gene, par...    34   4.5     
gb:AC116551_1206361 Dictyostelium discoideum chromosome 2 map co...    34   4.5     
gb:MHO416752_144062 Mycoplasma hominis uvrA gene (partial), ORF1...    34   4.5     
pir|H90113|H90113 nucleolar snRNP protein [imported] - Guillardi...    34   4.5     Guillardia theta
sp|P44446|LCFH_HAEIN|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase ...    34   4.5     Haemophilus influenzae
gb:BC058068_2552256 Danio rerio serine/arginine repetitive matri...    34   5.9     
gb:HSU15131_2022419 Human p126 (ST5) mRNA, complete cds.               34   5.9     
gb:HSA400879_2004887 Homo sapiens ST5 gene for suppression of tu...    34   5.9     
gb:HS1054A22_1996623 Human DNA sequence from clone RP5-1054A22 o...    33   7.7     
gb:HS1054A22_1996620 Human DNA sequence from clone RP5-1054A22 o...    33   7.7     
gb:HS1054A22_1996619 Human DNA sequence from clone RP5-1054A22 o...    33   7.7     
gb:BC036655_1981990 Homo sapiens suppression of tumorigenicity 5...    33   7.7     
gb:AB051542_1868054 Homo sapiens mRNA for KIAA1755 protein, part...    33   7.7     
gb:CR380951_1649988 Candida glabrata strain CBS138 chromosome E ...    33   7.7     
gb:BA000028_696688 Oceanobacillus iheyensis HTE831 DNA, complete...    33   7.7     
gb:CR378664_93833 Photobacterium profundum SS9; segment 2/12.          33   7.7     


>pir|T45834|T45834 hypothetical protein F2K15.150 - Arabidopsis
            thaliana>gb:ATF2K15_1550535 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F2K15.>gb:AY817013_1628695
            Arabidopsis thaliana Abl interactor-like protein-2
            (ABIL2) mRNA, complete cds.
          Length = 312

 Score =  194 bits (493), Expect = 3e-48
 Identities = 122/305 (40%), Positives = 166/305 (54%), Gaps = 10/305 (3%)
 Frame = -1

Query: 1024 AHQERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVY 845
            A  E +NYDE+ MQ     +D L+DLKNLR Q YSAAEYFE+SY  D+ KQ +V+T+K Y
Sbjct: 3    ASHEASNYDEVSMQQSMLFSDGLQDLKNLRAQLYSAAEYFELSYTTDDKKQIVVETLKDY 62

Query: 844  VSKAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQS 665
              KA++NTVDHLGS+  K++ F+DEKV E S TELR SC+EQR R CQE++D  G  QQS
Sbjct: 63   AVKALVNTVDHLGSVTYKVNDFIDEKVDEVSETELRVSCIEQRLRMCQEYMDHEGRSQQS 122

Query: 664  FVTVLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQNQHHQLQQGFLAT 485
             V   PK+ K  I P  ++ T ++L K         + Y G      +  +Q +    AT
Sbjct: 123  LVIDTPKFHKRYILPAGEIMTATNLEK---------LKYFGSSLEDADDWNQFRNAVRAT 173

Query: 484  KTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRLKRSES 305
              +  P   R+    + +  Q       F+FT     KE D R   SVSP RF L RS S
Sbjct: 174  IRETPPPPVRKSTSQSSSPRQPPQRSATFSFTSTIPKKEQDKR---SVSPHRFPLLRSGS 230

Query: 304  YIHR-----SPPFSPCDLRQFRP-----QPQRTISLPTKPAKPTSQNMKKLQSNKTKRTL 155
               R     S P +P   R   P     +P+R+ S+     K   +  ++ Q +K+KR L
Sbjct: 231  VATRKSASISRPTTPSKSRSITPIRYPSEPRRSASVRVAFEKDNQKETEQQQPSKSKRLL 290

Query: 154  QSLLS 140
            ++LLS
Sbjct: 291  KALLS 295



>gb:AY817014_1628696 Arabidopsis thaliana Abl interactor-like
            protein-3 (ABIL3) mRNA, complete cds.>gb:BT011734_1641256
            Arabidopsis thaliana At5g24310 gene, complete cds.
          Length = 321

 Score =  182 bits (461), Expect = 1e-44
 Identities = 126/310 (40%), Positives = 173/310 (55%), Gaps = 17/310 (5%)
 Frame = -1

Query: 1018 QERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVS 839
            +E +NYDEI MQ     +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  
Sbjct: 11   REASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAI 70

Query: 838  KAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV 659
            KA++NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V
Sbjct: 71   KALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLV 130

Query: 658  TVLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQNQHHQLQQGFLATKT 479
               PK+ K    P  ++    +L K       +   + G D+ +Q ++       +    
Sbjct: 131  IDTPKFHKRYFLPSGEIKRGGNLAKLKN----VEGSFDGEDDWNQFRN------AVRATI 180

Query: 478  KEHPTLPRRR--LQNNLTFTQTSPNPPA-FTFTRAASS--KELDSRGKLSVSPLRFRLKR 314
            +E P  P R+  LQ+    +Q  P   A F+F+  A++  KE D R   +VSP RF L R
Sbjct: 181  RETPPPPVRKPILQSP---SQRKPQRSATFSFSSIATAPKKEQDKR---AVSPHRFPLLR 234

Query: 313  SESYIHR----SPPFSPCDLRQFRPQPQRTISLPTKPA--------KPTSQNMKKLQSNK 170
            S S   R    S P +P   R   P P+R  S P + A        +   +   + Q +K
Sbjct: 235  SGSVAIRPSSISRPTTPSKSRAVTPTPKRYPSEPRRSASVRVAFEKEAQKEPEHQQQPSK 294

Query: 169  TKRTLQSLLS 140
            +KR L++LLS
Sbjct: 295  SKRLLKALLS 304



>gb:AB006701_1509929 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MOP9.
          Length = 333

 Score =  177 bits (449), Expect = 3e-43
 Identities = 123/311 (39%), Positives = 167/311 (53%), Gaps = 18/311 (5%)
 Frame = -1

Query: 1018 QERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVS 839
            +E +NYDEI MQ     +DSLKDLKNLR Q YSAAEYFE+SY  DE KQ +V+T+K Y  
Sbjct: 11   REASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAI 70

Query: 838  KAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFV 659
            KA++NTVDHLGS+  K++ F+DEKV E + TELR SC+EQR R CQE++D  G  QQS V
Sbjct: 71   KALVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYMDHEGRSQQSLV 130

Query: 658  TVLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQ--NQHHQLQQGFLAT 485
               PK+ K    P  ++    +L K       +   + G D+ +Q  N      +     
Sbjct: 131  IDTPKFHKRYFLPSGEIKRGGNLAKLKN----VEGSFDGEDDWNQFRNAVRATIRETPPP 186

Query: 484  KTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDS-RGKL---SVSPLRFRLK 317
              +  P L +     +L+ T+TS     F       +KE  S  GK+   +VSP RF L 
Sbjct: 187  PVRYSPVLIKTDTSVSLS-TETSTFSNLFVLLYRHRTKERTSVHGKIDKRAVSPHRFPLL 245

Query: 316  RSESYIHR----SPPFSPCDLRQFRPQPQRTISLPTKPA--------KPTSQNMKKLQSN 173
            RS S   R    S P +P   R   P P+R  S P + A        +   +   + Q +
Sbjct: 246  RSGSVAIRPSSISRPTTPSKSRAVTPTPKRYPSEPRRSASVRVAFEKEAQKEPEHQQQPS 305

Query: 172  KTKRTLQSLLS 140
            K+KR L++LLS
Sbjct: 306  KSKRLLKALLS 316



>gb:AB017067_1513412 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MJC20.>gb:AY817015_1628697 Arabidopsis thaliana
            Abl interactor-like protein-4 (ABIL4) mRNA, complete
            cds.>gb:AK175528_1817516 Arabidopsis thaliana mRNA,
            complete cds, clone: RAFL21-94-L12.>gb:AK175563_1817551
            Arabidopsis thaliana mRNA, complete cds, clone:
            RAFL21-98-K04.>gb:AK176699_1818687 Arabidopsis thaliana
            mRNA, complete cds, clone:
            RAFL25-24-D06.>gb:AK176912_1818900 Arabidopsis thaliana
            mRNA, complete cds, clone: RAFL25-48-L13.
          Length = 279

 Score =  146 bits (369), Expect = 6e-34
 Identities = 95/264 (35%), Positives = 138/264 (52%), Gaps = 1/264 (0%)
 Frame = -1

Query: 1015 ERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK 836
            + +N+DE+ M+     +++LKDLKNLRKQ YSAAEYFE SYGK EHK+ +++T+K Y +K
Sbjct: 13   QSSNHDELFMKQTLQFSETLKDLKNLRKQLYSAAEYFETSYGKAEHKETVIETLKEYAAK 72

Query: 835  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT 656
            AV+NTVDHLGS++ K ++FL +    FS T LR S +EQR R C++++ ++G  Q   + 
Sbjct: 73   AVVNTVDHLGSVSDKFNSFLSDNSTHFSTTHLRLSSLEQRMRLCRDYMGKSGTHQHLLLF 132

Query: 655  VLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQNQHHQLQQGFLATKTK 476
              P++ K    P     T    G  + R          R  + +N  +  ++   A KT 
Sbjct: 133  QYPRHHKRYFFPQQGRGTSFSAGDDSHRFTSAV-----RSTILENLPNTARK---ANKTG 184

Query: 475  EHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRLKRSESYIH 296
                 P   + NN+     +PN                   K S SP+RF L RS S + 
Sbjct: 185  SFSFAP--IVHNNI--NNRTPN-------------------KRSNSPMRFPLLRSGSLLK 221

Query: 295  R-SPPFSPCDLRQFRPQPQRTISL 227
            R S P  P       P+PQR IS+
Sbjct: 222  RSSSPSQPKKPPLALPEPQRAISV 245



>gb:AY084395_1569485 Arabidopsis thaliana clone 106836 mRNA, complete
            sequence.
          Length = 279

 Score =  145 bits (365), Expect = 2e-33
 Identities = 94/264 (35%), Positives = 138/264 (52%), Gaps = 1/264 (0%)
 Frame = -1

Query: 1015 ERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSK 836
            + +N+DE+ M+     +++LKDLKNLRKQ YSAAEYFE SYGK+EHK+ +++T+K Y +K
Sbjct: 13   QSSNHDELFMKQTLQFSETLKDLKNLRKQLYSAAEYFETSYGKEEHKETVIETLKEYAAK 72

Query: 835  AVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVT 656
            AV+NTVDHLGS++ K ++FL +    FS T LR S +EQR R C++++ ++G  Q   + 
Sbjct: 73   AVVNTVDHLGSVSDKFNSFLSDNSTHFSTTHLRLSSLEQRMRLCRDYMGKSGTHQHLLLF 132

Query: 655  VLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQNQHHQLQQGFLATKTK 476
              P++ K    P     T    G  + R          R  + +N  +  ++   A KT 
Sbjct: 133  QYPRHHKRYFFPQQGRGTSFSAGDDSHRFTSAV-----RSTILENLPNTARK---ANKTG 184

Query: 475  EHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRLKRSESYIH 296
                 P   + NN+     +PN                   K S SP+RF L  S S + 
Sbjct: 185  SFSFAP--IVHNNI--NNRTPN-------------------KRSNSPMRFPLLSSGSLLK 221

Query: 295  R-SPPFSPCDLRQFRPQPQRTISL 227
            R S P  P       P+PQR IS+
Sbjct: 222  RSSSPSQPKKPPLPLPEPQRAISV 245



>gb:AP003933_1835460 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBa0066C06.
          Length = 323

 Score =  139 bits (350), Expect = 1e-31
 Identities = 95/301 (31%), Positives = 147/301 (48%), Gaps = 2/301 (0%)
 Frame = -1

Query: 1036 GTELAHQERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDT 857
            G  +A    +  +E+ MQ     +D++KDLK L+ Q YSAAEYFE++Y +++ KQE+++ 
Sbjct: 12   GVGIAGMSSSTLEEVQMQETLIFSDTIKDLKMLKSQLYSAAEYFELAYTQEDDKQEVMNN 71

Query: 856  MKVYVSKAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGI 677
            +K Y  KA++NTVDHLGSI+ K+ + +D++  E   T LR SC+ QR++  Q  +D+ G+
Sbjct: 72   LKEYSVKALVNTVDHLGSISFKVSSLIDQRFDEVDDTNLRVSCIHQRAQVSQACMDKEGL 131

Query: 676  EQQSFVTVLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMH--QNQHHQLQ 503
             QQS V   PKY K  I P  D                M    P   EM   +N+  Q+Q
Sbjct: 132  SQQSLVITAPKYHKRYILPAGD--------------GSMPNAVPNFSEMRKAKNRAAQMQ 177

Query: 502  QGFLATKTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFR 323
            Q F A    +     ++   + L     +P+       RA SS         +  P +  
Sbjct: 178  QVFSAAAASQAKAKEKQPSFSKLRSIARAPS------QRARSSSPAQRPPSENTIPTKRA 231

Query: 322  LKRSESYIHRSPPFSPCDLRQFRPQPQRTISLPTKPAKPTSQNMKKLQSNKTKRTLQSLL 143
             KRSES I R+ P +            R+ SLP KP+   + +++        + L S+ 
Sbjct: 232  DKRSESPIPRTTPLT------------RSGSLPQKPSLLKTSSVRVQMHTSEHKKLASVR 279

Query: 142  S 140
            S
Sbjct: 280  S 280



>gb:AP001539_1821286 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0708G02.
          Length = 317

 Score =  121 bits (304), Expect = 2e-26
 Identities = 96/295 (32%), Positives = 143/295 (48%), Gaps = 11/295 (3%)
 Frame = -1

Query: 988 MQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHL 809
           +Q     +DSLKDL+NLR Q YSAAEYFEV Y  +  K  ++ ++K Y  +A+++TVDHL
Sbjct: 30  LQEGLLFSDSLKDLRNLRSQLYSAAEYFEVFYRNNSQKSTVMTSLKDYTVEALVSTVDHL 89

Query: 808 GSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHC 629
           G ++ K+D  + E+  E + TE R S VEQR R CQ+ ID+ G  QQS +   PKY +  
Sbjct: 90  GFVSYKVDNLVKERSDEVNETEFRVSSVEQRVRICQQTIDQEGRSQQSLLIRAPKYHRRY 149

Query: 628 INPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQNQHHQLQQGFLATKTKEHPTLP--- 458
           I PG+D+  V          P  +  +  R +MH++Q      G  +T        P   
Sbjct: 150 ILPGTDI--VESAIHPVSEPPRYSRQHMSR-KMHKSQSISTPVGRQSTMRSARSPSPSAR 206

Query: 457 -----RRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRLKRSESYIHR 293
                 R L  +      SP+P      +  S++  ++R   S  P    L RS + + R
Sbjct: 207 GTHHRSRSLSPSRKARAKSPSP------QIISTQTKETRAG-SPIPNSNPLARSAT-VAR 258

Query: 292 SPPFSPCDLRQFRPQPQRTISLPTKPAKPTSQN---MKKLQSNKTKRTLQSLLSF 137
            PP  P   RQ   Q     S   +  K +S+    +K L + +  R  +SL S+
Sbjct: 259 RPPVHPKHFRQTSMQLHSDWSNHKEQEKSSSKGRGFLKSLLTRRRWRNDESLYSY 313



>gb:AK118876_1816830 Arabidopsis thaliana At2g46225 mRNA for unknown
            protein, complete cds, clone: RAFL21-20-O20.
          Length = 298

 Score =  119 bits (297), Expect = 1e-25
 Identities = 56/129 (43%), Positives = 83/129 (64%)
 Frame = -1

Query: 1000 DEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINT 821
            DE+ M+   +   +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N 
Sbjct: 16   DEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNA 75

Query: 820  VDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY 641
            VDHLG++A+KL    D +  + S  E+R SCV Q+  +C+ +ID+ G+ QQ  + V+P +
Sbjct: 76   VDHLGTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLH 135

Query: 640  LKHCINPGS 614
             KH I P S
Sbjct: 136  HKHYILPNS 144



>gb:AC005397_1532653 Arabidopsis thaliana chromosome 2 clone T3F17 map
            CIC02E07, complete sequence.>gb:AY085146_1570227
            Arabidopsis thaliana clone 13319 mRNA, complete
            sequence.>gb:AY817012_1628694 Arabidopsis thaliana Abl
            interactor-like protein-1 (ABIL1) mRNA, complete cds.
          Length = 298

 Score =  119 bits (297), Expect = 1e-25
 Identities = 56/129 (43%), Positives = 83/129 (64%)
 Frame = -1

Query: 1000 DEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINT 821
            DE+ M+   +   +L++LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N 
Sbjct: 16   DEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNA 75

Query: 820  VDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY 641
            VDHLG++A+KL    D +  + S  E+R SCV Q+  +C+ +ID+ G+ QQ  + V+P +
Sbjct: 76   VDHLGTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQQQLLAVIPLH 135

Query: 640  LKHCINPGS 614
             KH I P S
Sbjct: 136  HKHYILPNS 144



>gb:AP002819_1822898 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0501G01.
          Length = 306

 Score =  110 bits (274), Expect = 6e-23
 Identities = 72/226 (31%), Positives = 112/226 (49%), Gaps = 10/226 (4%)
 Frame = -1

Query: 1000 DEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINT 821
            DE  M+   +   +L++LKNLR Q YSA+EY E SY   E KQ ++D +K Y  +A++N 
Sbjct: 34   DEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLDNLKDYAVRALVNA 93

Query: 820  VDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY 641
            VDHLG++A KL    +++  E S  EL+ +C+ Q+  +CQ + D+ GI QQ       ++
Sbjct: 94   VDHLGTVAYKLTDLYEQQASEVSTLELKVACLNQQVLTCQTYTDKEGIRQQQMTGTATRH 153

Query: 640  LKHCINPG---------SDVDTVSDLGKSNRRSP-MMTILYPGRDEMHQNQHHQLQQGFL 491
             KH I P          S++ T +D+    R  P   T+ +    E +   +   Q  F+
Sbjct: 154  HKHYIVPTLANKRMQAFSEMQTDADIDSRPRPYPSAKTLFWHLASEKNSKTNGARQSEFV 213

Query: 490  ATKTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRG 353
              +TK   T P  R +       TSP P       A+S   + + G
Sbjct: 214  LEETK--ATKPASRGKE----PSTSPLPKHLQTNLASSDFAMHNVG 253



>pir|B84900|B84900 hypothetical protein At2g46220 [imported] -
           Arabidopsis thaliana
          Length = 550

 Score =  102 bits (254), Expect = 1e-20
 Identities = 53/127 (41%), Positives = 75/127 (59%), Gaps = 13/127 (10%)
 Frame = -1

Query: 955 KDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFL 776
           K+LKNLR Q YSAA+Y E SY   E KQ ++D +K Y  KA++N VDHLG++A+KL    
Sbjct: 239 KELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHLGTVASKLTDLF 298

Query: 775 DEKVGEFSATELRFSCV-------------EQRSRSCQEFIDRNGIEQQSFVTVLPKYLK 635
           D +  + S  E+R SCV              Q+  +C+ +ID+ G+ QQ  + V+P + K
Sbjct: 299 DHQNSDISTMEMRASCVSQAISLKVCVCSFHQQLLTCRTYIDKEGLRQQQLLAVIPLHHK 358

Query: 634 HCINPGS 614
           H I P S
Sbjct: 359 HYILPNS 365



>gb:AC137608_1743474 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0009C07, complete sequence.
          Length = 302

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/129 (40%), Positives = 77/129 (59%)
 Frame = -1

Query: 1000 DEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINT 821
            DE  M+   +   +L++LKNLR Q YSA+EY E SY   E KQ +++ +K Y  +AV+N 
Sbjct: 25   DEASMERSKSFVKALQELKNLRPQLYSASEYCEKSYLHSEQKQMVLENLKDYAVRAVVNA 84

Query: 820  VDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKY 641
            VDHLG++A KL    +++  E S  EL+ + + Q+  +CQ F DR G+ QQ       K+
Sbjct: 85   VDHLGTVAYKLTDLFEQQASEVSTVELKVARLNQQILTCQIFTDRAGLRQQKIGGTTFKH 144

Query: 640  LKHCINPGS 614
             KH I P +
Sbjct: 145  HKHYILPST 153



>gb:AP003274_1826972 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0512C01.
          Length = 254

 Score = 63.2 bits (152), Expect = 9e-09
 Identities = 28/89 (31%), Positives = 60/89 (67%)
 Frame = -1

Query: 961 SLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDT 782
           +L++LK+LR Q +  A+  E ++   E K+ ++++ K Y+  A++  +DHLG++++KL+ 
Sbjct: 41  ALRELKDLRSQLHQTADCCEKAFLDTEKKKLILESTKGYICDAIVAVIDHLGTVSSKLEQ 100

Query: 781 FLDEKVGEFSATELRFSCVEQRSRSCQEF 695
            L EK+ E + TE + + ++QR  +C+++
Sbjct: 101 QLQEKI-EITQTEKKLNFLKQRLLTCEQY 128



>gb:AP003256_1826462 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0460E08.
          Length = 142

 Score = 53.5 bits (127), Expect = 7e-06
 Identities = 25/78 (32%), Positives = 51/78 (65%)
 Frame = -1

Query: 952 DLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAAKLDTFLD 773
           +LK+LR Q +  A+  E ++   E K+ ++++ K Y+  A++  +DHLG++++KL+  L 
Sbjct: 60  ELKDLRSQLHQTADCCEKAFLDTEKKKLILESTKGYICDAIVAVIDHLGTVSSKLEQQLQ 119

Query: 772 EKVGEFSATELRFSCVEQ 719
           EK+ E + TE + + ++Q
Sbjct: 120 EKI-EITQTEKKLNFLKQ 136



>gb:AK118112_1816107 Arabidopsis thaliana At3g49290 mRNA for unknown
           protein, complete cds, clone: RAFL19-38-C19.
          Length = 180

 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 41/124 (33%), Positives = 59/124 (47%), Gaps = 11/124 (8%)
 Frame = -1

Query: 478 KEHPTLPRRRLQNNLTFTQTSPNPPA-FTFTRAASSKELDSRGKLSVSPLRFRLKRSESY 302
           +E P  P R+  +  +  +  P   A F+FT     KE D R   SVSP RF L RS S 
Sbjct: 43  RETPPPPVRKSTSQSSSPRQPPQRSATFSFTSTIPKKEQDKR---SVSPHRFPLLRSGSV 99

Query: 301 IHR-----SPPFSPCDLRQFRP-----QPQRTISLPTKPAKPTSQNMKKLQSNKTKRTLQ 152
             R     S P +P   R   P     +P+R+ S+     K   +  ++ Q +K+KR L+
Sbjct: 100 ATRKSASISRPTTPSKSRSITPIRYPSEPRRSASVRVAFEKDNQKETEQQQPSKSKRLLK 159

Query: 151 SLLS 140
           +LLS
Sbjct: 160 ALLS 163



>gb:AE014297_1139492 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003703_1221485 Drosophila melanogaster
            chromosome 3R, section 41 of 118 of the complete
            sequence.>gb:AF151115_1245426 Drosophila melanogaster Abl
            tyrosine kinase-interacting protein mRNA, complete
            cds.>gb:AY051877_1290471 Drosophila melanogaster LD37010
            full length cDNA.
          Length = 473

 Score = 41.6 bits (96), Expect = 0.028
 Identities = 48/236 (20%), Positives = 90/236 (38%), Gaps = 12/236 (5%)
 Frame = -1

Query: 1039 MGTELAHQERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVD 860
            M TE      N  DE+    RT I D  + L++        A+Y E +Y + ++K+  ++
Sbjct: 1    MLTETPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALE 60

Query: 859  TMKVYVSKAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDR-- 686
              K Y ++++ +    + ++A      L+ +  +    E + + + Q     +E + R  
Sbjct: 61   ATKNYTTQSLASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARRE 120

Query: 685  ------NGIEQQSFVTVLP----KYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRD 536
                  N +  + F  V P    K +K+   P  D   + ++G     +    +    R 
Sbjct: 121  IGVLTANKVSSRQFKIVAPINPEKPIKYVRKP-IDYSMLDEIGHGINSAQHSQVRQKHRG 179

Query: 535  EMHQNQHHQLQQGFLATKTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKE 368
              H +    L        T + PT P+     N   T T     + T T   SS+E
Sbjct: 180  SSHGSVQSLLPPSVGPPPTTKPPTPPQMSRAGN---TGTLGKSVSNTGTLGKSSRE 232



>gb:AE016827_343894 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 592

 Score = 35.8 bits (81), Expect = 1.6
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 2/111 (1%)
 Frame = -1

Query: 970 ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQEL--VDTMKVYVSKAVINTVDHLGSIA 797
           ITD +K+L       Y A +Y E   GKD+  +++  +   K YVS  ++ + + L   A
Sbjct: 452 ITDRIKELMKTSNGKYIAPQYIEGKLGKDKFIEQIAVIADAKKYVSALIVPSFEALEDYA 511

Query: 796 AKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPK 644
            +L+    +++     +E+     E+R    Q+ +     EQ    T+LP+
Sbjct: 512 KQLNIKYQDRLELIKHSEI-IKLFEKRLEELQQELAH--FEQVKKFTLLPQ 559



>gb:AE006132_215813 Pasteurella multocida subsp. multocida str. Pm70
           section 99 of 204 of the complete
           genome.>gb:AE004439_1118543 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 606

 Score = 35.8 bits (81), Expect = 1.6
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 2/111 (1%)
 Frame = -1

Query: 970 ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQEL--VDTMKVYVSKAVINTVDHLGSIA 797
           ITD +K+L       Y A +Y E   GKD+  +++  +   K YVS  ++   + L   A
Sbjct: 459 ITDRIKELMKTSNGKYIAPQYIETKVGKDKFIEQIAVIADAKKYVSALIVPCFNSLEEYA 518

Query: 796 AKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPK 644
            +L+    +++     +++     EQR    Q+  +    EQ    T+LP+
Sbjct: 519 KQLNIKYHDRLELIKHSDI-LQMFEQRINDLQK--ELPSFEQIKKFTLLPQ 566



>gb:BX950851_842565 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 601

 Score = 35.4 bits (80), Expect = 2.0
 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 3/111 (2%)
 Frame = -1

Query: 970 ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQE---LVDTMKVYVSKAVINTVDHLGSI 800
           IT+ LKDL       Y A ++ E + G+D   ++   + DT K YVS  ++   D L   
Sbjct: 459 ITERLKDLMKTSGGKYIAPQHLEGTLGQDRFIEQVAIIADTRK-YVSALIVPCFDALEEY 517

Query: 799 AAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLP 647
           A  ++    +++     + +     EQR R  Q+ + R  +EQ    T+LP
Sbjct: 518 AHSINLKYHDRLELLRHSHI-IELFEQRLREMQKELSR--VEQVKKFTLLP 565



>sp|Q9VM33|EFGM_DROME Probable elongation factor G, mitochondrial
            precursor (mEF-G).>gb:AE014134_1127982 Drosophila
            melanogaster chromosome 2L, complete
            sequence.>gb:AE003616_1218089 Drosophila melanogaster
            chromosome 2L, section 25 of 83 of the complete sequence.
          Length = 745

 Score = 35.4 bits (80), Expect = 2.0
 Identities = 36/164 (21%), Positives = 73/164 (44%), Gaps = 3/164 (1%)
 Frame = -1

Query: 1018 QERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVS 839
            + + N++   +Q    +  + K + +L ++    A YFE  +G D    E+   M+V   
Sbjct: 187  RSKMNHNAAFIQLPIGVESNCKGIVDLVRE---KAIYFEGEHGMDIRLDEIPQDMRVESL 243

Query: 838  KAVINTVDHLGSIAAKL-DTFLDEK--VGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQ 668
            +     ++HL +    L + FL+EK    +     LR +C+   +R+    +    ++ +
Sbjct: 244  ERRQELIEHLSNADETLGELFLEEKPFTEDDIKAALRRTCI---NRTFTPVLVGTALKNK 300

Query: 667  SFVTVLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRD 536
                +L   L +  NPG +V+ +  + K   + P   +L P RD
Sbjct: 301  GVQPLLDAVLDYLPNPG-EVENLGFIEKEG-QDPEKVVLNPARD 342



>gb:CR382126_1658379 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 1045

 Score = 34.7 bits (78), Expect = 3.5
 Identities = 24/77 (31%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
 Frame = +3

Query: 588 PKSDTVSTSEPGLIQCFRYLGKTVTNDCCSMPFRSMNSWHDLDLCSTQENRSSVAENSP- 764
           P++D+   + P +IQ        +T    S P ++  S HDL    +Q+N S+++ ++  
Sbjct: 361 PRADSKVLASPVMIQ---NAANNLTPSGLSFPQKTDISTHDLLKIVSQDNVSAISSSTSI 417

Query: 765 --TFSSKKVSSLAAIEP 809
             +FS K VSSL+ I+P
Sbjct: 418 HKSFSPKSVSSLSRIQP 434



>gb:AY296057_2525448 Danio rerio Bcl9-2 mRNA, complete cds.
          Length = 1530

 Score = 34.3 bits (77), Expect = 4.5
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 11/78 (14%)
 Frame = -1

Query: 652  LPKYLKHC-INPGSDVDTVSDLGKSNRRSPMMTILYPG----------RDEMHQNQHHQL 506
            LP +  HC + PG  +  +   G  +    M  + +PG          + ++ Q  HHQ 
Sbjct: 1367 LPLHPSHCGMRPGMGMPQIGSRGMGSGGG-MGPMCHPGHMMGRTGMSPQQQLQQQHHHQQ 1425

Query: 505  QQGFLATKTKEHPTLPRR 452
            QQ  +A    +HP+ P R
Sbjct: 1426 QQAMMANNLLQHPSHPPR 1443



>gb:AF465545_2261521 Sunflower mosaic virus polyprotein gene, partial
            cds.
          Length = 824

 Score = 34.3 bits (77), Expect = 4.5
 Identities = 32/132 (24%), Positives = 54/132 (40%), Gaps = 6/132 (4%)
 Frame = -1

Query: 808  GSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHC 629
            G I   LD  L+ K  + S +  R S  EQ ++  +   +  GIE      V+   +  C
Sbjct: 618  GQIIVNLDHLLEYKPQQQSISNTR-STDEQFAKWYESVGEAYGIEGTQLEVVMNGLMVWC 676

Query: 628  INPGSDVDT----VSDLGKSNRRSPMMTILYPGRDEMHQNQHH--QLQQGFLATKTKEHP 467
            I  G+  +     V   G+     P+  ++   +    Q   H   L + ++  + +  P
Sbjct: 677  IENGTSPNINGTWVMMDGEEQVTYPLKPVVENAQPTFRQVMTHFSDLAEAYIEMRNRSEP 736

Query: 466  TLPRRRLQNNLT 431
             +PR  LQ NLT
Sbjct: 737  YMPRYGLQRNLT 748



>gb:AC116551_1206361 Dictyostelium discoideum chromosome 2 map
           complement(581327-427576) strain AX4, complete sequence.
          Length = 359

 Score = 34.3 bits (77), Expect = 4.5
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%)
 Frame = -1

Query: 256 RPQPQRTISLPTKPAKPTSQNMKKLQS----NKTKRTLQSLLSFQFTD*EAKDIEIFHSL 89
           +P P +T S PTKP+  TS + +K  S    N +K+   S  S Q T  + K+ +I ++L
Sbjct: 91  KPTPTKTTSKPTKPSATTSPSQQKQSSQSSQNTSKKQATSSSSQQSTQQKKKETKIKYNL 150



>gb:MHO416752_144062 Mycoplasma hominis uvrA gene (partial), ORF1-5,
            vaa gene and vmp gene.
          Length = 1404

 Score = 34.3 bits (77), Expect = 4.5
 Identities = 44/210 (20%), Positives = 82/210 (39%), Gaps = 8/210 (3%)
 Frame = -1

Query: 1030 ELAHQERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMK 851
            + A   +N+ D+   + +  ++ SL + K L K    +    E+   K E  +E+    +
Sbjct: 484  QTAQSSKNDADKTSNEEKAKLSASLSNAKKLDKNLTDSDG--EIQQAKAELAEEVEKANQ 541

Query: 850  VYVS---KAVINT----VDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFI 692
               S   K + N+    ++ +  +  KLD F +EK  EF+  E   S +       +EFI
Sbjct: 542  AITSNNTKEIQNSNTSLLNKISEVKNKLDKFSNEKEAEFNKLEASRSAI-------KEFI 594

Query: 691  DRNGIEQQSFVTVLPKYLKHCINPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQNQHH 512
            + N           P Y        + +D  + + KS+ +S ++              + 
Sbjct: 595  NENNTN--------PNYTALIQKLQAKLDAKNSITKSSNKSDIIA------------TNQ 634

Query: 511  QLQQGFLATKT-KEHPTLPRRRLQNNLTFT 425
             LQ+     KT KE      + ++N L  T
Sbjct: 635  ALQEALAIEKTEKESANSQNQAVKNTLNET 664



>pir|H90113|H90113 nucleolar snRNP protein [imported] - Guillardia
            theta nucleomorph>gb:GTAJ10592_1681152 Guillardia theta
            DNA for complete sequence of nucleomorph chromosome 2.
          Length = 365

 Score = 34.3 bits (77), Expect = 4.5
 Identities = 17/75 (22%), Positives = 38/75 (50%)
 Frame = +2

Query: 788  KFSSYRTKVIHCVNHSFAHINFHGIHQFLFVLIFAIRHFKIFCSRVKLFPQILQILQTVS 967
            KFS    ++I   N     + F+ +   + +  F+ +  K+F +R+K +  IL I   ++
Sbjct: 130  KFSLKTLRMIKNKNSEITKLKFNPVEYNILLSAFSTKKIKLFDTRLKFYSNILNIGIKIT 189

Query: 968  NVCSVLHKDFIIVVS 1012
            ++C + ++ F  + S
Sbjct: 190  DLCWIQNRPFEFLFS 204



>sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase (EC
           6.2.1.3) (Long-chain acyl-CoA synthetase)
           (LACS).>pir|H64041|H64041 probable
           long-chain-fatty-acid-CoA ligase (EC 6.2.1.3) HI0002
           [similarity] - Haemophilus influenzae (strain Rd
           KW20)>gb:U32686_203694 Haemophilus influenzae Rd KW20
           section 1 of 163 of the complete
           genome.>gb:L42023_1096243 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 607

 Score = 34.3 bits (77), Expect = 4.5
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 2/64 (3%)
 Frame = -1

Query: 970 ITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQE--LVDTMKVYVSKAVINTVDHLGSIA 797
           ITD +K+L       Y A +Y E   GKD+  ++  ++   K YVS  ++   D L   A
Sbjct: 463 ITDRIKELMKTSNGKYIAPQYIESKIGKDKFIEQIAIIADAKKYVSALIVPCFDSLEEYA 522

Query: 796 AKLD 785
            +L+
Sbjct: 523 KQLN 526



>gb:BC058068_2552256 Danio rerio serine/arginine repetitive matrix
           1, mRNA (cDNA clone MGC:63802 IMAGE:3815317), complete
           cds.
          Length = 896

 Score = 33.9 bits (76), Expect = 5.9
 Identities = 33/122 (27%), Positives = 47/122 (38%)
 Frame = -1

Query: 526 QNQHHQLQQGFLATKTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKL 347
           QN+    + G +  +    P  PRRR ++     + SP+PP               R   
Sbjct: 465 QNRGAGARNGEIRRRRSHSPASPRRRHRDASPRKRRSPSPP--------------GRRHR 510

Query: 346 SVSPLRFRLKRSESYIHRSPPFSPCDLRQFRPQPQRTISLPTKPAKPTSQNMKKLQSNKT 167
           S SP+R R   S     RSP   P   R+F P  QR  S    P  P+    ++   +  
Sbjct: 511 SQSPVRRRRSPSPPPRRRSPSPPP---RRFTPPIQRRYS----PPSPSPAQKRRSSGSPP 563

Query: 166 KR 161
           KR
Sbjct: 564 KR 565



>gb:HSU15131_2022419 Human p126 (ST5) mRNA, complete cds.
          Length = 1137

 Score = 33.9 bits (76), Expect = 5.9
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 2/101 (1%)
 Frame = -1

Query: 421 TSPNPPAFTFTRAASSKELDSRGKL--SVSPLRFRLKRSESYIHRSPPFSPCDLRQFRPQ 248
           T P  P      + SS+ L S+  L  +V+P+    +  E    ++P   P +     P 
Sbjct: 360 TKPGTPG----NSPSSQRLPSKSSLDPAVNPVPKPKRTFEYEAEKNPKSKPSNGLPPSPT 415

Query: 247 PQRTISLPTKPAKPTSQNMKKLQSNKTKRTLQSLLSFQFTD 125
           P     LP+ PA P ++  KK    +  R  QS  SF+F D
Sbjct: 416 PAAPPPLPSTPAPPVTRRPKK--DMRGHRKSQSRKSFEFED 454



>gb:HSA400879_2004887 Homo sapiens ST5 gene for suppression of
           tumorigenicity 5, L27a gene for ribosomal protein L27a
           and KIAA0298 gene.
          Length = 1137

 Score = 33.9 bits (76), Expect = 5.9
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 2/101 (1%)
 Frame = -1

Query: 421 TSPNPPAFTFTRAASSKELDSRGKL--SVSPLRFRLKRSESYIHRSPPFSPCDLRQFRPQ 248
           T P  P      + SS+ L S+  L  +V+P+    +  E    ++P   P +     P 
Sbjct: 360 TKPGTPG----NSPSSQRLPSKSSLDPAVNPVPKPKRTFEYEAEKNPKSKPSNGLPPSPT 415

Query: 247 PQRTISLPTKPAKPTSQNMKKLQSNKTKRTLQSLLSFQFTD 125
           P     LP+ PA P ++  KK    +  R  QS  SF+F D
Sbjct: 416 PAAPPPLPSTPAPPVTRRPKK--DMRGHRKSQSRKSFEFED 454



>gb:HS1054A22_1996623 Human DNA sequence from clone RP5-1054A22 on
           chromosome 20q11.22-12 Contains the TGM2 gene for
           transglutaminase 2 (C polypeptide,
           protein-glutamine-gamma-glutamyltransferase), the gene
           for a novel protein (KIAA1755), part of a novel gene and
           a CpG island, complete sequence.
          Length = 732

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 587 KIKQEKSYDDNSLSWPGRNASKPAPPTPA-RFSSNKNKRASYLTKEKAA 444
           K K+        +  P RN S P PPTP  +FS  + +R   +T EKA+
Sbjct: 442 KTKERNGRLPKPMPCPSRNTSSPEPPTPGLKFSFLRGQRQPSVTPEKAS 490



>gb:HS1054A22_1996620 Human DNA sequence from clone RP5-1054A22 on
           chromosome 20q11.22-12 Contains the TGM2 gene for
           transglutaminase 2 (C polypeptide,
           protein-glutamine-gamma-glutamyltransferase), the gene
           for a novel protein (KIAA1755), part of a novel gene and
           a CpG island, complete sequence.
          Length = 1110

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 587 KIKQEKSYDDNSLSWPGRNASKPAPPTPA-RFSSNKNKRASYLTKEKAA 444
           K K+        +  P RN S P PPTP  +FS  + +R   +T EKA+
Sbjct: 352 KTKERNGRLPKPMPCPSRNTSSPEPPTPGLKFSFLRGQRQPSVTPEKAS 400



>gb:HS1054A22_1996619 Human DNA sequence from clone RP5-1054A22 on
           chromosome 20q11.22-12 Contains the TGM2 gene for
           transglutaminase 2 (C polypeptide,
           protein-glutamine-gamma-glutamyltransferase), the gene
           for a novel protein (KIAA1755), part of a novel gene and
           a CpG island, complete sequence.
          Length = 1200

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 587 KIKQEKSYDDNSLSWPGRNASKPAPPTPA-RFSSNKNKRASYLTKEKAA 444
           K K+        +  P RN S P PPTP  +FS  + +R   +T EKA+
Sbjct: 442 KTKERNGRLPKPMPCPSRNTSSPEPPTPGLKFSFLRGQRQPSVTPEKAS 490



>gb:BC036655_1981990 Homo sapiens suppression of tumorigenicity 5,
           transcript variant 1, mRNA (cDNA clone MGC:33090
           IMAGE:4837231), complete cds.
          Length = 1137

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 2/101 (1%)
 Frame = -1

Query: 421 TSPNPPAFTFTRAASSKELDSRGKL--SVSPLRFRLKRSESYIHRSPPFSPCDLRQFRPQ 248
           T P  P      + SS+ L S+  L  +V+P+    +  E    ++P   P +     P 
Sbjct: 360 TKPGTPG----NSPSSQRLPSKSSLDPAVNPVPKPKRTFEYEADKNPKSKPSNGLPPSPT 415

Query: 247 PQRTISLPTKPAKPTSQNMKKLQSNKTKRTLQSLLSFQFTD 125
           P     LP+ PA P ++  KK    +  R  QS  SF+F D
Sbjct: 416 PAAPPPLPSTPAPPVTRRPKK--DMRGHRKSQSRKSFEFED 454



>gb:AB051542_1868054 Homo sapiens mRNA for KIAA1755 protein, partial
           cds.
          Length = 1110

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -3

Query: 587 KIKQEKSYDDNSLSWPGRNASKPAPPTPA-RFSSNKNKRASYLTKEKAA 444
           K K+        +  P RN S P PPTP  +FS  + +R   +T EKA+
Sbjct: 352 KTKERNGRLPKPMPCPSRNTSSPEPPTPGLKFSFLRGQRQPSVTPEKAS 400



>gb:CR380951_1649988 Candida glabrata strain CBS138 chromosome E
            complete sequence.
          Length = 2095

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 54/276 (19%), Positives = 107/276 (38%), Gaps = 10/276 (3%)
 Frame = -1

Query: 973  NITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQELVDTMKVYVSKAVINTVDHLGSIAA 794
            N+  + KD    +++ Y AA    ++    E   + +       S  V  T + L S+A 
Sbjct: 1331 NLIKNQKDSALKKEEIYRAAREMNMTVIDKESYSKFIQQR----SSPVKLTYEELQSLAT 1386

Query: 793  KLDTFLDEKVGEF----SATELRFSCVEQRSRSCQEFIDRNGIEQQSFVTVLPKYLKHCI 626
            K+D  L ++  +     S T L F  VE+   +        G + ++       +L    
Sbjct: 1387 KMDMDLIKRTPDLRSNSSGTRLNF--VEKEESAEDSSSSSTGEKSENLTQNKSPFLT--- 1441

Query: 625  NPGSDVDTVSDLGKSNRRSPMMTILYPGRDEMHQNQHHQLQQGFLATKTKEHPTLPRRRL 446
               S+  +++    +N+   +  IL P R                A+   + P L     
Sbjct: 1442 ---SNTSSLTLEELTNKAKELGYILSPMRKS--------------ASPLSDIPDLTSEST 1484

Query: 445  QNNLTFTQTSPNPPAFTFTRA------ASSKELDSRGKLSVSPLRFRLKRSESYIHRSPP 284
              N T T T  N  +   ++       A SK + +  KL ++ ++  LK +E  +     
Sbjct: 1485 ATNSTLTNTHENHSSLDLSKITQDNHKAQSKTIPN--KLDINTVQELLKETEYEL----- 1537

Query: 283  FSPCDLRQFRPQPQRTISLPTKPAKPTSQNMKKLQS 176
                 + + + +  +++  P+KP KPT + ++K+ S
Sbjct: 1538 -----INKKQLKELKSVRKPSKPTKPTEKELQKIAS 1568



>gb:BA000028_696688 Oceanobacillus iheyensis HTE831 DNA, complete
            genome.
          Length = 421

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 23/97 (23%), Positives = 38/97 (39%), Gaps = 4/97 (4%)
 Frame = -1

Query: 1081 SIFTKNQV*DYSNFMGTELAHQERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFE 902
            SIF    + D+   +G  L  ++         +    +   + +LK L        +   
Sbjct: 76   SIFNNYDIIDFFENLGVALKEEDHGRMFPASNKAMDVVNILINELKRLNVTIEMNTKVSS 135

Query: 901  VSYGKDEHKQELVDTMKVYVSKAVI----NTVDHLGS 803
            +SYGKD+H  +L D   +  +  VI      V H GS
Sbjct: 136  ISYGKDQHTIQLDDHTNIQTTAIVIASGGKAVPHTGS 172



>gb:CR378664_93833 Photobacterium profundum SS9; segment 2/12.
          Length = 604

 Score = 33.5 bits (75), Expect = 7.7
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 3/127 (2%)
 Frame = -1

Query: 1015 ERNNYDEILMQHRTNITDSLKDLKNLRKQFYSAAEYFEVSYGKDEHKQE---LVDTMKVY 845
            +  ++DE   Q    ITD +K+L       Y A +  E + GKD   ++   + DT K +
Sbjct: 444  DAGHFDE---QGNLFITDRIKELMKTSGGKYIAPQVIEGAIGKDHFIEQIAVIADTRK-F 499

Query: 844  VSKAVINTVDHLGSIAAKLDTFLDEKVGEFSATELRFSCVEQRSRSCQEFIDRNGIEQQS 665
            VS  ++   D L   A +L+    +++ E          +E+R    Q+ + R   EQ  
Sbjct: 500  VSALIVPCFDTLEEHARELNIKYKDRL-ELVKNSQIVELIEKRVVELQKDLAR--FEQVK 556

Query: 664  FVTVLPK 644
             +T+LPK
Sbjct: 557  KITLLPK 563


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,119,357,080
Number of Sequences: 1806583
Number of extensions: 23486565
Number of successful extensions: 70929
Number of sequences better than 10.0: 38
Number of HSP's better than 10.0 without gapping: 66851
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 70839
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 84320667046
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)