BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13901
         (795 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP005867_1859289 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AY085215_1570288 Arabidopsis thaliana clone 13887 mRNA, compl...    40   0.066   
gb:ATT5E8_1556134 Arabidopsis thaliana DNA chromosome 5, BAC clo...    40   0.066   
gb:AB018348_1864991 Homo sapiens mRNA for KIAA0805 protein, part...    33   6.1     
sp|Q96RV3|PCX1_HUMAN|PCX1_HUMAN Pecanex-like protein 1 (Pecanex homolog).>g...    33   6.1     Homo sapiens [man]


>gb:AP005867_1859289 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0599F09.
          Length = 214

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 45/170 (26%), Positives = 65/170 (38%), Gaps = 28/170 (16%)
 Frame = -3

Query: 793 QESFQREAEGYERLAQAKTLGTSMEFKKNNSDSVLDEDFIPSVAVE-GPSSLXXXXXXXX 617
           +E+F+REA GYERLA+A+ LG     +   +DS  D+     + +E GPS+         
Sbjct: 32  RETFEREAAGYERLARAR-LGLPEAEEDMFADSPKDKTTASLLDMEPGPSA-------AH 83

Query: 616 XXXXXXXXXXGDDSFDMFAEDDE-----------------NPP-----TNPTSS-----E 518
                      D  FDMF +DD+                 NP       N TS       
Sbjct: 84  TSTTTTTSKEDDSDFDMFGDDDDKTDVKRDSDANAVGSGSNPEQVSHDANETSGAEKGEN 143

Query: 517 GTLQNXXXXXXXXXXXXXXXXXXXXXXXXXXYCNAASGQWYSYKEDSGTY 368
           G++ +                          YC+A++G WYSY E +G Y
Sbjct: 144 GSVSSDYVYDPTSGYYYSSSTGYYYDSTSGCYCSASTGAWYSYDEQTGEY 193



>gb:AY085215_1570288 Arabidopsis thaliana clone 13887 mRNA, complete
           sequence.>gb:AY123988_1580069 Arabidopsis thaliana
           AT5g09390/T5E8_190 mRNA, complete
           cds.>gb:BT000562_1634840 Arabidopsis thaliana unknown
           protein (At5g09390/T5E8_190) mRNA, complete cds.
          Length = 351

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 19/23 (82%), Positives = 20/23 (86%)
 Frame = -3

Query: 793 QESFQREAEGYERLAQAKTLGTS 725
           QE FQREAEGYERLAQAK  GT+
Sbjct: 238 QEVFQREAEGYERLAQAKENGTA 260



>gb:ATT5E8_1556134 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T5E8 (ESSA project).
          Length = 354

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 19/23 (82%), Positives = 20/23 (86%)
 Frame = -3

Query: 793 QESFQREAEGYERLAQAKTLGTS 725
           QE FQREAEGYERLAQAK  GT+
Sbjct: 243 QEVFQREAEGYERLAQAKENGTA 265



>gb:AB018348_1864991 Homo sapiens mRNA for KIAA0805 protein, partial
           cds.
          Length = 1327

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 18/35 (51%), Positives = 20/35 (57%)
 Frame = -1

Query: 111 DIHILDYIVTHPLL*DLRWFICLLVRVVVLYPLCY 7
           DIHI     T  LL  L  FIC +V V +LY LCY
Sbjct: 206 DIHIFGGNATTSLLAALYSFICSIVAVALLYGLCY 240



>sp|Q96RV3|PCX1_HUMAN Pecanex-like protein 1 (Pecanex
            homolog).>gb:AF233450_1891816 Homo sapiens pecanex-like
            protein 1 mRNA, complete cds.
          Length = 2341

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 18/35 (51%), Positives = 20/35 (57%)
 Frame = -1

Query: 111  DIHILDYIVTHPLL*DLRWFICLLVRVVVLYPLCY 7
            DIHI     T  LL  L  FIC +V V +LY LCY
Sbjct: 1148 DIHIFGGNATTSLLAALYSFICSIVAVALLYGLCY 1182


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 743,029,217
Number of Sequences: 1806583
Number of extensions: 13070642
Number of successful extensions: 34017
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 32774
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33996
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51335108558
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)