BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13792
         (863 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY091772_1574732 Arabidopsis thaliana AT4g24390/T22A6_220 mRN...    40   0.058   
pir|T09902|T09902 hypothetical protein T22A6.220 - Arabidopsis t...    40   0.058   Arabidopsis thaliana [mouse-ear cress]
gb:AB024032_1515776 Arabidopsis thaliana genomic DNA, chromosome...    39   0.17    
gb:AF139835_1771452 Populus tremula x Populus tremuloides F-box ...    38   0.22    
gb:AY530101_1611874 Oryza sativa (indica cultivar-group) syn-cop...    33   7.1     
gb:AB066270_1522558 Oryza sativa (japonica cultivar-group) OsCyc...    33   7.1     
gb:OSJN00145_1190849 Oryza sativa (japonica cultivar-group) chro...    33   7.1     
gb:AY456185_618613 Gluconacetobacter diazotrophicus heme exporte...    33   7.1     
gb:AC121489_1740221 Oryza sativa (japonica cultivar-group) chrom...    33   9.2     


>gb:AY091772_1574732 Arabidopsis thaliana AT4g24390/T22A6_220 mRNA,
           complete cds.>gb:BT006340_1639227 Arabidopsis thaliana
           At4g24390/T22A6_220 gene, complete cds.
          Length = 623

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 1/33 (3%)
 Frame = -1

Query: 827 NEYDMVANEY-DTVYMYRSLDEPRCDAPKFVQI 732
           ++ D V  +Y +T+Y+YRSLD PR DAPKFV I
Sbjct: 590 DDEDTVTGDYVETLYLYRSLDGPRKDAPKFVTI 622



>pir|T09902|T09902 hypothetical protein T22A6.220 - Arabidopsis
           thaliana>gb:ATCHRIV61_1546322 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 61.>gb:ATT22A6_1555188
           Arabidopsis thaliana DNA chromosome 4, BAC clone T22A6
           (ESSA project).
          Length = 614

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 1/33 (3%)
 Frame = -1

Query: 827 NEYDMVANEY-DTVYMYRSLDEPRCDAPKFVQI 732
           ++ D V  +Y +T+Y+YRSLD PR DAPKFV I
Sbjct: 581 DDEDTVTGDYVETLYLYRSLDGPRKDAPKFVTI 613



>gb:AB024032_1515776 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K9P8.>gb:AY056431_1563739 Arabidopsis thaliana
           AT5g49980/K9P8_12 mRNA, complete
           cds.>gb:AY139774_1582391 Arabidopsis thaliana
           AT5g49980/K9P8_12 mRNA, complete
           cds.>gb:BT004536_1637570 Arabidopsis thaliana
           AT5g49980/K9P8_12 gene, complete cds.
          Length = 619

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 17/22 (77%), Positives = 19/22 (86%)
 Frame = -1

Query: 797 DTVYMYRSLDEPRCDAPKFVQI 732
           +T+YMYRSLD PR DAPKFV I
Sbjct: 597 ETLYMYRSLDGPRNDAPKFVTI 618



>gb:AF139835_1771452 Populus tremula x Populus tremuloides F-box
           containing protein TIR1 (TIR1) mRNA, complete cds.
          Length = 635

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 18/26 (69%), Positives = 22/26 (84%), Gaps = 1/26 (3%)
 Frame = -1

Query: 806 NEY-DTVYMYRSLDEPRCDAPKFVQI 732
           +EY DT+YMYRSL+ PR DAP+FV I
Sbjct: 609 DEYVDTLYMYRSLEGPRDDAPRFVSI 634



>gb:AY530101_1611874 Oryza sativa (indica cultivar-group)
           syn-copalyl diphosphate synthase mRNA, complete cds.
          Length = 767

 Score = 33.1 bits (74), Expect = 7.1
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 11/55 (20%)
 Frame = +3

Query: 426 YPIHQYCRL-----------SRHLAGKITKLTSYMFHNWKTTGAEYHLDCPISPI 557
           YP+  Y RL           SRH   +I     Y+F NW   G  +  +CP+  I
Sbjct: 312 YPLDVYERLWAVDRLTRLGISRHFTSEIEDCLDYIFRNWTPDGLAHTKNCPVKDI 366



>gb:AB066270_1522558 Oryza sativa (japonica cultivar-group) OsCyc1
           mRNA for syn-CDP synthase, complete cds.
          Length = 766

 Score = 33.1 bits (74), Expect = 7.1
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 11/55 (20%)
 Frame = +3

Query: 426 YPIHQYCRL-----------SRHLAGKITKLTSYMFHNWKTTGAEYHLDCPISPI 557
           YP+  Y RL           SRH   +I     Y+F NW   G  +  +CP+  I
Sbjct: 312 YPLDVYERLWAVDRLTRLGISRHFTSEIEDCLDYIFRNWTPDGLAHTKNCPVKDI 366



>gb:OSJN00145_1190849 Oryza sativa (japonica cultivar-group)
           chromosome 4 clone OSJNBa0096F01, *** SEQUENCING IN
           PROGRESS ***, 2 ordered pieces.
          Length = 685

 Score = 33.1 bits (74), Expect = 7.1
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 11/55 (20%)
 Frame = +3

Query: 426 YPIHQYCRL-----------SRHLAGKITKLTSYMFHNWKTTGAEYHLDCPISPI 557
           YP+  Y RL           SRH   +I     Y+F NW   G  +  +CP+  I
Sbjct: 230 YPLDVYERLWAVDRLTRLGISRHFTSEIEDCLDYIFRNWTPDGLAHTKNCPVKDI 284



>gb:AY456185_618613 Gluconacetobacter diazotrophicus heme exporter
           protein C (ccmC), unknown protein, cytochrome C
           biosynthesis heme-carrier protein (ccmE), and cytochrome
           C-type biogenesis protein (ccmF) genes, complete cds;
           and thioredoxin disulfide isomerase (ccmG) gene, partial
           cds.
          Length = 658

 Score = 33.1 bits (74), Expect = 7.1
 Identities = 25/78 (32%), Positives = 37/78 (47%), Gaps = 2/78 (2%)
 Frame = +2

Query: 77  YMFWGPATASSLKSKLTGRKISRCSILSIKRE*L-YWMMVYYPDLHALLNLQF-SRSPFL 250
           Y FW P   +SL   LTG  +   +I+  KRE L  W ++   D+   L+  F  RS  L
Sbjct: 238 YWFWDPVENASLIPWLTGTALVHSAIVVEKREALKIWTVLLASDISFSLSGTFLVRSGIL 297

Query: 251 QNLKGGATNQPTSLFYLG 304
            ++   A +    +F LG
Sbjct: 298 NSVHAFANDPARGIFILG 315



>gb:AC121489_1740221 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1217B09, complete sequence.
          Length = 603

 Score = 32.7 bits (73), Expect = 9.2
 Identities = 14/22 (63%), Positives = 17/22 (77%)
 Frame = -1

Query: 797 DTVYMYRSLDEPRCDAPKFVQI 732
           D +YMYRSL+ PR D P FV+I
Sbjct: 581 DILYMYRSLEGPREDVPPFVKI 602


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 786,225,035
Number of Sequences: 1806583
Number of extensions: 14485562
Number of successful extensions: 32103
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 31550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32099
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 58992155624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)