BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13737
         (1236 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY091057_1574285 Arabidopsis thaliana unknown protein (At4g39...   279   e-124   
gb:AY087403_1572434 Arabidopsis thaliana clone 35002 mRNA, compl...   275   e-123   
pir|T09355|T09355 hypothetical protein F23K16.20 - Arabidopsis t...   276   e-121   Arabidopsis thaliana [mouse-ear cress]
pir|T04029|T04029 hypothetical protein F17A8.160 - Arabidopsis t...   284   3e-75   Arabidopsis thaliana [mouse-ear cress]
pir|A86464|A86464 hypothetical protein F12G12.16 - Arabidopsis t...   280   3e-74   Arabidopsis thaliana [mouse-ear cress]
gb:AY088535_1573553 Arabidopsis thaliana clone 7642 mRNA, comple...   277   4e-73   
gb:AC108498_1738442 Oryza sativa (japonica cultivar-group) chrom...   259   1e-67   
gb:AP004747_1844300 Oryza sativa (japonica cultivar-group) genom...   258   2e-67   
gb:AY030360_1559368 Oryza sativa putative transmembrane protein ...   257   4e-67   
gb:AP004185_1838691 Oryza sativa (japonica cultivar-group) genom...   163   1e-64   
gb:AB016888_1513166 Arabidopsis thaliana genomic DNA, chromosome...   175   2e-42   
gb:AC084817_1733831 Oryza sativa (japonica cultivar-group) chrom...   102   2e-42   
pir|G86343|G86343 hypothetical protein T22I11.10 - Arabidopsis t...   174   4e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AY084463_1569553 Arabidopsis thaliana clone 108746 mRNA, comp...   172   1e-41   
gb:AB060277_1521816 Oryza sativa GPT mRNA for putative glucose-6...   101   1e-41   
pir|A96795|A96795 unknown protein F28O16.4 [imported] - Arabidop...   171   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AK117643_1815668 Arabidopsis thaliana At1g21070 mRNA for unkn...   144   3e-33   
gb:LMFL2185_1387820 Leishmania major Friedlin chromosome 19 cosm...    80   6e-27   
gb:AP002912_1823881 Oryza sativa (japonica cultivar-group) genom...   102   1e-20   
gb:AC024594_1539349 Oryza sativa chromosome 10 BAC OSJNBa0093B11...   102   2e-20   
gb:BT002471_1636074 Arabidopsis thaliana putative integral membr...   101   3e-20   
gb:AP006168_1861220 Oryza sativa (japonica cultivar-group) genom...   100   8e-20   
gb:AY087465_1572496 Arabidopsis thaliana clone 35741 mRNA, compl...    78   2e-19   
gb:AY080815_1568513 Arabidopsis thaliana unknown protein (At1g06...    99   2e-19   
gb:AB026659_1517380 Arabidopsis thaliana genomic DNA, chromosome...    78   2e-19   
gb:BC006601_2090235 Mus musculus solute carrier family 35, membe...    65   4e-18   
gb:AY358943_1947822 Homo sapiens clone DNA125170 BLOV1 (UNQ3043)...    64   2e-17   
gb:AE016959_1023110 Oryza sativa (japonica cultivar-group) chrom...    91   5e-17   
gb:AL935183_2504896 Zebrafish DNA sequence from clone DKEYP-86A5...    67   5e-17   
pir|F86203|F86203 hypothetical protein [imported] - Arabidopsis ...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:BT003153_1636734 Arabidopsis thaliana At5g57100 mRNA, complet...    71   5e-16   
gb:AB023042_1515470 Arabidopsis thaliana genomic DNA, chromosome...    70   2e-15   
gb:AY085537_1570606 Arabidopsis thaliana clone 156439 mRNA, comp...    70   2e-15   
gb:AF148713_1886177 Homo sapiens bladder cancer overexpressed pr...    56   4e-14   
gb:AP005113_1848087 Oryza sativa (japonica cultivar-group) genom...    72   2e-11   
gb:AY648822_2541650 Danio rerio UDP-glucuronic acid/UDP-N-acetyl...    41   1e-06   
pir|F84708|F84708 probable integral membrane protein [imported] ...    56   2e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP005300_1850157 Oryza sativa (japonica cultivar-group) genom...    42   2e-06   
gb:BC055186_2551268 Danio rerio zgc:63651, mRNA (cDNA clone MGC:...    40   5e-06   
gb:AE005172_890262 Arabidopsis thaliana chromosome 1, top arm co...    40   2e-05   
gb:AB117932_2048595 Mus musculus mUGTrel8 mRNA for UDP-glucuroni...    52   2e-05   
gb:AB117931_2048594 Mus musculus mUGTrel8 mRNA for UDP-glucuroni...    52   2e-05   
gb:AX083449_1460848 Sequence 141 from Patent WO0112660.>gb:AB106...    50   7e-05   
gb:AB122077_1873818 Homo sapiens SLC35D2 mRNA for nucleotide sug...    49   2e-04   
pir|G96576|G96576 hypothetical protein F22G10.26 [imported] - Ar...    47   8e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP004462_1841378 Oryza sativa (japonica cultivar-group) genom...    46   0.001   
gb:CR382128_1660689 Yarrowia lipolytica chromosome B of strain C...    44   0.005   
pir|F96805|F96805 unknown protein T5M16.20 [imported] - Arabidop...    44   0.007   Arabidopsis thaliana [mouse-ear cress]
gb:HSA005866_1999916 Homo sapiens mRNA for putative Sqv-7-like p...    42   0.020   
gb:AY421728_1605129 Cryptococcus neoformans var. neoformans Cas4...    42   0.034   
gb:AY093729_1575389 Arabidopsis thaliana AT3g14410/MLN21_19 mRNA...    40   0.098   
gb:AY042818_1560883 Arabidopsis thaliana putative protein (F28M2...    40   0.098   
gb:AB022220_1515150 Arabidopsis thaliana genomic DNA, chromosome...    40   0.098   
pir|T05110|T05110 hypothetical protein F28M20.210 - Arabidopsis ...    40   0.098   Arabidopsis thaliana [mouse-ear cress]
gb:BC085693_2109270 Rattus norvegicus putative phosphate-phospho...    40   0.13    
gb:AF182714_2058108 Rattus norvegicus putative phosphate/phospho...    40   0.13    
gb:AE005172_891137 Arabidopsis thaliana chromosome 1, top arm co...    40   0.13    
gb:AP003508_1830079 Oryza sativa (japonica cultivar-group) genom...    39   0.17    
gb:AY426186_1605647 Cryptococcus neoformans var. neoformans Drp1...    39   0.17    
gb:AP005620_1855048 Oryza sativa (japonica cultivar-group) genom...    39   0.22    
gb:AC133334_1741363 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    39   0.22    
gb:AF466200_1802224 Sorghum bicolor putative protein kinase gene...    39   0.28    
gb:AC115584_1205698 Dictyostelium discoideum chromosome 2 map co...    39   0.28    
gb:BC083039_2563059 Xenopus laevis hypothetical LOC494867, mRNA ...    38   0.37    
gb:AL731853_2072945 Mouse DNA sequence from clone RP23-128G5 on ...    38   0.49    
gb:CR456351_1992642 Homo sapiens Em:AC005006.4 full length open ...    38   0.49    
gb:ATAC009400_1542961 Arabidopsis thaliana chromosome III BAC F1...    38   0.49    
gb:AK039786_1165498 Mus musculus adult male spinal cord cDNA, RI...    38   0.49    
gb:AE001362_939349 Plasmodium falciparum 3D7 chromosome 2 comple...    37   0.63    
sp|Q09875|YAGC_SCHPO|YAGC_SCHPO Hypothetical protein C12G12.12 in chromosom...    37   0.63    Schizosaccharomyces pombe
gb:CNS07EGA_1372927 chromosome III of strain GB-M1 of Encephalit...    37   1.1     
gb:AB062677_1197042 Drosophila melanogaster UST74C mRNA for UDP-...    37   1.1     
sp|Q95YI5|US74_DROME|US74_DROME UDP-sugar transporter UST74c (Fringe connec...    37   1.1     Drosophila melanogaster
gb:AP003211_1825267 Oryza sativa (japonica cultivar-group) genom...    36   1.4     
gb:AC134232_1741661 Oryza sativa (japonica cultivar-group) chrom...    36   1.8     
gb:AL160269_1921817 Human DNA sequence from clone RP11-240L7 on ...    35   2.4     
gb:BT015807_1642425 Arabidopsis thaliana At3g11320 gene, complet...    35   2.4     
gb:AY198133_596920 Spiroplasma kunkelii strain CR2-3x partial ge...    35   2.4     
pir|C71612|C71612 probable multiple-TM membrane protein PFB0535w...    35   2.4     Plasmodium falciparum
pir|H96790|H96790 unknown protein F15M4.16 [imported] - Arabidop...    35   2.4     Arabidopsis thaliana [mouse-ear cress]
gb:AB027863_1517629 Schizosaccharomyces pombe gene for Hypotheti...    35   3.2     
gb:AB121210_1201131 Marsupenaeus japonicus mjTSPb mRNA for throm...    35   3.2     
gb:AB121209_1201130 Marsupenaeus japonicus mjTSPa mRNA for throm...    35   3.2     
sp|Q9UUI8|YIY4_SCHPO|YIY4_SCHPO Protein C22F8.04 in chromosome I.>pir|T3819...    35   3.2     Schizosaccharomyces pombe
gb:AB121211_1201132 Marsupenaeus japonicus mjTSPc mRNA for throm...    35   4.1     
gb:AE014298_1126743 Drosophila melanogaster chromosome X, comple...    35   4.1     
gb:NCB11C21_1689007 Neurospora crassa DNA linkage group V BAC cl...    34   5.4     
gb:AY062475_1565131 Arabidopsis thaliana phosphate/phosphoenolpy...    34   7.0     
gb:ATF21E1_1549581 Arabidopsis thaliana DNA chromosome 5, BAC cl...    34   7.0     
gb:AX647441_1472346 Sequence 1633 from Patent EP1270724.               34   7.0     
gb:AY606321_2366823 Avian infectious bronchitis virus isolate 22...    33   9.2     
gb:AE017274_424519 Bacillus cereus ATCC 10987, section 11 of 18 ...    33   9.2     


>gb:AY091057_1574285 Arabidopsis thaliana unknown protein (At4g39390)
            mRNA, complete cds.>gb:AY142535_1582964 Arabidopsis
            thaliana unknown protein (At4g39390) mRNA, complete cds.
          Length = 337

 Score =  279 bits (714), Expect(2) = e-124
 Identities = 141/192 (73%), Positives = 158/192 (82%)
 Frame = -2

Query: 1139 RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXL 960
            +KMS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFS              L
Sbjct: 3    KKMSATTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTL 62

Query: 959  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL 780
            +T  L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL
Sbjct: 63   LTTFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL 122

Query: 779  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL 600
            LEV+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+L
Sbjct: 123  LEVMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYL 182

Query: 599  QRKYSLGSFNLL 564
            QRKYSLGSFNLL
Sbjct: 183  QRKYSLGSFNLL 194



 Score =  189 bits (480), Expect(2) = e-124
 Identities = 90/119 (75%), Positives = 106/119 (89%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           HTAP+QAASLLLVGP  D WLT++ V AY+++  ++  ++LSC+IA+GTNLSQFICIGRF
Sbjct: 196 HTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLFFLILSCSIAVGTNLSQFICIGRF 255

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           TAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct: 256 TAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNASSKPGGKER 314



>gb:AY087403_1572434 Arabidopsis thaliana clone 35002 mRNA, complete
            sequence.
          Length = 333

 Score =  275 bits (704), Expect(2) = e-123
 Identities = 139/190 (73%), Positives = 156/190 (82%)
 Frame = -2

Query: 1133 MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMT 954
            MS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFS              L+T
Sbjct: 1    MSATTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLT 60

Query: 953  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE 774
              L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE
Sbjct: 61   TFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE 120

Query: 773  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR 594
            V+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQR
Sbjct: 121  VMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQR 180

Query: 593  KYSLGSFNLL 564
            KY+LGSFNLL
Sbjct: 181  KYALGSFNLL 190



 Score =  189 bits (480), Expect(2) = e-123
 Identities = 90/119 (75%), Positives = 106/119 (89%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           HTAP+QAASLLLVGP  D WLT++ V AY+++  ++  ++LSC+IA+GTNLSQFICIGRF
Sbjct: 192 HTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLFFLILSCSIAVGTNLSQFICIGRF 251

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           TAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNASSK GGKER
Sbjct: 252 TAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNASSKPGGKER 310



>pir|T09355|T09355 hypothetical protein F23K16.20 - Arabidopsis
            thaliana>gb:ATCHRIV91_1547923 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 91.>gb:ATF23K16_1549764
            Arabidopsis thaliana DNA chromosome 4, BAC clone F23K16
            (ESSA project).
          Length = 342

 Score =  276 bits (707), Expect(2) = e-121
 Identities = 140/190 (73%), Positives = 156/190 (82%)
 Frame = -2

Query: 1133 MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMT 954
            MS+   K ++KA +D A+W FN+VTSVGII+VNKALMA +GFS              L+T
Sbjct: 1    MSATTSKTDQKAALDIASWLFNVVTSVGIILVNKALMATYGFSFATTLTGLHFGTTTLLT 60

Query: 953  LILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE 774
              L  LGYIQ S LPW + +KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE
Sbjct: 61   TFLTWLGYIQPSQLPWPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE 120

Query: 773  VVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR 594
            V+LD+VRYSRDTKLSILLVL GVA+CTVTDVSVN  GF+AA IAVWSTALQQYYVH+LQR
Sbjct: 121  VMLDNVRYSRDTKLSILLVLAGVAVCTVTDVSVNLNGFLAAAIAVWSTALQQYYVHYLQR 180

Query: 593  KYSLGSFNLL 564
            KYSLGSFNLL
Sbjct: 181  KYSLGSFNLL 190



 Score =  181 bits (460), Expect(2) = e-121
 Identities = 90/128 (70%), Positives = 106/128 (82%), Gaps = 9/128 (7%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVS---------LIVLSCTIAIGTNL 407
           HTAP+QAASLLLVGP  D WLT++ V AY+++  ++           ++LSC+IA+GTNL
Sbjct: 192 HTAPVQAASLLLVGPFLDYWLTNQRVDAYNFSFVSLLYLTQFFGQFFLILSCSIAVGTNL 251

Query: 406 SQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNAS 227
           SQFICIGRFTAVSFQVLGHMKTILVL LGF FFGKEG+N+QVVLGM IAI+GM+WYGNAS
Sbjct: 252 SQFICIGRFTAVSFQVLGHMKTILVLVLGFTFFGKEGLNLQVVLGMLIAILGMIWYGNAS 311

Query: 226 SKAGGKER 203
           SK GGKER
Sbjct: 312 SKPGGKER 319



>pir|T04029|T04029 hypothetical protein F17A8.160 - Arabidopsis
            thaliana>gb:ATCHRIV27_1544695 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 27.>gb:ATF17A8_1548878
            Arabidopsis thaliana DNA chromosome 4, BAC clone F17A8
            (ESSA project).>gb:BT010950_1640896 Arabidopsis thaliana
            At4g09810 gene, complete cds.
          Length = 335

 Score =  284 bits (726), Expect = 3e-75
 Identities = 143/202 (70%), Positives = 161/202 (79%)
 Frame = -2

Query: 1121 VVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILK 942
            V K +KKA +D AAW FN+VTSVGIIIVNKALMA +GFS              LMTL+L+
Sbjct: 4    VKKSDKKATLDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTLVLR 63

Query: 941  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD 762
             LGYIQ S+LP++E +KF+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV D
Sbjct: 64   CLGYIQPSHLPFTELLKFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVFD 123

Query: 761  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL 582
             +RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL
Sbjct: 124  KIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSL 183

Query: 581  GSFNLLGAYCTTTGCISAVGGP 516
             SFNLLG           + GP
Sbjct: 184  SSFNLLGHTAPAQAATLLIVGP 205



 Score =  184 bits (466), Expect = 4e-45
 Identities = 87/120 (72%), Positives = 100/120 (83%)
 Frame = -3

Query: 562 GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR 383
           GHTAP QAA+LL+VGP  D WLTDK V  Y Y   +V  I LSCTIAIGTNLSQFICIGR
Sbjct: 190 GHTAPAQAATLLIVGPFLDYWLTDKRVDMYDYNSVSVMFITLSCTIAIGTNLSQFICIGR 249

Query: 382 FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           FTAVSFQVLGHMKTILVL +GF FF ++G+N+ V+LGM IA++GM+WYGNASSK GGKE+
Sbjct: 250 FTAVSFQVLGHMKTILVLVMGFFFFDRDGLNLHVILGMIIAVLGMIWYGNASSKPGGKEK 309



>pir|A86464|A86464 hypothetical protein F12G12.16 - Arabidopsis
            thaliana>gb:AE005172_892205 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC015446_1537986 Arabidopsis thaliana
            chromosome I BAC F12G12 genomic sequence, complete
            sequence.>gb:AC079286_1732506 Arabidopsis thaliana
            chromosome 1 BAC T15K4 genomic sequence, complete
            sequence.
          Length = 335

 Score =  280 bits (717), Expect = 3e-74
 Identities = 141/202 (69%), Positives = 161/202 (79%)
 Frame = -2

Query: 1121 VVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILK 942
            V K +KKA +D AAW FN+VTSVGIIIVNKALMA +G+S              LMTL+L+
Sbjct: 4    VSKADKKAAVDAAAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTLVLR 63

Query: 941  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD 762
             LGYIQ S+LP++E ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D
Sbjct: 64   CLGYIQPSHLPFTELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFD 123

Query: 761  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL 582
             +RYSRDTKLSI LVL+GV +CTVTDVSVN KGF+AAF+AVWSTALQQYYVH+LQRKYSL
Sbjct: 124  KIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKGFVAAFVAVWSTALQQYYVHYLQRKYSL 183

Query: 581  GSFNLLGAYCTTTGCISAVGGP 516
             SFNLLG           V GP
Sbjct: 184  NSFNLLGHTAPAQAATLLVVGP 205



 Score =  187 bits (476), Expect = 3e-46
 Identities = 90/120 (75%), Positives = 102/120 (85%)
 Frame = -3

Query: 562 GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR 383
           GHTAP QAA+LL+VGP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct: 190 GHTAPAQAATLLVVGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR 249

Query: 382 FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct: 250 FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER 309



>gb:AY088535_1573553 Arabidopsis thaliana clone 7642 mRNA, complete
            sequence.
          Length = 335

 Score =  277 bits (708), Expect = 4e-73
 Identities = 140/202 (69%), Positives = 160/202 (79%)
 Frame = -2

Query: 1121 VVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILK 942
            V K +KKA +D AAW FN+VTSVGIIIVNKALMA +G+S              LMTL+L+
Sbjct: 4    VSKADKKAAVDAAAWMFNVVTSVGIIIVNKALMATYGYSFATTLTGLHFATTTLMTLVLR 63

Query: 941  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD 762
             LGYIQ S+LP++E ++F+LFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE+V D
Sbjct: 64   CLGYIQPSHLPFTELLRFILFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEMVFD 123

Query: 761  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL 582
             +RYSRDTKLSI LVL+GV +CTVTDVSVN K F+AAF+AVWSTALQQYYVH+LQRKYSL
Sbjct: 124  KIRYSRDTKLSIGLVLVGVGVCTVTDVSVNTKRFVAAFVAVWSTALQQYYVHYLQRKYSL 183

Query: 581  GSFNLLGAYCTTTGCISAVGGP 516
             SFNLLG           V GP
Sbjct: 184  NSFNLLGHTAPAQAATLLVIGP 205



 Score =  187 bits (475), Expect = 4e-46
 Identities = 89/120 (74%), Positives = 102/120 (85%)
 Frame = -3

Query: 562 GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR 383
           GHTAP QAA+LL++GP  D WLT+K V  Y Y L +V  I LSCTIAIGTNLSQFICIGR
Sbjct: 190 GHTAPAQAATLLVIGPFLDYWLTEKRVDMYDYNLVSVLFITLSCTIAIGTNLSQFICIGR 249

Query: 382 FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           FTAVSFQVLGHMKTILVL +GF FFG+EG+N+ VV+GM IA++GM+WYGNASSK GGKER
Sbjct: 250 FTAVSFQVLGHMKTILVLIMGFFFFGREGLNLHVVVGMIIAVLGMIWYGNASSKPGGKER 309



>gb:AC108498_1738442 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1076_H08, complete sequence.
          Length = 335

 Score =  259 bits (661), Expect = 1e-67
 Identities = 135/200 (67%), Positives = 150/200 (75%)
 Frame = -2

Query: 1115 KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRL 936
            K E+KA +D  AW FNIVTSVGII+VNKALMA  GFS              LMTL++K L
Sbjct: 6    KAERKAALDAGAWMFNIVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL 65

Query: 935  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV 756
            GYIQ S LP  E IKFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C LE++ D V
Sbjct: 66   GYIQPSYLPVPELIKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILFDKV 125

Query: 755  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS 576
            RYSRDTK SI++VL+GVA+CTVTDVSVN++G IAA IAVWSTALQQ+YVH LQRKYSLGS
Sbjct: 126  RYSRDTKFSIMVVLVGVAVCTVTDVSVNSQGLIAAIIAVWSTALQQHYVHHLQRKYSLGS 185

Query: 575  FNLLGAYCTTTGCISAVGGP 516
            FNLLG           V GP
Sbjct: 186  FNLLGHTAPAQAASLLVLGP 205



 Score =  187 bits (474), Expect = 5e-46
 Identities = 87/120 (72%), Positives = 101/120 (84%)
 Frame = -3

Query: 562 GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR 383
           GHTAP QAASLL++GP  D WLT+K V  ++YT      I+LSC IA+GTNLSQFICIGR
Sbjct: 190 GHTAPAQAASLLVLGPFVDFWLTNKRVDTFNYTAIVTFFIILSCIIAVGTNLSQFICIGR 249

Query: 382 FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           FTAVSFQVLGHMKT+LVLTLGFLFFGKEG+N  V +GM +A++GM+WYGNASSK GGKER
Sbjct: 250 FTAVSFQVLGHMKTVLVLTLGFLFFGKEGLNFHVAIGMILAVIGMIWYGNASSKPGGKER 309



>gb:AP004747_1844300 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0407A09.>gb:AP005300_1850162 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OJ2055_H10.
          Length = 331

 Score =  258 bits (659), Expect = 2e-67
 Identities = 131/200 (65%), Positives = 153/200 (76%)
 Frame = -2

Query: 1115 KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRL 936
            K E+KA++D  AW FN+VTSVGII+VNKALMA  GFS              LMTL++K L
Sbjct: 6    KAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL 65

Query: 935  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV 756
            G+IQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct: 66   GHIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEILFDKV 125

Query: 755  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS 576
            RYSR+TKLSI+LVL+GVA+CTVTDVSVN+KG +AA IAVWSTALQQ+YVH LQ+KYSLGS
Sbjct: 126  RYSRNTKLSIVLVLVGVAVCTVTDVSVNSKGLLAAVIAVWSTALQQHYVHHLQKKYSLGS 185

Query: 575  FNLLGAYCTTTGCISAVGGP 516
            FNLLG           + GP
Sbjct: 186  FNLLGHTAPAQAASLLILGP 205



 Score =  192 bits (487), Expect = 2e-47
 Identities = 91/120 (75%), Positives = 103/120 (85%)
 Frame = -3

Query: 562 GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR 383
           GHTAP QAASLL++GP  D WLT++ V  ++YT      IVLSCTIA+GTNLSQFICIGR
Sbjct: 190 GHTAPAQAASLLILGPFVDFWLTNRRVDTFNYTTIVTFFIVLSCTIAVGTNLSQFICIGR 249

Query: 382 FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  VVLGM +A++GM+WYGNASSK GGKER
Sbjct: 250 FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVVLGMMLAVIGMIWYGNASSKPGGKER 309



>gb:AY030360_1559368 Oryza sativa putative transmembrane protein mRNA,
            complete cds.
          Length = 331

 Score =  257 bits (656), Expect = 4e-67
 Identities = 130/200 (65%), Positives = 153/200 (76%)
 Frame = -2

Query: 1115 KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRL 936
            K E+KA++D  AW FN+VTSVGII+VNKALMA  GFS              LMTL++K L
Sbjct: 6    KAERKAVLDAGAWMFNVVTSVGIIMVNKALMATHGFSFATTLTGLHFATTTLMTLVMKWL 65

Query: 935  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSV 756
            G+IQ S LP  E +KFV FAN SIVGMNVSLMWNSVGFYQIAKL +IPV C+LE++ D V
Sbjct: 66   GHIQPSYLPLPELVKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCILEILFDKV 125

Query: 755  RYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGS 576
            RYSR+TKLSI+LVL+GVA+CTVTDVSVN++G +AA IAVWSTALQQ+YVH LQ+KYSLGS
Sbjct: 126  RYSRNTKLSIVLVLVGVAVCTVTDVSVNSRGLLAAVIAVWSTALQQHYVHHLQKKYSLGS 185

Query: 575  FNLLGAYCTTTGCISAVGGP 516
            FNLLG           + GP
Sbjct: 186  FNLLGHTAPAQAASLLILGP 205



 Score =  192 bits (487), Expect = 2e-47
 Identities = 91/120 (75%), Positives = 103/120 (85%)
 Frame = -3

Query: 562 GHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGR 383
           GHTAP QAASLL++GP  D WLT++ V  ++YT      IVLSCTIA+GTNLSQFICIGR
Sbjct: 190 GHTAPAQAASLLILGPFVDFWLTNRRVDTFNYTTIVTFFIVLSCTIAVGTNLSQFICIGR 249

Query: 382 FTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           FTAVSFQVLGHMKTILVLTLGFLFFGKEG+N  VVLGM +A++GM+WYGNASSK GGKER
Sbjct: 250 FTAVSFQVLGHMKTILVLTLGFLFFGKEGLNFHVVLGMMLAVIGMIWYGNASSKPGGKER 309



>gb:AP004185_1838691 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1301_C12.>gb:AP004276_1839654 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0453G03.
          Length = 345

 Score =  163 bits (412), Expect(2) = 1e-64
 Identities = 93/186 (50%), Positives = 119/186 (63%), Gaps = 4/186 (2%)
 Frame = -2

Query: 1109 EKK--AIIDTAAWTFNIVTSVGIIIVNKALMANFG--FSXXXXXXXXXXXXXXLMTLILK 942
            EKK  A+ D  AW  N+V+SVGII+ NK LM++ G  FS              L+  I  
Sbjct: 4    EKKPPAVSDVGAWAMNVVSSVGIIMANKQLMSSSGYAFSFATTLTGFHFTVTALVGWISN 63

Query: 941  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD 762
              GY    ++P  E + F L AN SI GMN+SLM NSVGFYQI+KLSMIPV CL+E VL+
Sbjct: 64   ATGYSVSKHVPLWELVWFSLVANTSITGMNLSLMLNSVGFYQISKLSMIPVVCLMEWVLN 123

Query: 761  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL 582
            S  Y+     ++++V  GV ICTVTDV VNAKGFI A +AV+ T+LQQ  +   Q+KY++
Sbjct: 124  SKHYTTKVISAVVVVAAGVGICTVTDVEVNAKGFICACVAVFCTSLQQITIGSFQKKYNI 183

Query: 581  GSFNLL 564
            GSF LL
Sbjct: 184  GSFELL 189



 Score =  107 bits (267), Expect(2) = 1e-64
 Identities = 50/106 (47%), Positives = 78/106 (73%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           TAP+QA SL+++GP  D +L  + +  Y+++  A   I+LSC++A+  N+SQ++CIGRF+
Sbjct: 192 TAPIQAVSLIILGPFADYYLNGRWLLNYNFSTGATFFILLSCSLAVFCNMSQYLCIGRFS 251

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           A SFQVLGHMKT+ VL LG++ F    + ++ +LGM +A++GMV Y
Sbjct: 252 ATSFQVLGHMKTVCVLILGWILF-DSALTVKNILGMLLAVMGMVVY 296



>gb:AB016888_1513166 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MDH9.
          Length = 350

 Score =  175 bits (443), Expect = 2e-42
 Identities = 94/208 (45%), Positives = 130/208 (62%), Gaps = 2/208 (0%)
 Frame = -2

Query: 1133 MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSXXXXXXXXXXXXXXL 960
            M++   +    A+ D  AW  N+++SVGII+ NK LM++  F FS              L
Sbjct: 1    MAAENERKSPSAVSDMGAWAMNVISSVGIIMANKQLMSSSGFAFSFATTLTGFHFALTAL 60

Query: 959  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL 780
            + ++    G+    ++P  E I F + AN SI  MN SLM NSVGFYQI+KLSMIPV C+
Sbjct: 61   VGMVSNATGFSASKHVPMWELIWFSIVANVSIAAMNFSLMLNSVGFYQISKLSMIPVVCV 120

Query: 779  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL 600
            +E +L S RYSR+ K+S+++V++GV ICTVTDV VNAKGFI A +A++S++LQQ  +  L
Sbjct: 121  MEWILHSKRYSREVKISVVVVVVGVGICTVTDVKVNAKGFICACVAIFSSSLQQILIGSL 180

Query: 599  QRKYSLGSFNLLGAYCTTTGCISAVGGP 516
            Q+KYS+GSF LL            V GP
Sbjct: 181  QKKYSIGSFELLSKTAPIQAFSLLVVGP 208



 Score =  109 bits (273), Expect = 1e-22
 Identities = 56/106 (52%), Positives = 76/106 (71%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           TAP+QA SLL+VGP+ D  L+ K +  Y+ +      I+LSC +A+  N+SQ++CIGRF+
Sbjct: 195 TAPIQAFSLLVVGPLVDYLLSGKFIMKYNMSSGCFLFILLSCGLAVFCNISQYLCIGRFS 254

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           AVSFQV+GHMKT+ +LTLG+L F    M  + V GM +AIVGMV Y
Sbjct: 255 AVSFQVIGHMKTVCILTLGWLLF-DSAMTFKNVAGMIVAIVGMVIY 299



>gb:AC084817_1733831 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0419C04, complete sequence.>gb:AC144741_1744220
            Oryza sativa (japonica cultivar-group) chromosome 5 clone
            OSJNBa0086E02, complete sequence.
          Length = 354

 Score =  102 bits (254), Expect(2) = 2e-42
 Identities = 58/189 (30%), Positives = 102/189 (53%)
 Frame = -2

Query: 1118 VKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKR 939
            V  EK  +    A + ++V+SV I+I NKALM++ GF+                  +   
Sbjct: 3    VGGEKFQLGTVGALSLSVVSSVSIVICNKALMSSLGFNFATTLTSWHLLVTFCSLHVALW 62

Query: 938  LGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDS 759
            + + +         + F +    SI  +N+SL +NSVGFYQ+ KL++IP + +LE +   
Sbjct: 63   MKFFEHKPFDSRTVMGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVILETLFFR 122

Query: 758  VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLG 579
             ++SR  +LS+ ++L GV + TVTD+ +NA G + + +A+ +T + Q   + +Q+K+ + 
Sbjct: 123  KKFSRSIQLSLSVLLFGVGVATVTDLQLNAVGSVLSLLAIITTCIAQIMTNTIQKKFKVS 182

Query: 578  SFNLLGAYC 552
            S  LL   C
Sbjct: 183  STQLLYQSC 191



 Score = 94.0 bits (232), Expect(2) = 2e-42
 Identities = 48/120 (40%), Positives = 77/120 (64%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           + P Q+ +L L+GP  D +LT+++V A+ YT   V  IVLSC I++  N S F+ IG+ +
Sbjct: 190 SCPYQSLTLFLIGPFLDGFLTNQNVFAFDYTSQVVFFIVLSCLISVSVNFSTFLVIGKTS 249

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKERVQ 197
            V++QVLGH+KT LVLT G++    +  + + +LG+ IA+VGMV Y    +  G ++  +
Sbjct: 250 PVTYQVLGHLKTCLVLTFGYVLL-HDPFSWRNILGILIAVVGMVLYSYFCTLEGQQKNAE 308



>pir|G86343|G86343 hypothetical protein T22I11.10 - Arabidopsis
            thaliana>gb:AE005172_891066 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:T22I11_1723800 Arabidopsis thaliana
            chromosome 1 BAC T22I11 sequence, complete sequence.
          Length = 348

 Score =  174 bits (440), Expect = 4e-42
 Identities = 98/204 (48%), Positives = 127/204 (62%), Gaps = 4/204 (1%)
 Frame = -2

Query: 1115 KDEKK--AIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSXXXXXXXXXXXXXXLMTLI 948
            ++EKK  A+ D  AW  N+ +SVGII+ NK LM++  FGFS              L+ ++
Sbjct: 5    ENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTALVGMV 64

Query: 947  LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV 768
                G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C++E V
Sbjct: 65   SNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVMEWV 124

Query: 767  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY 588
            L S  YSR+ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KY
Sbjct: 125  LHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKY 184

Query: 587  SLGSFNLLGAYCTTTGCISAVGGP 516
            S+GSF LL            + GP
Sbjct: 185  SIGSFELLSKTAPIQAISLLIFGP 208



 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/106 (53%), Positives = 77/106 (72%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           TAP+QA SLL+ GP  D +L+ + +  Y  T SA+  I+LSC +A+  N+SQ++CIGRF+
Sbjct: 195 TAPIQAISLLIFGPFVDYFLSGRFISTYKMTYSAMLCILLSCALAVFCNISQYLCIGRFS 254

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           A SFQVLGHMKT+ VLTLG+L F  E M  + + GM +A+VGMV Y
Sbjct: 255 ATSFQVLGHMKTVCVLTLGWLIFDSE-MTFKNIAGMVLAVVGMVIY 299



>gb:AY084463_1569553 Arabidopsis thaliana clone 108746 mRNA, complete
            sequence.
          Length = 348

 Score =  172 bits (437), Expect = 1e-41
 Identities = 96/208 (46%), Positives = 126/208 (60%), Gaps = 2/208 (0%)
 Frame = -2

Query: 1133 MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSXXXXXXXXXXXXXXL 960
            M  A  +++  A+ D  AW  N+ +SVGII+ NK LM++  FGFS              L
Sbjct: 1    MEKAENENKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTAL 60

Query: 959  MTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCL 780
            + ++    G     ++P  E + F L AN SI  MN SLM NSVGFYQI+KLSMIPV C+
Sbjct: 61   VGMVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCV 120

Query: 779  LEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL 600
            +E VL S  YSR+ K S+++V++GV ICTVTDV  NAKGFI A  AV+ST+LQQ  +  L
Sbjct: 121  MEWVLHSKHYSREVKASVMVVVVGVGICTVTDVKFNAKGFICACTAVFSTSLQQISIGSL 180

Query: 599  QRKYSLGSFNLLGAYCTTTGCISAVGGP 516
            Q+KYS+GSF LL            + GP
Sbjct: 181  QKKYSIGSFELLSKTAPIQAISLLIFGP 208



 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/106 (53%), Positives = 77/106 (72%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           TAP+QA SLL+ GP  D +L+ + +  Y  T SA+  I+LSC +A+  N+SQ++CIGRF+
Sbjct: 195 TAPIQAISLLIFGPFVDYFLSGRFISTYKMTYSAMLCILLSCALAVFCNISQYLCIGRFS 254

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           A SFQVLGHMKT+ VLTLG+L F  E M  + + GM +A+VGMV Y
Sbjct: 255 ATSFQVLGHMKTVCVLTLGWLIFDSE-MTFKNIAGMVLAVVGMVIY 299



>gb:AB060277_1521816 Oryza sativa GPT mRNA for putative
            glucose-6-phosphate/phosphate-tranlocator, complete cds.
          Length = 354

 Score =  101 bits (252), Expect(2) = 1e-41
 Identities = 58/189 (30%), Positives = 102/189 (53%)
 Frame = -2

Query: 1118 VKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKR 939
            V  EK  +    A + ++V+SV I+I NKALM++ GF+                  +   
Sbjct: 3    VGGEKFQLGTVGALSLSVVSSVSIVICNKALMSSLGFNFATTLTSWHLLVTFCSLHVALW 62

Query: 938  LGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDS 759
            + + +         + F +    SI  +N+SL +NSVGFYQ+ KL++IP + +LE +   
Sbjct: 63   MKFFEHKPFDSRTVMGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVILETLFFR 122

Query: 758  VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLG 579
             ++SR  +LS+ ++L GV + TVTD+ +NA G + + +A+ +T + Q   + +Q+K+ + 
Sbjct: 123  KKFSRSIQLSLSVLLFGVGVATVTDLQLNAVGSVLSSLAIITTCIAQIMTNTIQKKFKVS 182

Query: 578  SFNLLGAYC 552
            S  LL   C
Sbjct: 183  STQLLYQSC 191



 Score = 92.4 bits (228), Expect(2) = 1e-41
 Identities = 47/120 (39%), Positives = 77/120 (64%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           + P Q+ +L L+GP  D +LT+++V A+ YT   V  IVLSC I++  N S F+ IG+ +
Sbjct: 190 SCPYQSLTLFLIGPFLDGFLTNQNVFAFDYTSQVVFFIVLSCLISVSVNFSTFLVIGKTS 249

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKERVQ 197
            V++QVLGH+KT LVL  G++    + ++ + +LG+ IA+VGMV Y    +  G ++  +
Sbjct: 250 PVTYQVLGHLKTCLVLIFGYVLL-HDPLSWRNILGILIAVVGMVLYSYFCTLEGQQKNAE 308



>pir|A96795|A96795 unknown protein F28O16.4 [imported] - Arabidopsis
            thaliana>gb:AE005173_895198 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC010718_1537039 Arabidopsis thaliana
            chromosome 1 BAC F28O16 genomic sequence, complete
            sequence.>gb:AY039973_1560479 Arabidopsis thaliana
            unknown protein (At1g76670) mRNA, complete
            cds.>gb:AY058088_1564227 Arabidopsis thaliana
            At1g76670/F28O16_4 mRNA, complete
            cds.>gb:AY074532_1567576 Arabidopsis thaliana unknown
            protein (At1g76670) mRNA, complete
            cds.>gb:BT000556_1634834 Arabidopsis thaliana unknown
            protein (At1g76670/F28O16_4) mRNA, complete
            cds.>gb:AJ633721_1813083 Arabidopsis thaliana mRNA for
            UDP-galactose transporter (udpgalt2 gene).
          Length = 347

 Score =  171 bits (434), Expect = 2e-41
 Identities = 92/201 (45%), Positives = 124/201 (61%), Gaps = 2/201 (0%)
 Frame = -2

Query: 1112 DEKKAIIDTAAWTFNIVTSVGIIIVNKALMAN--FGFSXXXXXXXXXXXXXXLMTLILKR 939
            ++K A+ D  AW  N+++SVGII+ NK LM++  FGF               L+ ++   
Sbjct: 7    EKKSAVSDVGAWAMNVISSVGIIMANKQLMSSSGFGFGFATTLTGFHFAFTALVGMVSNA 66

Query: 938  LGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDS 759
             G     ++P  E + F + AN SI  MN SLM NSVGFYQI+KLSMIPV C+LE +L S
Sbjct: 67   TGLSASKHVPLWELLWFSIVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVLEWILHS 126

Query: 758  VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLG 579
              Y ++ K S+++V++GV ICTVTDV VNAKGFI A  AV+ST+LQQ  +  LQ+KYS+G
Sbjct: 127  KHYCKEVKASVMVVVIGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSLQKKYSVG 186

Query: 578  SFNLLGAYCTTTGCISAVGGP 516
            SF LL            + GP
Sbjct: 187  SFELLSKTAPIQAISLLICGP 207



 Score =  117 bits (294), Expect = 4e-25
 Identities = 64/125 (51%), Positives = 80/125 (64%), Gaps = 9/125 (7%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           TAP+QA SLL+ GP  D  L+ K +  Y  T  A+  I+LSC +A+  N+SQ++CIGRF+
Sbjct: 194 TAPIQAISLLICGPFVDYLLSGKFISTYQMTYGAIFCILLSCALAVFCNISQYLCIGRFS 253

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG---------NASS 224
           A SFQVLGHMKT+ VLTLG+L F  E M  + + GM IAIVGMV Y          NA S
Sbjct: 254 ATSFQVLGHMKTVCVLTLGWLLFDSE-MTFKNIAGMAIAIVGMVIYSWAVDIEKQRNAKS 312

Query: 223 KAGGK 209
              GK
Sbjct: 313 TPHGK 317



>gb:AK117643_1815668 Arabidopsis thaliana At1g21070 mRNA for unknown
            protein, complete cds, clone: RAFL17-30-F11.
          Length = 312

 Score =  144 bits (364), Expect = 3e-33
 Identities = 80/169 (47%), Positives = 102/169 (60%)
 Frame = -2

Query: 1022 ANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSL 843
            +  GFS              L+ ++    G     ++P  E + F L AN SI  MN SL
Sbjct: 4    SGLGFSFATTLTGFHFALTALVGMVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSL 63

Query: 842  MWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKG 663
            M NSVGFYQI+KLSMIPV C++E VL S  YSR+ K S+++V++GV ICTVTDV VNAKG
Sbjct: 64   MLNSVGFYQISKLSMIPVVCVMEWVLHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKG 123

Query: 662  FIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLLGAYCTTTGCISAVGGP 516
            FI A  AV+ST+LQQ  +  LQ+KYS+GSF LL            + GP
Sbjct: 124  FICACTAVFSTSLQQISIGSLQKKYSIGSFELLSKTAPIQAISLLIFGP 172



 Score =  115 bits (288), Expect = 2e-24
 Identities = 57/106 (53%), Positives = 77/106 (72%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           TAP+QA SLL+ GP  D +L+ + +  Y  T SA+  I+LSC +A+  N+SQ++CIGRF+
Sbjct: 159 TAPIQAISLLIFGPFVDYFLSGRFISTYKMTYSAMLCILLSCALAVFCNISQYLCIGRFS 218

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           A SFQVLGHMKT+ VLTLG+L F  E M  + + GM +A+VGMV Y
Sbjct: 219 ATSFQVLGHMKTVCVLTLGWLIFDSE-MTFKNIAGMVLAVVGMVIY 263



>gb:LMFL2185_1387820 Leishmania major Friedlin chromosome 19 cosmid
            L2185.>gb:LMFL2185_1387822 Leishmania major Friedlin
            chromosome 19 cosmid L2185.
          Length = 321

 Score = 80.1 bits (196), Expect(2) = 6e-27
 Identities = 47/170 (27%), Positives = 81/170 (47%), Gaps = 1/170 (0%)
 Frame = -2

Query: 1070 NIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIK 891
            N  +S+GI+  NK +    GFS              L   I + +G  +   +P  + + 
Sbjct: 15   NAFSSIGIVYTNKVIFTRHGFSYGTLLTVIHFFITTLGLFICRMMGVFEPKRIPVLKILP 74

Query: 890  FVL-FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVL 714
              + F  F  +  NVSL++NS+GFYQ+ K+   P+  +++ +     +S   KLS+ +  
Sbjct: 75   LCVGFCGFVALN-NVSLVYNSIGFYQLMKVLTTPMLVVIQTLFYQKTFSAKVKLSLTVTC 133

Query: 713  LGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            +GV + TV+D S N  G + A   +  T + Q +V   Q ++    F LL
Sbjct: 134  IGVGLSTVSDTSANLAGTVVALSTLLITCMYQIWVGTKQSEFQCDGFQLL 183



 Score = 64.7 bits (156), Expect(2) = 6e-27
 Identities = 38/116 (32%), Positives = 63/116 (54%)
 Frame = -3

Query: 553 APLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFTA 374
           AP+  A L+ +    D    D +   Y      + +I+ S  +A   N+S F+ IG+ + 
Sbjct: 187 APISCAMLMPMAYFAD----DLANKYYTPCWPTIIVIIFSGLLAFFVNISIFLVIGKTSP 242

Query: 373 VSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE 206
           V++ VLGH K  ++L LGFL+FG + MN ++ LG+ I + G+ WY +   +   KE
Sbjct: 243 VTYNVLGHFKLCVILFLGFLWFGDQ-MNARIFLGIVITLFGVFWYTHLKMQEEKKE 297



>gb:AP002912_1823881 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0028E10.>gb:AP003301_1827683 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0701D05.>gb:AP003339_1828249 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:OJ1276_B06.
          Length = 356

 Score =  102 bits (255), Expect = 1e-20
 Identities = 60/201 (29%), Positives = 105/201 (52%)
 Frame = -2

Query: 1118 VKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKR 939
            V  EK  +    A + ++V+SV I+I NKALM++ GF+                  +   
Sbjct: 3    VTGEKFQLGTVGALSLSVVSSVSIVICNKALMSSLGFNFATTLTSWHLLVTFCSLHVALC 62

Query: 938  LGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDS 759
            +   +         + F +    SI  +N+SL +NSVGFYQ+ KL++IP + +LE +   
Sbjct: 63   MKLFEHKPFDARTVMGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVILETLFFR 122

Query: 758  VRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLG 579
             ++SR+ +LS+ ++L GV + TVTD+ +NA G + + +A+ +T + Q   + +Q+K+ + 
Sbjct: 123  KKFSRNIQLSLSVLLFGVGVATVTDLQLNAVGSVLSLLAIITTCIAQIMTNTIQKKFKVS 182

Query: 578  SFNLLGAYCTTTGCISAVGGP 516
            S  LL   C        + GP
Sbjct: 183  STQLLYQSCPYQALTLFIVGP 203



 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/112 (41%), Positives = 73/112 (65%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           + P QA +L +VGP  D +LT+++V A+ YT   V  IVLSC I++  N S F+ IG+ +
Sbjct: 190 SCPYQALTLFIVGPFLDGFLTNQNVFAFDYTSQVVFFIVLSCLISVSVNFSTFLVIGKTS 249

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSK 221
            V++QVLGH+KT LVL  G++    +  + + +LG+ IA++GMV Y    +K
Sbjct: 250 PVTYQVLGHLKTCLVLAFGYVLL-HDPFSWRNILGILIAVIGMVSYSYFCTK 300



>gb:AC024594_1539349 Oryza sativa chromosome 10 BAC OSJNBa0093B11
            genomic sequence, complete sequence.
          Length = 370

 Score =  102 bits (254), Expect = 2e-20
 Identities = 59/185 (31%), Positives = 97/185 (52%)
 Frame = -2

Query: 1070 NIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIK 891
            ++ +SV I+I NK L++  GF                   + +RL + +   +     I 
Sbjct: 21   SVTSSVAIVICNKYLISTLGFFFATTLTSWHLMVTFCTLYVAQRLRFFEAKPIDAQTVIS 80

Query: 890  FVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLL 711
            F L    SI  +N+ L +NSVGFYQ+ KL++IP + LLE +  S ++SR  K+S++++LL
Sbjct: 81   FGLLNGISIGLLNLCLGFNSVGFYQMTKLAIIPFTMLLETIFLSKKFSRSIKISLMVLLL 140

Query: 710  GVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLLGAYCTTTGCIS 531
            GV I +VTD+ +N  G I A + + +T + Q   + +QR+  + S  LL         + 
Sbjct: 141  GVGIASVTDLQLNLLGSIIAVLTIAATCVSQILTNQIQRRLKVSSTQLLYQSSPYQSAVL 200

Query: 530  AVGGP 516
             V GP
Sbjct: 201  LVTGP 205



 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 46/106 (43%), Positives = 70/106 (66%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           ++P Q+A LL+ GP  DK LT++ V A+ YT   V+ IVLSC+IA+  N S F+ IG  +
Sbjct: 192 SSPYQSAVLLVTGPFVDKLLTNRDVFAFTYTFQVVAFIVLSCSIAVCVNFSTFLVIGTTS 251

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
            V++QVLGH+KT L+L+ G++   ++    + V G+ +AI GM  Y
Sbjct: 252 PVTYQVLGHLKTCLILSFGYVLL-RDPFTFRNVAGILVAIFGMGLY 296



>gb:BT002471_1636074 Arabidopsis thaliana putative integral membrane
            protein (At2g30460) mRNA, complete
            cds.>gb:BT008742_1639938 Arabidopsis thaliana At2g30460
            gene, complete cds.>gb:AK176166_1818154 Arabidopsis
            thaliana mRNA for integral membrane protein -like,
            complete cds, clone: RAFL23-02-C03.>gb:AK176178_1818166
            Arabidopsis thaliana mRNA for integral membrane protein
            -like, complete cds, clone:
            RAFL23-04-K15.>gb:AK176274_1818262 Arabidopsis thaliana
            mRNA for integral membrane protein -like, complete cds,
            clone: RAFL23-19-D12.
          Length = 353

 Score =  101 bits (252), Expect = 3e-20
 Identities = 62/202 (30%), Positives = 105/202 (51%), Gaps = 1/202 (0%)
 Frame = -2

Query: 1118 VKDEKKAIIDT-AAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILK 942
            + D +K  + T  A + ++V+SV I+I NKAL++  GF+                  +  
Sbjct: 1    MSDAQKFQLGTIGALSLSVVSSVSIVICNKALISTLGFTFATTLTSWHLLVTFCSLHVAL 60

Query: 941  RLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLD 762
             + + +         + F +    SI  +N+SL +NSVGFYQ+ KL++IP + +LE +  
Sbjct: 61   WMKFFEHKPFDPRAVLGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVVLETIFF 120

Query: 761  SVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSL 582
               +SR  + S++++LLGV I TVTD+ +N  G + + +AV +T + Q   + +Q+KY +
Sbjct: 121  RKMFSRKIQFSLVILLLGVGIATVTDLQLNMLGSVLSLLAVITTCVAQIMTNTIQKKYKV 180

Query: 581  GSFNLLGAYCTTTGCISAVGGP 516
             S  LL   C        V GP
Sbjct: 181  SSTQLLYQSCPYQAITLFVTGP 202



 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 46/106 (43%), Positives = 70/106 (66%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           + P QA +L + GP  D  LT+++V A+ YT   V  IVLSC I++  N S F+ IG+ +
Sbjct: 189 SCPYQAITLFVTGPFLDGLLTNQNVFAFKYTSQVVFFIVLSCLISVSVNFSTFLVIGKTS 248

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
            V++QVLGH+KT LVL  G+L   K+  + + +LG+ +A++GMV Y
Sbjct: 249 PVTYQVLGHLKTCLVLAFGYLLL-KDAFSWRNILGILVAVIGMVLY 293



>gb:AP006168_1861220 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1469H02.
          Length = 341

 Score =  100 bits (248), Expect = 8e-20
 Identities = 57/187 (30%), Positives = 97/187 (51%)
 Frame = -2

Query: 1076 TFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSER 897
            T ++ +SV I+I NKAL++  GF                   + +R+ + +   +     
Sbjct: 14   TLSVASSVSIVICNKALISTLGFPFATTLTSWHLMVTFCTLHVAQRMRFFEPKAIDGQTV 73

Query: 896  IKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLV 717
            I F L    SI  +N+SL +NS+GFYQ+ KL++IP + +LE +    R+S   K S+L++
Sbjct: 74   ILFGLLNGTSIGLLNLSLGFNSIGFYQMTKLAIIPFTVMLETIFLKKRFSESIKFSLLIL 133

Query: 716  LLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLLGAYCTTTGC 537
            LLGV I +VTD+ +N  G + + +A+ +T + Q   + +Q++  + S  LL         
Sbjct: 134  LLGVGIASVTDLKLNLLGSVLSGLAIATTCVGQILTNTIQKRLKVSSTQLLYQSAPYQAA 193

Query: 536  ISAVGGP 516
            I    GP
Sbjct: 194  ILFATGP 200



 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 50/117 (42%), Positives = 70/117 (59%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           +AP QAA L   GP  D+ LT +SV A+ YT   V  IVLSC IA+  N S F+ IG  +
Sbjct: 187 SAPYQAAILFATGPFVDQLLTSRSVFAHKYTAPVVGFIVLSCLIAVSVNFSTFLVIGTTS 246

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKE 206
            V++QVLGH+KT LVL+ G+     +   ++ +LG+ +AI GM  Y   S +   K+
Sbjct: 247 PVTYQVLGHLKTCLVLSFGYTLL-HDPFTMRNILGILVAIFGMALYSYFSVRESKKK 302



>gb:AY087465_1572496 Arabidopsis thaliana clone 35741 mRNA, complete
            sequence.
          Length = 397

 Score = 77.8 bits (190), Expect(2) = 2e-19
 Identities = 55/186 (29%), Positives = 85/186 (45%), Gaps = 4/186 (2%)
 Frame = -2

Query: 1136 KMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLM 957
            K S    + +++      A +FN V +VGII+ NK +M   GF+              ++
Sbjct: 41   KTSEGAKRQQQRFCGPVVAMSFNFVVAVGIILANKLVMGRVGFNFPIFLTLIHYTVAWIL 100

Query: 956  TLILKRLGYIQDS----NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPV 789
                K L  +  S      P+S          F+    N SL  NSVGFYQ+AK+++ P 
Sbjct: 101  LAFFKSLSLLPMSPPSKTTPFSSLFSLGAVMAFASGLANTSLKHNSVGFYQMAKIAVTPT 160

Query: 788  SCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYV 609
              L E VL     S    +++ +V LGVAI TVTD+  N  G + A   +  +A+ +   
Sbjct: 161  IVLAEFVLFKKTISSTKVMALAVVSLGVAIATVTDLEFNLFGALVAVAWIIPSAINKILW 220

Query: 608  HFLQRK 591
              LQ++
Sbjct: 221  SNLQQQ 226



 Score = 42.0 bits (97), Expect(2) = 2e-19
 Identities = 33/113 (29%), Positives = 52/113 (46%)
 Frame = -3

Query: 577 LSIYWGHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQF 398
           L++ W  T P     LL + P    WL    V  + + L+  S I++S  +      S  
Sbjct: 232 LALMW-KTTPFTVFFLLALMP----WLDPPGVLLFKWDLTNSSAILISALLGFLLQWSGA 286

Query: 397 ICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           + +G  +A S  VLG  KT ++L  G++ FG +   I  + G   A+ GM  Y
Sbjct: 287 LALGATSATSHVVLGQFKTCVILLGGYVIFGSDPGFIS-ICGAVAALGGMSVY 338



>gb:AY080815_1568513 Arabidopsis thaliana unknown protein (At1g06890)
            mRNA, complete cds.>gb:AY117281_1579322 Arabidopsis
            thaliana unknown protein (At1g06890) mRNA, complete cds.
          Length = 357

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 59/189 (31%), Positives = 98/189 (51%)
 Frame = -2

Query: 1082 AWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWS 903
            A + ++V+SV I+I NKAL++  GF+                  +   +   +       
Sbjct: 14   ALSLSVVSSVSIVICNKALISTLGFTFATTLTSWHLLVTFCSLHVALWMKMFEHKPFDPR 73

Query: 902  ERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSIL 723
              + F +    SI  +N+SL +NSVGFYQ+ KL++IP + LLE +    ++SR  + S+ 
Sbjct: 74   AVMGFGILNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTVLLETLFFRKKFSRKIQFSLT 133

Query: 722  LVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLLGAYCTTT 543
            ++LLGV I TVTD+ +N  G + + +AV +T + Q   + +Q+K+ + S  LL   C   
Sbjct: 134  ILLLGVGIATVTDLQLNMLGSVLSLLAVVTTCVAQIMTNTIQKKFKVSSTQLLYQSCPYQ 193

Query: 542  GCISAVGGP 516
                 V GP
Sbjct: 194  AITLFVTGP 202



 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/106 (41%), Positives = 70/106 (66%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           + P QA +L + GP  D  LT+++V A+ YT   V  IVLSC I++  N S F+ IG+ +
Sbjct: 189 SCPYQAITLFVTGPFLDGLLTNQNVFAFKYTSQVVFFIVLSCLISVSVNFSTFLVIGKTS 248

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
            V++QVLGH+KT LVL  G++   ++  + + +LG+ +A++GMV Y
Sbjct: 249 PVTYQVLGHLKTCLVLAFGYVLL-RDPFDWRNILGILVAVIGMVVY 293



>gb:AB026659_1517380 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MYN21.
          Length = 398

 Score = 77.8 bits (190), Expect(2) = 2e-19
 Identities = 55/186 (29%), Positives = 85/186 (45%), Gaps = 4/186 (2%)
 Frame = -2

Query: 1136 KMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLM 957
            K S    + +++      A +FN V +VGII+ NK +M   GF+              ++
Sbjct: 42   KTSEGAKRQQQRFCGPVVAMSFNFVVAVGIILANKLVMGRVGFNFPIFLTLIHYTVAWIL 101

Query: 956  TLILKRLGYIQDS----NLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPV 789
                K L  +  S      P+S          F+    N SL  NSVGFYQ+AK+++ P 
Sbjct: 102  LAFFKSLSLLPMSPPSKTTPFSSLFSLGAVMAFASGLANTSLKHNSVGFYQMAKIAVTPT 161

Query: 788  SCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYV 609
              L E VL     S    +++ +V LGVAI TVTD+  N  G + A   +  +A+ +   
Sbjct: 162  IVLAEFVLFKKTISSTKVMALAVVSLGVAIATVTDLEFNLFGALVAVAWIIPSAINKILW 221

Query: 608  HFLQRK 591
              LQ++
Sbjct: 222  SNLQQQ 227



 Score = 41.6 bits (96), Expect(2) = 2e-19
 Identities = 33/113 (29%), Positives = 52/113 (46%)
 Frame = -3

Query: 577 LSIYWGHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQF 398
           L++ W  T P     LL + P    WL    V  + + L+  S I++S  +      S  
Sbjct: 233 LALMW-KTTPFTVFFLLALMP----WLDPPGVLLFKWDLTNSSAILISALLGFLLQWSGA 287

Query: 397 ICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           + +G  +A S  VLG  KT ++L  G++ FG +   I  + G   A+ GM  Y
Sbjct: 288 LALGATSATSHVVLGQFKTCVILLGGYVIFGSDPGFIS-ICGAIAALGGMSVY 339



>gb:BC006601_2090235 Mus musculus solute carrier family 35, member E3,
            mRNA (cDNA clone MGC:11712 IMAGE:3965585), complete
            cds.>gb:BC057101_2102594 Mus musculus solute carrier
            family 35, member E3, mRNA (cDNA clone MGC:73484
            IMAGE:5720169), complete cds.
          Length = 313

 Score = 65.5 bits (158), Expect(2) = 4e-18
 Identities = 45/174 (25%), Positives = 82/174 (47%)
 Frame = -2

Query: 1085 AAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPW 906
            A   FN++ S+ I+ +NK +  + GF                +  I ++L      +LP 
Sbjct: 16   AGLLFNLLVSICIVFLNKWIYVHHGFPNMSLTLVHFVVTWLGL-YICQKLNIFAPKSLPL 74

Query: 905  SERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSI 726
            S+ +   L     +V  N+SL  N++G YQ+AK    PV   ++      R+S   +L++
Sbjct: 75   SKLLLLALSFCGFVVFTNLSLQNNTIGTYQLAKAMTTPVIIAIQTFWYQKRFSVRIQLTL 134

Query: 725  LLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            + + +GV + +  DV  ++ G + A + V  T+L Q +V   Q +  + S  LL
Sbjct: 135  IPITVGVILNSYYDVKFHSLGMVFAALGVVVTSLYQVWVGAKQHELQVNSMQLL 188



 Score = 49.7 bits (117), Expect(2) = 4e-18
 Identities = 32/122 (26%), Positives = 66/122 (54%), Gaps = 2/122 (1%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           + AP+ +A LL+  P  +    +  +    +++SA+ +++LS  IA   NLS +  IG  
Sbjct: 190 YQAPMSSAMLLVAVPFFEPVFAEGGIFG-PWSVSALLMVLLSGIIAFMVNLSIYWIIGNT 248

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGN--ASSKAGGKE 206
           + V++ + GH K  + L  G++ F K+ +++   LG+   + G++ Y +   S + G K 
Sbjct: 249 SPVTYNMFGHFKFCITLCGGYILF-KDPLSVNQGLGILCTLFGILTYTHFKLSEQEGSKS 307

Query: 205 RV 200
           ++
Sbjct: 308 KL 309



>gb:AY358943_1947822 Homo sapiens clone DNA125170 BLOV1 (UNQ3043)
            mRNA, complete cds.>gb:BC008412_1971365 Homo sapiens
            solute carrier family 35, member E3, mRNA (cDNA clone
            MGC:14550 IMAGE:4280446), complete
            cds.>gb:BC030504_1979803 Homo sapiens solute carrier
            family 35, member E3, mRNA (cDNA clone MGC:40294
            IMAGE:3900045), complete cds.
          Length = 313

 Score = 63.9 bits (154), Expect(2) = 2e-17
 Identities = 46/174 (26%), Positives = 78/174 (44%)
 Frame = -2

Query: 1085 AAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPW 906
            A   FN++ S+ I+ +NK +    GF                +  I ++L      +LP 
Sbjct: 16   AGLLFNLLVSICIVFLNKWIYVYHGFPNMSLTLVHFVVTWLGL-YICQKLDIFAPKSLPP 74

Query: 905  SERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSI 726
            S  +   L     +V  N+SL  N++G YQ+AK    PV   ++       +S   +L++
Sbjct: 75   SRLLLLALSFCGFVVFTNLSLQNNTIGTYQLAKAMTTPVIIAIQTFCYQKTFSTRIQLTL 134

Query: 725  LLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            + + LGV + +  DV  N  G + A + V  T+L Q +V   Q +  + S  LL
Sbjct: 135  IPITLGVILNSYYDVKFNFLGMVFAALGVLVTSLYQVWVGAKQHELQVNSMQLL 188



 Score = 48.5 bits (114), Expect(2) = 2e-17
 Identities = 30/107 (28%), Positives = 59/107 (55%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           + AP+ +A LL+  P  +    +  +    +++SA+ +++LS  IA   NLS +  IG  
Sbjct: 190 YQAPMSSAMLLVAVPFFEPVFGEGGIFG-PWSVSALLMVLLSGVIAFMVNLSIYWIIGNT 248

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           + V++ + GH K  + L  G++ F K+ ++I   LG+   + G++ Y
Sbjct: 249 SPVTYNMFGHFKFCITLFGGYVLF-KDPLSINQALGILCTLFGILAY 294



>gb:AE016959_1023110 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC037425_1540029
           Oryza sativa chromosome 10 BAC OSJNBa0055P24 genomic
           sequence, complete sequence.>gb:AE017106_1752929 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           60 of 77 of the complete sequence.
          Length = 342

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 46/106 (43%), Positives = 70/106 (66%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           ++P Q+A LL+ GP  DK LT++ V A+ YT   V+ IVLSC+IA+  N S F+ IG  +
Sbjct: 164 SSPYQSAVLLVTGPFVDKLLTNRDVFAFTYTFQVVAFIVLSCSIAVCVNFSTFLVIGTTS 223

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
            V++QVLGH+KT L+L+ G++   ++    + V G+ +AI GM  Y
Sbjct: 224 PVTYQVLGHLKTCLILSFGYVLL-RDPFTFRNVAGILVAIFGMGLY 268



 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 45/185 (24%), Positives = 80/185 (43%)
 Frame = -2

Query: 1070 NIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIK 891
            ++ +SV I+I NK L++  GF                   + +RL + +           
Sbjct: 21   SVTSSVAIVICNKYLISTLGFFFATTLTSWHLMVTFCTLYVAQRLRFFEAK--------- 71

Query: 890  FVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLL 711
                                +    + KL++IP + LLE +  S ++SR  K+S++++LL
Sbjct: 72   -------------------PIDAQTMTKLAIIPFTMLLETIFLSKKFSRSIKISLMVLLL 112

Query: 710  GVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLLGAYCTTTGCIS 531
            GV I +VTD+ +N  G I A + + +T + Q   + +QR+  + S  LL         + 
Sbjct: 113  GVGIASVTDLQLNLLGSIIAVLTIAATCVSQILTNQIQRRLKVSSTQLLYQSSPYQSAVL 172

Query: 530  AVGGP 516
             V GP
Sbjct: 173  LVTGP 177



>gb:AL935183_2504896 Zebrafish DNA sequence from clone DKEYP-86A5 in
            linkage group 4 Contains the 5' end of the gene for a
            novel protein similar to vertebrate atrophin-1
            interacting protein (AIP1) and two novel genes, complete
            sequence.
          Length = 317

 Score = 66.6 bits (161), Expect(2) = 5e-17
 Identities = 46/169 (27%), Positives = 80/169 (47%)
 Frame = -2

Query: 1070 NIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIK 891
            N+++SV I+ +NK +  ++GF                + +  K   +   S  P    + 
Sbjct: 25   NLLSSVCIVFINKWIYVHYGFPNMTLTLIHFVMTWLGLFICQKMDIFAPKSLRPSKILLL 84

Query: 890  FVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLL 711
             + F  F +V  N+SL  N++G YQ+AK+   PV   ++ +     +S   KL+++ + L
Sbjct: 85   ALSFCGF-VVFTNLSLQSNTIGTYQLAKVMTTPVIIAIQTMYYRKTFSTKIKLTLVPITL 143

Query: 710  GVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            GV + +  DV  N  G I A + V  T+L Q +V   Q +  + S  LL
Sbjct: 144  GVILNSYYDVRFNLMGMIFATLGVLVTSLYQVWVGAKQHELQVNSMQLL 192



 Score = 44.7 bits (104), Expect(2) = 5e-17
 Identities = 31/122 (25%), Positives = 65/122 (53%), Gaps = 2/122 (1%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           + AP+ +A LL++ P  +    D  +    ++  A+ +++LS  IA   NLS +  IG  
Sbjct: 194 YQAPMSSAFLLVLVPFFEPLTGDGGIFG-PWSFLALFMVLLSGVIAFLVNLSIYWIIGNT 252

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGN--ASSKAGGKE 206
           + V++ + GH K  + L  G++ F ++ +++   LG+   + G++ Y +   + +  GK 
Sbjct: 253 SPVTYNMFGHFKFCITLLGGYVLF-QDPLSLNQGLGILCTLTGILAYTHFKLAEQEEGKS 311

Query: 205 RV 200
           R+
Sbjct: 312 RL 313



>pir|F86203|F86203 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889694 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC011001_1537174 Arabidopsis thaliana
           chromosome I BAC F4H5 genomic sequence, complete
           sequence.
          Length = 255

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/106 (41%), Positives = 70/106 (66%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           + P QA +L + GP  D  LT+++V A+ YT   V  IVLSC I++  N S F+ IG+ +
Sbjct: 87  SCPYQAITLFVTGPFLDGLLTNQNVFAFKYTSQVVFFIVLSCLISVSVNFSTFLVIGKTS 146

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
            V++QVLGH+KT LVL  G++   ++  + + +LG+ +A++GMV Y
Sbjct: 147 PVTYQVLGHLKTCLVLAFGYVLL-RDPFDWRNILGILVAVIGMVVY 191



 Score = 64.7 bits (156), Expect = 4e-09
 Identities = 34/100 (34%), Positives = 57/100 (57%)
 Frame = -2

Query: 815 IAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVW 636
           + KL++IP + LLE +    ++SR  + S+ ++LLGV I TVTD+ +N  G + + +AV 
Sbjct: 1   MTKLAIIPCTVLLETLFFRKKFSRKIQFSLTILLLGVGIATVTDLQLNMLGSVLSLLAVV 60

Query: 635 STALQQYYVHFLQRKYSLGSFNLLGAYCTTTGCISAVGGP 516
           +T + Q   + +Q+K+ + S  LL   C        V GP
Sbjct: 61  TTCVAQIMTNTIQKKFKVSSTQLLYQSCPYQAITLFVTGP 100



>gb:BT003153_1636734 Arabidopsis thaliana At5g57100 mRNA, complete
            cds.
          Length = 390

 Score = 71.2 bits (173), Expect(2) = 5e-16
 Identities = 53/172 (30%), Positives = 84/172 (48%), Gaps = 6/172 (3%)
 Frame = -2

Query: 1088 TAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLP 909
            T A TFN V ++ II +NK ++ N GF               L+  +LK   ++  S  P
Sbjct: 65   TVALTFNFVVAISIIFMNKWVLKNIGFEFPVFLTFIHYIVAYLLMALLKSFSFLPAS--P 122

Query: 908  WSERIKFVLFANFSIV-----GM-NVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYS 747
             S +   +      IV     G+ NVSL +NSVGFYQ+AK+++ P     E +    R S
Sbjct: 123  PSTKSSLLPLYTLGIVMSLSTGLANVSLKYNSVGFYQMAKIAVTPSIVFAEFLWYRKRVS 182

Query: 746  RDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK 591
                +S+ +V +GVA+ TVTD+  +  G   AF  +  +A  +     +Q++
Sbjct: 183  FMKVVSLTVVSVGVAVATVTDLQFSLFGACVAFAWIIPSATNKILWSNMQQR 234



 Score = 36.6 bits (83), Expect(2) = 5e-16
 Identities = 29/113 (25%), Positives = 53/113 (46%)
 Frame = -3

Query: 577 LSIYWGHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQF 398
           L++ W  T P+    L+ + P  D         +++++L+  S I++S  +      S  
Sbjct: 240 LALMW-KTTPITLLFLVSMIPFLDP----PGALSFNWSLTNTSAILVSALLGFFLQWSGA 294

Query: 397 ICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           + +G  +A++  VLG  KT ++L   +  FG     I V  G  +AI+G   Y
Sbjct: 295 LALGATSAITHVVLGQFKTCVLLLGNYYIFGSNSGFISVG-GAFVAIMGTSLY 346



>gb:AB023042_1515470 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MUL3.
          Length = 390

 Score = 69.7 bits (169), Expect(2) = 2e-15
 Identities = 53/172 (30%), Positives = 83/172 (48%), Gaps = 6/172 (3%)
 Frame = -2

Query: 1088 TAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLP 909
            T A TFN V ++ II +NK ++ N GF               L+  +LK    +  S  P
Sbjct: 65   TVALTFNFVVAISIIFMNKWVLKNIGFEFPVFLTFIHYIVAYLLMALLKSFSLLPAS--P 122

Query: 908  WSERIKFVLFANFSIV-----GM-NVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYS 747
             S +   +      IV     G+ NVSL +NSVGFYQ+AK+++ P     E +    R S
Sbjct: 123  PSTKSSLLPLYTLGIVMSLSTGLANVSLKYNSVGFYQMAKIAVTPSIVFAEFLWYRKRVS 182

Query: 746  RDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK 591
                +S+ +V +GVA+ TVTD+  +  G   AF  +  +A  +     +Q++
Sbjct: 183  FMKVVSLTVVSVGVAVATVTDLQFSLFGACVAFAWIIPSATNKILWSNMQQR 234



 Score = 36.6 bits (83), Expect(2) = 2e-15
 Identities = 29/113 (25%), Positives = 53/113 (46%)
 Frame = -3

Query: 577 LSIYWGHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQF 398
           L++ W  T P+    L+ + P  D         +++++L+  S I++S  +      S  
Sbjct: 240 LALMW-KTTPITLLFLVSMIPFLDP----PGALSFNWSLTNTSAILVSALLGFFLQWSGA 294

Query: 397 ICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           + +G  +A++  VLG  KT ++L   +  FG     I V  G  +AI+G   Y
Sbjct: 295 LALGATSAITHVVLGQFKTCVLLLGNYYIFGSNSGFISVG-GAFVAIMGTSLY 346



>gb:AY085537_1570606 Arabidopsis thaliana clone 156439 mRNA, complete
            sequence.
          Length = 384

 Score = 69.7 bits (169), Expect(2) = 2e-15
 Identities = 53/172 (30%), Positives = 83/172 (48%), Gaps = 6/172 (3%)
 Frame = -2

Query: 1088 TAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLP 909
            T A TFN V ++ II +NK ++ N GF               L+  +LK    +  S  P
Sbjct: 59   TVALTFNFVVAISIIFMNKWVLKNIGFEFPVFLTFIHYIVAYLLMALLKSFSLLPAS--P 116

Query: 908  WSERIKFVLFANFSIV-----GM-NVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYS 747
             S +   +      IV     G+ NVSL +NSVGFYQ+AK+++ P     E +    R S
Sbjct: 117  PSTKSSLLPLYTLGIVMSLSTGLANVSLKYNSVGFYQMAKIAVTPSIVFAEFLWYRKRVS 176

Query: 746  RDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK 591
                +S+ +V +GVA+ TVTD+  +  G   AF  +  +A  +     +Q++
Sbjct: 177  FMKVVSLTVVSVGVAVATVTDLQFSLFGACVAFAWIIPSATNKILWSNMQQR 228



 Score = 36.6 bits (83), Expect(2) = 2e-15
 Identities = 29/113 (25%), Positives = 53/113 (46%)
 Frame = -3

Query: 577 LSIYWGHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQF 398
           L++ W  T P+    L+ + P  D         +++++L+  S I++S  +      S  
Sbjct: 234 LALMW-KTTPITLLFLVSMIPFLDP----PGALSFNWSLTNTSAILVSALLGFFLQWSGA 288

Query: 397 ICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           + +G  +A++  VLG  KT ++L   +  FG     I V  G  +AI+G   Y
Sbjct: 289 LALGATSAITHVVLGQFKTCVLLLGNYYIFGSNSGFISVG-GAFVAIMGTSLY 340



>gb:AF148713_1886177 Homo sapiens bladder cancer overexpressed
           protein (BLOV1) mRNA, complete cds.
          Length = 354

 Score = 55.8 bits (133), Expect(2) = 4e-14
 Identities = 37/129 (28%), Positives = 62/129 (48%)
 Frame = -2

Query: 950 ILKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEV 771
           I ++L      +LP S  +   L     +V  N+SL  N++G YQ+AK    PV   ++ 
Sbjct: 101 ICQKLDIFAPKSLPPSRLLLLALSFCGFVVFTNLSLQNNTIGTYQLAKAMTTPVIIAIQT 160

Query: 770 VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK 591
                 +S   +L+++ + LGV + +  DV  N  G + A + V  T+L Q +V   Q +
Sbjct: 161 FCYQKTFSTRIQLTLIPITLGVILNSYYDVKFNFLGMVFAALGVLVTSLYQVWVGAKQHE 220

Query: 590 YSLGSFNLL 564
             + S  LL
Sbjct: 221 LQVNSMQLL 229



 Score = 45.8 bits (107), Expect(2) = 4e-14
 Identities = 29/107 (27%), Positives = 58/107 (54%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           + AP+ +A LL+  P  +    +  +    +++SA+ +++LS  IA   NLS +  IG  
Sbjct: 231 YQAPMSSAMLLVAVPFFEPVFGEGGIFG-PWSVSALLMVLLSGVIAFMVNLSIYWIIGNT 289

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY 239
           + V++ + GH K  + L  G++ F K+ ++I   L +   + G++ Y
Sbjct: 290 SPVTYNMFGHFKFCIALFGGYVLF-KDPLSINQALDILCTLFGILAY 335



>gb:AP005113_1848087 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0685G12.
          Length = 514

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 55/201 (27%), Positives = 96/201 (47%), Gaps = 5/201 (2%)
 Frame = -2

Query: 1130 SSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTL 951
            S    + +++    + A TFN   +VGII+ NK +M + GF               ++  
Sbjct: 182  SEGAKRQQQRFCGPSVALTFNFAVAVGIIMANKMVMGSVGFKFPIALSLIHYAVAFVLMA 241

Query: 950  ILKRLGYIQDSNLPWSERIKFV-LFANFSIVGMNVSLMWN----SVGFYQIAKLSMIPVS 786
            ILK +  +  +  P S+   F  LFA  +++ ++  L  N    SVGFYQ+AK+++ P  
Sbjct: 242  ILKTMSMLPVA--PPSKSTPFSSLFALGAVMSLSTGLANNFPLFSVGFYQMAKIAVTPTI 299

Query: 785  CLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVH 606
             + E ++   R S    +++ +V  GVA+ TVTD+  N  G + A   +  +A+ +    
Sbjct: 300  VVAEFMIFQKRVSSQKVITLAIVSFGVAVATVTDLEFNFFGAVVALAWIVPSAVNKILWS 359

Query: 605  FLQRKYSLGSFNLLGAYCTTT 543
             LQ+    G++  L     TT
Sbjct: 360  NLQQS---GNWTALALMWKTT 377



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 3/127 (2%)
 Frame = -3

Query: 577 LSIYWGHTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQF 398
           L++ W  T P+    LL + P+ D       +  + +       I++S         S  
Sbjct: 370 LALMW-KTTPVTIFFLLALMPLLDP----PGLLLFDWNFRNSLAIIISALFGFLLQWSGA 424

Query: 397 ICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWY---GNAS 227
           + +G  +A+S  VLG  KTI+++  G+L F  +   I  + G  +A+ GM  Y   G   
Sbjct: 425 LALGATSALSHVVLGQFKTIVIMLSGYLIFSSD-PGITSICGAIVALGGMSVYTYLGLKE 483

Query: 226 SKAGGKE 206
           S   GK+
Sbjct: 484 STTTGKK 490



>gb:AY648822_2541650 Danio rerio UDP-glucuronic
            acid/UDP-N-acetylgalactosamine dual transporter mRNA,
            complete cds.
          Length = 336

 Score = 41.2 bits (95), Expect(2) = 1e-06
 Identities = 38/196 (19%), Positives = 84/196 (42%), Gaps = 4/196 (2%)
 Frame = -2

Query: 1139 RKMSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXL 960
            R  ++ + +     ++  +A  F  ++S  I++VNK+++ N+ F               +
Sbjct: 7    RNEAAGMAEQTLTVLLKLSAAGFYGISSFLIVVVNKSVLTNYRFPSSICVGIGQMLATVV 66

Query: 959  MTLILKRLGYIQ----DSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIP 792
            +  + K L  I     D ++P       +L+    I G+  +   N   F  + + S++ 
Sbjct: 67   VLRVGKALRVITFPEFDGSIPRKTFPLPLLYVGNQITGLFGTKRLNLPMFTVLRRFSIL- 125

Query: 791  VSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYY 612
             + L E  L   ++SR  +L++  ++LG  +    D++ + +G++   +    TA    +
Sbjct: 126  FTMLAEGFLLKKKFSRPVQLTVFTMILGAFVAASADLAFDLQGYVFILMNDVLTAANGAF 185

Query: 611  VHFLQRKYSLGSFNLL 564
            V        LG + LL
Sbjct: 186  VKQKLDSKELGKYGLL 201



 Score = 34.7 bits (78), Expect(2) = 1e-06
 Identities = 20/72 (27%), Positives = 36/72 (50%)
 Frame = -3

Query: 454 VSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVL 275
           +S   LSC +      S  +C    +A++  ++G +K ILV  +G +F G    +    +
Sbjct: 237 ISQFFLSCIMGFILMYSTVLCTQYNSALTTTIVGCLKNILVTYIGMVFGGDYIFSWTNFI 296

Query: 274 GMGIAIVGMVWY 239
           G+ I+I G + Y
Sbjct: 297 GLNISIAGSLVY 308



>pir|F84708|F84708 probable integral membrane protein [imported] -
           Arabidopsis thaliana>gb:U93215_1726559 Arabidopsis
           thaliana chromosome 2 BAC T6B20 genomic sequence,
           complete sequence.
          Length = 200

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 26/61 (42%), Positives = 42/61 (68%)
 Frame = -3

Query: 421 IGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVW 242
           +  N S F+ IG+ + V++QVLGH+KT LVL  G+L   K+  + + +LG+ +A++GMV 
Sbjct: 81  LNVNFSTFLVIGKTSPVTYQVLGHLKTCLVLAFGYLLL-KDAFSWRNILGILVAVIGMVL 139

Query: 241 Y 239
           Y
Sbjct: 140 Y 140



>gb:AP005300_1850157 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ2055_H10.
          Length = 346

 Score = 42.0 bits (97), Expect(2) = 2e-06
 Identities = 38/189 (20%), Positives = 77/189 (40%), Gaps = 15/189 (7%)
 Frame = -2

Query: 1058 SVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIKFVLF 879
            SV +++ NKA ++++ F                +  +L+RL  I  +N   S     + F
Sbjct: 52   SVLLVMFNKAALSSYNFPCANVITLLQMVCSTGLLYVLRRLKIISFTNSEPSVPSDALFF 111

Query: 878  ANFSIVGMNV---------------SLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSR 744
              F I+                   S+   +V  Y   + + +  +  +E  L   +++ 
Sbjct: 112  VPFRILLRTTPLSLAYLLYMLASMESVRGVNVPMYTTLRRTTVVFTMTMEYFLAKQKHTP 171

Query: 743  DTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
                S+ L++ G  I    D+S +A+G+   F+A  +TA+    ++ + +   L SF L+
Sbjct: 172  PIIGSVALIVFGAFIAGARDLSFDARGYAIVFVANITTAVYLATINRIGKSSGLNSFGLM 231

Query: 563  GAYCTTTGC 537
              +C    C
Sbjct: 232  --WCNGLVC 238



 Score = 33.1 bits (74), Expect(2) = 2e-06
 Identities = 19/85 (22%), Positives = 41/85 (48%)
 Frame = -3

Query: 475 YHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEG 296
           Y Y+    ++++ SC +A   N + F      +A++  + G++K    + +G++ FG   
Sbjct: 260 YLYSPGFQAVLLFSCMLAFLLNYTIFWNTILNSALTQSMCGNLKDFFTVGIGWVLFGGLP 319

Query: 295 MNIQVVLGMGIAIVGMVWYGNASSK 221
            ++  V+G G+  +G   Y     K
Sbjct: 320 FDLLNVIGQGLGFLGSGLYAYCKIK 344



>gb:BC055186_2551268 Danio rerio zgc:63651, mRNA (cDNA clone MGC:63651
            IMAGE:5611843), complete cds.
          Length = 363

 Score = 39.7 bits (91), Expect(2) = 5e-06
 Identities = 36/188 (19%), Positives = 76/188 (40%), Gaps = 4/188 (2%)
 Frame = -2

Query: 1115 KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRL 936
            +D     +   A  F  ++S  I++VNK+++ N+ F               ++    K L
Sbjct: 26   EDTSALYLKLFAAAFYGISSFLIVVVNKSVLTNYRFPSSLALGIGQMFATVVVLRGAKAL 85

Query: 935  GYIQDSNLPWSERIKF----VLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVV 768
              I   +  W    K     +L+    + G+  +   N   F  + + S++  + L E  
Sbjct: 86   NMISFPDFDWHVAYKVFPLPLLYVGNQLTGLFGTKQLNLPMFTVLRRFSIL-FTMLFEGY 144

Query: 767  LDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKY 588
            L   ++S   K ++  ++LG  +   +D++ + +G++   +    TA    Y+       
Sbjct: 145  LLKQKFSWSIKATVFTMILGAFVAASSDLAFDLQGYVFITLNNILTAANGAYMKQKLDSK 204

Query: 587  SLGSFNLL 564
             LG + LL
Sbjct: 205  ELGKYGLL 212



 Score = 34.3 bits (77), Expect(2) = 5e-06
 Identities = 20/68 (29%), Positives = 35/68 (51%)
 Frame = -3

Query: 442 VLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGI 263
           VLSC +      S  +C    +A++  ++G +K ILV  +G +F G    +    +G+ I
Sbjct: 252 VLSCVMGFILMYSIMLCTHYNSALTTTIVGCIKNILVTYIGMVFGGDYIFSWMNFVGLNI 311

Query: 262 AIVGMVWY 239
           +I G + Y
Sbjct: 312 SIAGSLVY 319



>gb:AE005172_890262 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC025416_1539474 Genomic sequence
           for Arabidopsis thaliana BAC F5O11 from chromosome I,
           complete sequence.>gb:AC025417_1539487 Genomic sequence
           for Arabidopsis thaliana BAC T12C24 from chromosome I,
           complete sequence.>gb:AK117247_1815291 Arabidopsis
           thaliana At1g12500 mRNA for unknown protein, complete
           cds, clone: RAFL16-79-N18.
          Length = 361

 Score = 40.4 bits (93), Expect(2) = 2e-05
 Identities = 21/79 (26%), Positives = 42/79 (53%)
 Frame = -3

Query: 454 VSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVL 275
           + L+  + T+A   NL+ F+     +A++ QVLG+ K  +   +  L F +  + +  + 
Sbjct: 278 IFLLAGNATVAYLVNLTNFLVTKHTSALTLQVLGNGKAAVAAGVSVLIF-RNPVTVMGIA 336

Query: 274 GMGIAIVGMVWYGNASSKA 218
           G G+ I+G+V Y  A  ++
Sbjct: 337 GFGVTIMGVVLYSEARKRS 355



 Score = 31.6 bits (70), Expect(2) = 2e-05
 Identities = 36/191 (18%), Positives = 75/191 (39%), Gaps = 7/191 (3%)
 Frame = -2

Query: 1085 AAWTFNIVTSVGIIIVNKALMANFGFSX-XXXXXXXXXXXXXLMTLILKRLGYIQDSNLP 909
            AAW     +++G++++NK L+  +GF                  + ++   G +   ++ 
Sbjct: 64   AAW---FGSNIGVLLLNKYLLFYYGFRYPIFLTMTHMLSCAAYSSAVINIAGIVPRQHIL 120

Query: 908  WSERIKFVLFAN----FSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRD 741
               +   +L  +     S+V  N SL +  V F Q    +    + +   ++     S +
Sbjct: 121  SRRQFLKILSLSAIFCLSVVCGNTSLRYIPVSFNQAIGATTPFFTAVFSFLITCKTESTE 180

Query: 740  TKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYY--VHFLQRKYSLGSFNL 567
              L++L V+ G+ + + ++ S +  GF+    +    AL+     +        L S NL
Sbjct: 181  VYLALLPVVSGIVLASNSEPSFHLFGFLICVASTAGRALKSVVQGIILTSESEKLHSMNL 240

Query: 566  LGAYCTTTGCI 534
            L        CI
Sbjct: 241  LLYMAPMAACI 251



>gb:AB117932_2048595 Mus musculus mUGTrel8 mRNA for UDP-glucuronic
            acid/UDP-N-acetylgalactosamine transporter transcript
            variant2, complete cds.
          Length = 283

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 4/166 (2%)
 Frame = -2

Query: 1049 IIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQ----DSNLPWSERIKFVL 882
            I++VNKAL+  +GF               ++  + K    I     D  +P       +L
Sbjct: 29   IVLVNKALLTTYGFPSPIVLGIGQMATTIMILYVFKLNKIIHFPDFDKKIPGKLFPLPLL 88

Query: 881  FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVA 702
            +    I G++ S    S+  + + +   IP + LLE ++   +YS +  LS+L ++LG  
Sbjct: 89   YVGNHISGLS-STSKLSLPMFTVLRKFTIPFTLLLEAIILGTQYSLNIILSVLAIVLGAF 147

Query: 701  ICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            I   +D++ N +G++  F+    TA    Y         LG + +L
Sbjct: 148  IAAGSDLTFNLEGYVFVFLNDIFTAANGVYTKQKMDPKELGKYGVL 193



>gb:AB117931_2048594 Mus musculus mUGTrel8 mRNA for UDP-glucuronic
            acid/UDP-N-acetylgalactosamine transporter transcript
            variant1, complete cds.
          Length = 326

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 4/166 (2%)
 Frame = -2

Query: 1049 IIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQ----DSNLPWSERIKFVL 882
            I++VNKAL+  +GF               ++  + K    I     D  +P       +L
Sbjct: 29   IVLVNKALLTTYGFPSPIVLGIGQMATTIMILYVFKLNKIIHFPDFDKKIPGKLFPLPLL 88

Query: 881  FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVA 702
            +    I G++ S    S+  + + +   IP + LLE ++   +YS +  LS+L ++LG  
Sbjct: 89   YVGNHISGLS-STSKLSLPMFTVLRKFTIPFTLLLEAIILGTQYSLNIILSVLAIVLGAF 147

Query: 701  ICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            I   +D++ N +G++  F+    TA    Y         LG + +L
Sbjct: 148  IAAGSDLTFNLEGYVFVFLNDIFTAANGVYTKQKMDPKELGKYGVL 193



>gb:AX083449_1460848 Sequence 141 from Patent
            WO0112660.>gb:AB106537_1873589 Homo sapiens hfrc mRNA for
            UDP-N-acetylglucosamine transporter, complete
            cds.>gb:AL160269_1921816 Human DNA sequence from clone
            RP11-240L7 on chromosome 9 Contains the 3' end of a gene
            for a novel protein similar to a zinc finger protein, the
            gene for a nucleotide-sugar transporter (SQV7L) the
            HSD17B3 gene for hydroxysteroid (17-beta) dehydrogenase
            3, 2 novel genes and two CpG islands, complete sequence.
          Length = 337

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 4/166 (2%)
 Frame = -2

Query: 1049 IIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQ----DSNLPWSERIKFVL 882
            I++VNKAL+  +GF               ++  + K    I     D  +P       +L
Sbjct: 41   IVLVNKALLTTYGFPSPIFLGIGQMAATIMILYVSKLNKIIHFPDFDKKIPVKLFPLPLL 100

Query: 881  FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVA 702
            +    I G++ S    S+  + + +   IP++ LLE ++   +YS +  LS+  ++LG  
Sbjct: 101  YVGNHISGLS-STSKLSLPMFTVLRKFTIPLTLLLETIILGKQYSLNIILSVFAIILGAF 159

Query: 701  ICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            I   +D++ N +G+I  F+    TA    Y         LG + +L
Sbjct: 160  IAAGSDLAFNLEGYIFVFLNDIFTAANGVYTKQKMDPKELGKYGVL 205



>gb:AB122077_1873818 Homo sapiens SLC35D2 mRNA for nucleotide sugar
            transporter UGTrel8, complete cds.
          Length = 337

 Score = 49.3 bits (116), Expect = 2e-04
 Identities = 39/166 (23%), Positives = 73/166 (43%), Gaps = 4/166 (2%)
 Frame = -2

Query: 1049 IIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQ----DSNLPWSERIKFVL 882
            I++VNKAL+  +GF               ++  + K    I     D  +P       +L
Sbjct: 41   IVLVNKALLTTYGFPSPIFLGIGQMAATIMILYVSKLNKIIHFPDFDKKIPVKLFPLPLL 100

Query: 881  FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVA 702
            +    I G++ S    S+  + + +   IP++ LLE ++   +YS +  LS+  ++LG  
Sbjct: 101  YVGNHISGLS-STSKLSLPMFTVLRKFTIPLTLLLETIILGKQYSLNIILSVFAIILGAF 159

Query: 701  ICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            I   +D++ N +G+I  F+    T+    Y         LG + +L
Sbjct: 160  IAAGSDLAFNLEGYIFVFLNDIFTSANGVYTKQKMDPKELGKYGVL 205



>pir|G96576|G96576 hypothetical protein F22G10.26 [imported] -
           Arabidopsis thaliana>gb:AE005173_893265 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539293 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.
          Length = 316

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 30/96 (31%), Positives = 52/96 (54%)
 Frame = -3

Query: 502 WLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTL 323
           +L    +  +++ +  +SL  L CT A+  NLS F+ I R +A++ ++ G +K  LV+ +
Sbjct: 203 FLEKSKMDTWNFHVLVLSLNSL-CTFAL--NLSVFLVISRTSALTIRIAGVVKDWLVVLV 259

Query: 322 GFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAG 215
             L F +  + I  + G  +AIVG+  Y N   K G
Sbjct: 260 SALLFAETKLTIINLFGYAVAIVGVATYNNHKPKNG 295



>gb:AP004462_1841378 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC clone:P0450B04.
          Length = 350

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 39/168 (23%), Positives = 77/168 (45%), Gaps = 5/168 (2%)
 Frame = -2

Query: 1115 KDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRL 936
            K + +A++   A+    ++S  +I+VNK +++ +GFS               +   L   
Sbjct: 93   KIQNQALLSGLAYC---ISSCSMILVNKYILSGYGFSAGIFLMLYQNIVSVTIVSTLSLS 149

Query: 935  GYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIP-----VSCLLEV 771
            G I    L W + IK  L  N   VGM ++ M+ S+ +  +A L+++      ++   E 
Sbjct: 150  GVIPTEPLTW-KLIKVWLPVNIIFVGMLITSMF-SLKYINVAMLTILKNVANVLTASGET 207

Query: 770  VLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTA 627
                 ++ R   +S+ L+++      +TD+S NA G+    +  + TA
Sbjct: 208  YFFKKQHDRQVWISLTLMIISAIAGGITDLSFNAIGYTWQILNCFLTA 255



>gb:CR382128_1660689 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 349

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 41/169 (24%), Positives = 71/169 (42%), Gaps = 4/169 (2%)
 Frame = -2

Query: 1058 SVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIKFVLF 879
            ++ + + NKA++ +F F                   +L   G  + + L   E    +LF
Sbjct: 19   NLALTLFNKAVLGSFPFPYTLTGIHTLCGTLG--CALLHWRGVFKLTRLSDQENTTLILF 76

Query: 878  A---NFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLG 708
            +     +I   NVSL   +V F+Q+ + +    + L+ VV     Y+  T LS++LV  G
Sbjct: 77   SILYTINIAISNVSLQMVTVPFHQVVRATTPFFAMLINVVFLRHSYTVLTYLSLVLVCAG 136

Query: 707  VAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQR-KYSLGSFNLL 564
            V   T  D    A GFI   +     A++    + +Q  ++ L    LL
Sbjct: 137  VGFATAGDYYFTAMGFILTILGAVLAAVKTVVTNRIQTGRFRLSPLELL 185



>pir|F96805|F96805 unknown protein T5M16.20 [imported] - Arabidopsis
           thaliana>gb:AE005173_895283 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC010704_1537029 Arabidopsis thaliana
           chromosome 1 BAC T5M16 genomic sequence, complete
           sequence.>gb:AY113887_1578298 Arabidopsis thaliana
           unknown protein (At1g77610) mRNA, complete
           cds.>gb:AF360161_1791117 Arabidopsis thaliana unknown
           protein (At1g77610) mRNA, complete
           cds.>gb:AJ633720_1813082 Arabidopsis thaliana mRNA for
           UDP-galactose transporter (udpgalt1 gene).
          Length = 336

 Score = 43.9 bits (102), Expect = 0.007
 Identities = 33/107 (30%), Positives = 52/107 (48%)
 Frame = -3

Query: 556 TAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRFT 377
           T  L   +LLL G     W       A+    SA+ +I+ S  +A   N S F  I   T
Sbjct: 197 TMILGIPALLLEGSGILSWFE-----AHPAPWSALIIILSSGVLAFCLNFSIFYVIHSTT 251

Query: 376 AVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYG 236
           AV+F V G++K  + + + +L F +  ++    +G GI +VG  +YG
Sbjct: 252 AVTFNVAGNLKVAVAVMVSWLIF-RNPISYMNAVGCGITLVGCTFYG 297



>gb:HSA005866_1999916 Homo sapiens mRNA for putative Sqv-7-like
           protein, partial.
          Length = 261

 Score = 42.4 bits (98), Expect = 0.020
 Identities = 23/90 (25%), Positives = 45/90 (50%)
 Frame = -2

Query: 833 SVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIA 654
           S+  + + +   IP++ LLE ++   +YS +  LS+  ++LG  I   +D++ N +G+I 
Sbjct: 40  SLPMFTVLRKFTIPLTLLLETIILGKQYSLNIILSVFAIILGAFIAAGSDLAFNLEGYIF 99

Query: 653 AFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
            F+    T+    Y         LG + +L
Sbjct: 100 VFLNDIFTSANGVYTKQKMDPKELGKYGVL 129



>gb:AY421728_1605129 Cryptococcus neoformans var. neoformans Cas41p
           (CAS41) gene, complete cds.
          Length = 356

 Score = 41.6 bits (96), Expect = 0.034
 Identities = 27/86 (31%), Positives = 45/86 (52%), Gaps = 1/86 (1%)
 Frame = -3

Query: 475 YHYTLSAVSLIVLS-CTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKE 299
           + + L    LI+LS   +A G N++    IG    +   + G  K IL+++   +FFG  
Sbjct: 272 FRHFLRVGPLIMLSNAAVAFGLNVAAVFLIGVAGGLVLTLAGIFKDILLISSSCIFFGSP 331

Query: 298 GMNIQVVLGMGIAIVGMVWYGNASSK 221
              IQ + G  +A+VG++ Y  +SSK
Sbjct: 332 ITRIQ-IFGYSLALVGLMAYKTSSSK 356



>gb:AY093729_1575389 Arabidopsis thaliana AT3g14410/MLN21_19 mRNA,
           complete cds.>gb:AF410286_1797100 Arabidopsis thaliana
           AT3g14410/MLN21_19 mRNA, complete cds.
          Length = 340

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 32/113 (28%), Positives = 55/113 (48%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           + +P  A  L +     +K   D + G +++    ++L  L CT A+  NLS F+ I   
Sbjct: 202 YVSPCSAICLFVPWIFLEKSKIDGN-GPWNFHFVVLTLNSL-CTFAL--NLSVFLVISHT 257

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSK 221
           +A++ +V G +K  +V+ +  L F    + I  + G  IAI G+  Y N   K
Sbjct: 258 SALTIRVAGVVKDWVVVLVSALLFADTKLTIINLFGYAIAIAGVAAYNNHKLK 310



>gb:AY042818_1560883 Arabidopsis thaliana putative protein
           (F28M20.210) mRNA, complete cds.>gb:AY064629_1566080
           Arabidopsis thaliana putative protein (At4g31600;
           F28M20.210) mRNA, complete cds.
          Length = 323

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = -3

Query: 448 LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGM 269
           +++LS  + I  N + F+C    +A++  ++G +K +   TLGF+  G   ++   V G+
Sbjct: 230 ILILSLVMGIVLNFTMFLCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVEVHALNVSGL 289

Query: 268 GIAIVGMVWYGNA 230
            +   G VWY  A
Sbjct: 290 VVNTAGGVWYSYA 302



>gb:AB022220_1515150 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLN21.
          Length = 339

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 32/113 (28%), Positives = 55/113 (48%)
 Frame = -3

Query: 559 HTAPLQAASLLLVGPITDKWLTDKSVGAYHYTLSAVSLIVLSCTIAIGTNLSQFICIGRF 380
           + +P  A  L +     +K   D + G +++    ++L  L CT A+  NLS F+ I   
Sbjct: 201 YVSPCSAICLFVPWIFLEKSKIDGN-GPWNFHFVVLTLNSL-CTFAL--NLSVFLVISHT 256

Query: 379 TAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSK 221
           +A++ +V G +K  +V+ +  L F    + I  + G  IAI G+  Y N   K
Sbjct: 257 SALTIRVAGVVKDWVVVLVSALLFADTKLTIINLFGYAIAIAGVAAYNNHKLK 309



>pir|T05110|T05110 hypothetical protein F28M20.210 - Arabidopsis
           thaliana>gb:ATCHRIV75_1547081 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           75.>gb:ATF28M20_1550365 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28M20 (ESSAII project).
          Length = 296

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = -3

Query: 448 LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGM 269
           +++LS  + I  N + F+C    +A++  ++G +K +   TLGF+  G   ++   V G+
Sbjct: 203 ILILSLVMGIVLNFTMFLCTIVNSALTTTIVGVLKGVGSTTLGFVLLGGVEVHALNVSGL 262

Query: 268 GIAIVGMVWYGNA 230
            +   G VWY  A
Sbjct: 263 VVNTAGGVWYSYA 275



>gb:BC085693_2109270 Rattus norvegicus putative
           phosphate-phosphoenolpyruvate translocator, mRNA (cDNA
           clone MGC:93128 IMAGE:7191218), complete cds.
          Length = 350

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           ++LSC +++  NL+ F  +   +A++  VLG++  +  L L  L FG   ++    +G+ 
Sbjct: 258 VLLSCFLSVVYNLASFSLLALTSALTVHVLGNLTVVGNLILSRLLFGSH-LSALSYVGIA 316

Query: 265 IAIVGMVWYGNASSKAGGKER 203
           + + GM  Y N  S A    R
Sbjct: 317 LTLSGMFLYHNCESVASWATR 337



>gb:AF182714_2058108 Rattus norvegicus putative
           phosphate/phosphoenolpyruvate translocator mRNA,
           complete cds.
          Length = 256

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           ++LSC +++  NL+ F  +   +A++  VLG++  +  L L  L FG   ++    +G+ 
Sbjct: 164 VLLSCFLSVVYNLASFSLLALTSALTVHVLGNLTVVGNLILSRLLFGSH-LSALSYVGIA 222

Query: 265 IAIVGMVWYGNASSKAGGKER 203
           + + GM  Y N  S A    R
Sbjct: 223 LTLSGMFLYHNCESVASWATR 243



>gb:AE005172_891137 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC013482_1537958 Genomic sequence
           for Arabidopsis thaliana BAC T26F17 from chromosome I,
           complete sequence.>gb:ATH551328_1552884 Arabidopsis
           thaliana partial mRNA for GONST5 Golgi Nucleotide sugar
           transporter (At1g21870 gene).
          Length = 341

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 23/75 (30%), Positives = 41/75 (54%)
 Frame = -3

Query: 460 SAVSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQV 281
           SA+ ++  S  +A   N S F  I   TAV+F V G++K  + + + ++ F +  ++   
Sbjct: 230 SALIILFNSGVLAFCLNFSIFYVIQSTTAVTFNVAGNLKVAVAVFVSWMIF-RNPISPMN 288

Query: 280 VLGMGIAIVGMVWYG 236
            +G GI +VG  +YG
Sbjct: 289 AVGCGITLVGCTFYG 303



>gb:AP003508_1830079 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0470C02.>gb:AP005913_1860020 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBb0005A05.
          Length = 323

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 10/96 (10%)
 Frame = -3

Query: 487 SVGAYHYTLSAVS----------LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTI 338
           + G + Y+LS +S          ++++S  + I  N + F C    +A++  ++G +K +
Sbjct: 206 ATGEFPYSLSVLSEKTASLTFSAILLVSLVMGIVLNFTMFWCTIVNSALTTTIVGVLKGV 265

Query: 337 LVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNA 230
              TLGF+  G   ++   V G+ I   G VWY  A
Sbjct: 266 GSTTLGFVLLGGVEVHTLNVTGLVINTFGGVWYSYA 301



>gb:AY426186_1605647 Cryptococcus neoformans var. neoformans Drp1p
            (DRP1) gene, complete cds.>gb:AE017353_1760162
            Cryptococcus neoformans var. neoformans JEC21 chromosome
            13, complete sequence.
          Length = 559

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 38/168 (22%), Positives = 68/168 (40%), Gaps = 4/168 (2%)
 Frame = -2

Query: 1088 TAAWT-FNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNL 912
            TA W     V ++G+ + NK ++ +F F                  + L+R G    + L
Sbjct: 254  TAYWLGLYFVFNLGLTLFNKFVLVSFPFPYTLTGLHALSGCAGCY-IALER-GAFTPARL 311

Query: 911  PWSERI---KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRD 741
               E +    F +    +I   N+SL   +V F+Q+ + S    +  +  +    R+S  
Sbjct: 312  AQRENLILGAFSVLYTINIAVSNISLQLVTVPFHQVVRASTPLFTIFISSIFLRTRFSIM 371

Query: 740  TKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQ 597
              +S+L V+ GV   T  D    A G I   +  +  AL+    + +Q
Sbjct: 372  KLVSLLPVVAGVGFATYGDYYFTAWGLILTLLGTFLAALKTVVTNLIQ 419



>gb:AP005620_1855048 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0680F05.
          Length = 350

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           + L+C      N+S F+ I R +A++ +V G ++   V+ L    F    +    ++G  
Sbjct: 243 LFLNCLCTFILNMSVFLVISRTSALTARVTGVVRDWSVVLLSAAIFADTQLTFINIIGYA 302

Query: 265 IAIVGMVWYGNASSK 221
           IAI G+V Y N   K
Sbjct: 303 IAIAGVVAYNNRKLK 317



>gb:AC133334_1741363 Oryza sativa chromosome 3 BAC OSJNBa0004L11
           genomic sequence, complete sequence.
          Length = 379

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 20/76 (26%), Positives = 38/76 (50%)
 Frame = -3

Query: 448 LIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGM 269
           +   +   A   N+S F+ IGR  AV+ +V G +K  +++ L  + F +  +    ++G 
Sbjct: 228 IFFFNAVAAFALNISIFLVIGRTGAVTIRVAGVLKDWILIALSTIIFPESIITSLNIIGY 287

Query: 268 GIAIVGMVWYGNASSK 221
            +A+ G+V Y     K
Sbjct: 288 AVALSGVVMYNYLKMK 303



>gb:AF466200_1802224 Sorghum bicolor putative protein kinase gene,
           partial cds; putative Cf-2, fertilization-independent
           endosperm proteins, hypothetical protein, putative
           non-LTR retroelement reverse transcriptase, OCL5
           protein, tryptophan synthase beta-subunit, hypothetical
           proteins, putative AP endonuclease, putative RNA
           polymerase II complex component SRB7, putative
           beta-1,3-glucanase, hypothetical protein, TNP2-like
           protein, hypothetical protein, putative
           phosphate/phosphoenolpyruvate translocator, putative
           protein, hypothetical proteins, putative
           galactosyltransferase family, hypothetical protein,
           putative cytochrome P450 family, putative lipid transfer
           protein, putative photoreceptor-interacting protein, and
           hypothetical protein genes, complete cds; and
           hypothetical protein gene, partial cds.
          Length = 531

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 22/75 (29%), Positives = 37/75 (49%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           + L+C      N+S F+ I R +A++ +V G ++   V+ L    F    +    ++G  
Sbjct: 307 LFLNCLCTFILNMSVFLVISRTSALTARVTGVVRDWSVVLLSAAIFADTQLTFINIIGYA 366

Query: 265 IAIVGMVWYGNASSK 221
           IAI G+V Y N   K
Sbjct: 367 IAIAGVVAYNNHKLK 381



>gb:AC115584_1205698 Dictyostelium discoideum chromosome 2 map
            complement(3622543-3568102) strain AX4, complete
            sequence.
          Length = 368

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 44/208 (21%), Positives = 92/208 (44%), Gaps = 18/208 (8%)
 Frame = -2

Query: 1139 RKMSSAVVKDEKKAIIDTAAWT--FNIVTSVGIIIVNKALMANFGFSXXXXXX----XXX 978
            +++   + + +K++ + T A    F    S+ ++ +NK L+++F F              
Sbjct: 49   QQIQQQIQQQKKESSLSTIASVIAFYFFISISLVFLNKILLSDFKFEYPLFITWYQQIIS 108

Query: 977  XXXXXLMTLILKR---LGYIQDSNLPWSERIKFVLFANFSIVGM----NVSLMWNSVGFY 819
                 +MT I K    L ++ +     +   K VL     + GM    N+ L +  V FY
Sbjct: 109  FVSIYIMTSISKSVPALSFLPEFEFKSATASK-VLPVTAVLTGMVIFNNLCLEYVEVSFY 167

Query: 818  QIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFI-----A 654
            Q+A+   I  S +L  ++   + S    ++ L+V LG  + +  +V+ +  G I     +
Sbjct: 168  QVARSLTICFSLILTYIVLKSKTSYRATMACLVVFLGFVLGSAGEVNFSWLGIIFGLLSS 227

Query: 653  AFIAVWSTALQQYYVHFLQRKYSLGSFN 570
             F+A++S A+++        ++ L  +N
Sbjct: 228  FFVALYSIAVKRVLPAVNGNEWRLSIYN 255



>gb:BC083039_2563059 Xenopus laevis hypothetical LOC494867, mRNA (cDNA
            clone IMAGE:3401708), partial cds.
          Length = 340

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 37/182 (20%), Positives = 76/182 (41%), Gaps = 4/182 (2%)
 Frame = -2

Query: 1097 IIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQ-- 924
            ++   A  F  V+S  I++VNK+++ N  F               ++  + K L  +   
Sbjct: 25   LVKLLAAAFYGVSSFFIVVVNKSVLTNHRFPSSLCVGLGQMLATVVVLWLGKALRVVHFP 84

Query: 923  --DSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRY 750
              D ++P       +L+    I G+  +   N   F  + + S++  + + E  L    +
Sbjct: 85   DFDRHIPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSIL-FTMMAEGFLLKKHF 143

Query: 749  SRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFN 570
            SR  ++++  +++G  I    D++ + +G+I   +    TA    YV        LG + 
Sbjct: 144  SRSIQMTVFAMIIGAFIAASADLAFDLEGYIFILLNDVLTAANGAYVKQKLDSKELGKYG 203

Query: 569  LL 564
            LL
Sbjct: 204  LL 205



>gb:AL731853_2072945 Mouse DNA sequence from clone RP23-128G5 on
           chromosome 11 Contains the 5' end of the Osbp2 gene for
           oxysterol binding protein 2, a novel pseudogene, two
           novel genes, the Dusp18 gene for dual specificity
           phosphatase 18 and five CpG islands, complete sequence.
          Length = 351

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 23/81 (28%), Positives = 41/81 (50%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           ++LSC +++  NL+ F  +   +A++  VLG++  +  L L  L FG   ++    LG+ 
Sbjct: 259 VLLSCFLSVVYNLASFSLLALTSALTVHVLGNLMVVGNLILSRLLFGSH-LSALSYLGIT 317

Query: 265 IAIVGMVWYGNASSKAGGKER 203
           + + GM  Y N    A    R
Sbjct: 318 LTLSGMFLYHNCELVASWATR 338



>gb:CR456351_1992642 Homo sapiens Em:AC005006.4 full length open
           reading frame (ORF) cDNA clone (cDNA clone
           C22ORF:pGEM.Em:AC005006.4).
          Length = 350

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 23/81 (28%), Positives = 41/81 (50%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           I+LSC +++  NL+ F  +   +A++  VLG++  +  L L  L FG   ++    +G+ 
Sbjct: 258 ILLSCLLSVLYNLASFSLLALTSALTVHVLGNLTVVGNLILSRLLFGSR-LSALSYVGIA 316

Query: 265 IAIVGMVWYGNASSKAGGKER 203
           + + GM  Y N    A    R
Sbjct: 317 LTLSGMFLYHNCEFVASWAAR 337



>gb:ATAC009400_1542961 Arabidopsis thaliana chromosome III BAC F14P13
            genomic sequence, complete sequence.
          Length = 355

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 36/177 (20%), Positives = 78/177 (44%), Gaps = 6/177 (3%)
 Frame = -2

Query: 1133 MSSAVVKDEKKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMT 954
            MSS+    +K+ +  ++       +++G++++NK L++N+GF               +++
Sbjct: 44   MSSSSSSPKKQTLFISSLIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILS 103

Query: 953  LI------LKRLGYIQDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIP 792
             +      L  L Y++  +         ++F   S+VG N+SL +  V F Q    +   
Sbjct: 104  YVSIVFLKLVPLQYLKSRSQFLKVATLSIVFC-ASVVGGNISLRYLPVSFNQAVGATTPF 162

Query: 791  VSCLLEVVLDSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQ 621
             + L   ++   R +  T  +++ V+ GV I +  +   +  GFI    A  + A +
Sbjct: 163  FTALFAYIMTFKREAWVTYGALVPVVTGVVIASGGEPGFHWFGFIMCISATAARAFK 219



>gb:AK039786_1165498 Mus musculus adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330108F03
           product:weakly similar to PUTATIVE
           PHOSPHATE/PHOSPHOENOLPYRUVATE TRANSLOCATOR [Rattus
           norvegicus], full insert sequence.>gb:BC020181_2093318
           Mus musculus solute carrier family 35, member E4, mRNA
           (cDNA clone MGC:28785 IMAGE:4488513), complete cds.
          Length = 350

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 23/81 (28%), Positives = 41/81 (50%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           ++LSC +++  NL+ F  +   +A++  VLG++  +  L L  L FG   ++    LG+ 
Sbjct: 258 VLLSCFLSVVYNLASFSLLALTSALTVHVLGNLMVVGNLILSRLLFGSH-LSALSYLGIT 316

Query: 265 IAIVGMVWYGNASSKAGGKER 203
           + + GM  Y N    A    R
Sbjct: 317 LTLSGMFLYHNCELVASWATR 337



>gb:AE001362_939349 Plasmodium falciparum 3D7 chromosome 2 complete
           sequence.>gb:AE001401_1208660 Plasmodium falciparum 3D7
           chromosome 2 section 38 of 73 of the complete sequence.
          Length = 215

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 27/139 (19%), Positives = 61/139 (43%), Gaps = 23/139 (16%)
 Frame = -2

Query: 887 VLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE-VVLDSVRYSRDTKLSILLVLL 711
           ++  NF++V  N+ L + S+ FYQ+A+   +P +          ++++    +S ++V +
Sbjct: 58  IITFNFTLVFGNICLKYTSISFYQLARSMTLPFNFFFSYFFFKQIKFNLLMIISCIIVSI 117

Query: 710 GVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVH-------------------FLQRKY 588
           G  I ++  V+ N    +    +++ T      +H                   F+ + Y
Sbjct: 118 GFLIFSLDAVNTNYNSVLYGISSIFVTFSSFLCIHYTDNVVFNMFGNVKSTVQTFMSKYY 177

Query: 587 SLGSFN---LLGAYCTTTG 540
           +  +FN   ++G   TT+G
Sbjct: 178 NSENFNTHTIIGIILTTSG 196



>sp|Q09875|YAGC_SCHPO Hypothetical protein C12G12.12 in chromosome
           I.>pir|S62543|S62543 hypothetical protein SPAC12G12.12 -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC12G12_1716405 S.pombe chromosome I cosmid
           c12G12.
          Length = 324

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 33/125 (26%), Positives = 51/125 (40%), Gaps = 12/125 (9%)
 Frame = -2

Query: 935 GYIQDSNLPWSERIKFVLFANFSIVG---MNVSLMWNSVGFYQIAKLSMIPVSCLLEVVL 765
           GY    +LP   ++   L A   I G   MNV L++ S   YQ+ + S+I    L    L
Sbjct: 63  GYESLDHLPLKHKVFMALPAIMDICGSTLMNVGLLYTSASIYQMTRGSLIIFVALFATTL 122

Query: 764 DSVRYSRDTKLSILLVLLGVAICTVTDVSVNAKG---------FIAAFIAVWSTALQQYY 612
                 +   LS+  V+LGVAI   +  S +             I  F       +++Y 
Sbjct: 123 LKRTIGQLQWLSLSFVVLGVAIVGYSGSSSSIGSNPILGITAVLIGQFFLATQFTIEEYI 182

Query: 611 VHFLQ 597
           + F+Q
Sbjct: 183 LSFIQ 187



>gb:CNS07EGA_1372927 chromosome III of strain GB-M1 of Encephalitozoon
            cuniculi (Microspora).
          Length = 292

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 37/159 (23%), Positives = 66/159 (41%)
 Frame = -2

Query: 1106 KKAIIDTAAWTFNIVTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYI 927
            KKA+ +  A    + +S+   + NK +++N GF               +  L LK    +
Sbjct: 2    KKAVEELTASLIYLFSSIITTLANKYILSNLGFKMQYLLVALQSLTIVVGLLTLKFARLV 61

Query: 926  QDSNLPWSERIKFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYS 747
            +     + + +   L     I   + SL +  +  Y + K S I V  LLE  L   R  
Sbjct: 62   EFRLTKFKKWMIPSLLLTVMIFSGSKSLYYLPISLYTLFKNSSIIVVALLEQHLFKKRIG 121

Query: 746  RDTKLSILLVLLGVAICTVTDVSVNAKGFIAAFIAVWST 630
              + LS +L+++       +DV +N  G++   + V ST
Sbjct: 122  SLSCLSFILMIISSYAGNSSDVILNV-GYVWISVNVLST 159



>gb:AB062677_1197042 Drosophila melanogaster UST74C mRNA for UDP-sugar
            transporter, complete cds.
          Length = 373

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 36/174 (20%), Positives = 75/174 (43%), Gaps = 7/174 (4%)
 Frame = -2

Query: 1064 VTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIKF- 888
            ++S  I +VNK ++ ++ F               ++  + KRL  +   N P  +R  F 
Sbjct: 72   LSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLV---NFPPLQRNTFA 128

Query: 887  ------VLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSI 726
                  ++F    + G+  +   +   F  + + S++ ++ LLE+ +  +R S   ++S+
Sbjct: 129  KIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSIL-MTMLLELKILGLRPSNAVQVSV 187

Query: 725  LLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
              ++ G  +    D+S N +G+I   I    TA    YV        +G + L+
Sbjct: 188  YAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLM 241



>sp|Q95YI5|US74_DROME UDP-sugar transporter UST74c (Fringe connection
            protein).>gb:AE014296_1136751 Drosophila melanogaster
            chromosome 3L, complete sequence.>gb:AE003524_1213961
            Drosophila melanogaster chromosome 3L, section 61 of 83
            of the complete sequence.>gb:AY129459_1302210 Drosophila
            melanogaster RH08077 full insert cDNA.
          Length = 373

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 36/174 (20%), Positives = 75/174 (43%), Gaps = 7/174 (4%)
 Frame = -2

Query: 1064 VTSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIKF- 888
            ++S  I +VNK ++ ++ F               ++  + KRL  +   N P  +R  F 
Sbjct: 72   LSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLV---NFPPLQRNTFA 128

Query: 887  ------VLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSI 726
                  ++F    + G+  +   +   F  + + S++ ++ LLE+ +  +R S   ++S+
Sbjct: 129  KIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSIL-MTMLLELKILGLRPSNAVQVSV 187

Query: 725  LLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRKYSLGSFNLL 564
              ++ G  +    D+S N +G+I   I    TA    YV        +G + L+
Sbjct: 188  YAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLM 241



>gb:AP003211_1825267 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBa0011P19.>gb:AP004358_1840662 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1135C02.
          Length = 273

 Score = 36.2 bits (82), Expect = 1.4
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = -1

Query: 711 GCCYLYSY*CECQCKGIYCCLHCGLEHCFAAVLC 610
           GC +LY   C C C+G+Y C+H G+      V+C
Sbjct: 224 GCSFLYM--CACGCEGVYMCVHVGVNGNEGWVIC 255



>gb:AC134232_1741661 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBa0013D02, complete sequence.
          Length = 322

 Score = 35.8 bits (81), Expect = 1.8
 Identities = 42/174 (24%), Positives = 73/174 (41%), Gaps = 8/174 (4%)
 Frame = -2

Query: 1061 TSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIKFVL 882
            +++G++++NK L++N+GF               L++        +    L  S R++   
Sbjct: 34   SNIGVLLLNKYLLSNYGFKYPIFLTMCHMSACALLSYAAIAWLRVVPMQLVRS-RVQLAK 92

Query: 881  FANF------SIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILL 720
             A        S+V  NVSL +  V F Q    +    + +   ++   R S  T L+++ 
Sbjct: 93   IAALSLVFCGSVVSGNVSLRYLPVSFNQAVGATTPFFTAVFAYIMTVKRESWVTYLTLVP 152

Query: 719  VLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL--QRKYSLGSFNLL 564
            V+ GV I +  + S +  GFI    A  + AL+      L       L S NLL
Sbjct: 153  VVTGVMIASGGEPSFHLFGFIMCIGATAARALKTVLQGILLSSEGEKLNSMNLL 206



>gb:AL160269_1921817 Human DNA sequence from clone RP11-240L7 on
            chromosome 9 Contains the 3' end of a gene for a novel
            protein similar to a zinc finger protein, the gene for a
            nucleotide-sugar transporter (SQV7L) the HSD17B3 gene for
            hydroxysteroid (17-beta) dehydrogenase 3, 2 novel genes
            and two CpG islands, complete sequence.
          Length = 163

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 4/121 (3%)
 Frame = -2

Query: 1049 IIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLILKRLGYIQ----DSNLPWSERIKFVL 882
            I++VNKAL+  +GF               ++  + K    I     D  +P       +L
Sbjct: 41   IVLVNKALLTTYGFPSPIFLGIGQMAATIMILYVSKLNKIIHFPDFDKKIPVKLFPLPLL 100

Query: 881  FANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVLLGVA 702
            +    I G++ S    S+  + + +   IP++ LLE ++   +YS +  LS+  ++LG  
Sbjct: 101  YVGNHISGLS-STSKLSLPMFTVLRKFTIPLTLLLETIILGKQYSLNIILSVFAIILGAF 159

Query: 701  I 699
            I
Sbjct: 160  I 160



>gb:BT015807_1642425 Arabidopsis thaliana At3g11320 gene, complete
            cds.
          Length = 308

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 38/175 (21%), Positives = 77/175 (44%), Gaps = 9/175 (5%)
 Frame = -2

Query: 1061 TSVGIIIVNKALMANFGFSXXXXXXXXXXXXXXLMTLI-LKRLGYIQDSNLPWSERIKFV 885
            +++G++++NK L++N+GF               L++ + +  +  +    +    R++F+
Sbjct: 21   SNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAIAWMKMVPMQTI--RSRVQFL 78

Query: 884  LFANFSIVGM------NVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSIL 723
              A  S+V        N+SL +  V F Q    +    + +   ++   R +  T  +++
Sbjct: 79   KIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVFAYLITFKREAWLTYFTLV 138

Query: 722  LVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL--QRKYSLGSFNLL 564
             V+ GV I + ++ S +  GFI    A  + AL+      L       L S NLL
Sbjct: 139  PVVTGVVIASGSEPSFHLFGFIMCIAATAARALKSVLQGILLSSEGEKLNSMNLL 193



>gb:AY198133_596920 Spiroplasma kunkelii strain CR2-3x partial
           genome sequence.
          Length = 696

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 3/86 (3%)
 Frame = -3

Query: 454 VSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMN---IQ 284
           ++ I+L+    IG +   ++ +G  TAV   + G M     +T   L   KEG     I+
Sbjct: 550 ITAIILAIGRVIGESAPVYLTLG--TAVRLPIAGFMSPGASMTTQILMLSKEGTTAGAIR 607

Query: 283 VVLGMGIAIVGMVWYGNASSKAGGKE 206
           ++  +  AI+ ++W  N+ +   GK+
Sbjct: 608 IMFELAFAIMVLIWLSNSLAHILGKK 633



>pir|C71612|C71612 probable multiple-TM membrane protein PFB0535w -
           malaria parasite (Plasmodium falciparum)
          Length = 311

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 20/100 (20%), Positives = 51/100 (51%), Gaps = 1/100 (1%)
 Frame = -2

Query: 887 VLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLE-VVLDSVRYSRDTKLSILLVLL 711
           ++  NF++V  N+ L + S+ FYQ+A+   +P +          ++++    +S ++V +
Sbjct: 87  IITFNFTLVFGNICLKYTSISFYQLARSMTLPFNFFFSYFFFKQIKFNLLMIISCIIVSI 146

Query: 710 GVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFLQRK 591
           G  I ++  V+ N    +   I    + +Q  +++ +++K
Sbjct: 147 GFLIFSLDAVNTNYNSVLYGTIV---SIIQAIHLNLIKKK 183



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 19/69 (27%), Positives = 33/69 (47%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           ++LSC  +I    S F+CI     V F + G++K+  V T    ++  E  N   ++G+ 
Sbjct: 229 LILSCISSIFVTFSSFLCIHYTDNVVFNMFGNVKS-TVQTFMSKYYNSENFNTHTIIGII 287

Query: 265 IAIVGMVWY 239
           +   G   Y
Sbjct: 288 LTTSGSCLY 296



>pir|H96790|H96790 unknown protein F15M4.16 [imported] - Arabidopsis
           thaliana>gb:AE005173_895165 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC009978_1536911 Genomic sequence for
           Arabidopsis thaliana BAC T23E18 from chromosome I,
           complete sequence.>gb:AC012394_1537630 Arabidopsis
           thaliana chromosome 1 BAC F15M4 genomic sequence,
           complete sequence.>gb:ATH551326_1552882 Arabidopsis
           thaliana partial mRNA for GONST3 Golgi Nucleotide sugar
           transporter (At1g76340 gene).
          Length = 372

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/83 (25%), Positives = 38/83 (45%)
 Frame = -3

Query: 469 YTLSAVSLIVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMN 290
           Y+L  V  + LSC   +  +   F C    +A  F VLG +  +L + +  + + K    
Sbjct: 247 YSLQVVLPVGLSCLFGLAISFFGFSCRRAISATGFTVLGIVNKLLTVVINLMVWDKHSTF 306

Query: 289 IQVVLGMGIAIVGMVWYGNASSK 221
           +   LG+ + + G V Y  ++ K
Sbjct: 307 VG-TLGLLVCMFGGVMYQQSTIK 328



>gb:AB027863_1517629 Schizosaccharomyces pombe gene for Hypothetical
           protein, partial cds, clone:SB40.
          Length = 191

 Score = 35.0 bits (79), Expect = 3.2
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 4/100 (4%)
 Frame = -2

Query: 893 KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVL 714
           KF+      IV     L +  V FYQI++  ++P + LL  VL   +         LLV+
Sbjct: 84  KFIFVKILGIVSKTYCLAFVPVSFYQISRGLLLPFTILLSFVLLKQKTRLFPFGGCLLVM 143

Query: 713 LGVAICTVTDVSVNAKGFIAAFIAVWSTALQ----QYYVH 606
           LG       +  V   G I    + ++TA++    ++YVH
Sbjct: 144 LGFGFGVRFESHVAPIGIILGVWSSFTTAIESVAVKHYVH 183



>gb:AB121210_1201131 Marsupenaeus japonicus mjTSPb mRNA for
           thrombospondin, complete cds.
          Length = 1032

 Score = 35.0 bits (79), Expect = 3.2
 Identities = 28/81 (34%), Positives = 34/81 (41%), Gaps = 3/81 (3%)
 Frame = -1

Query: 834 LCGILSD---CKVEYDTCLMFIGSCAG*CAILERHQAKHFVGSPGCCYLYSY*CECQCKG 664
           L G   D   CK + D CL+  G C        + Q  + VGS  C  L  Y  +    G
Sbjct: 426 LAGFTGDGLVCK-DVDECLVGNGGCHA------KAQCTNTVGSRNCSCLPGYIGD----G 474

Query: 663 IYCCLHCGLEHCFAAVLCTLS 601
             C   C L+ CFA V CT S
Sbjct: 475 FGCAGACELQPCFAGVTCTFS 495



>gb:AB121209_1201130 Marsupenaeus japonicus mjTSPa mRNA for
           thrombospondin, complete cds.
          Length = 1114

 Score = 35.0 bits (79), Expect = 3.2
 Identities = 28/81 (34%), Positives = 34/81 (41%), Gaps = 3/81 (3%)
 Frame = -1

Query: 834 LCGILSD---CKVEYDTCLMFIGSCAG*CAILERHQAKHFVGSPGCCYLYSY*CECQCKG 664
           L G   D   CK + D CL+  G C        + Q  + VGS  C  L  Y  +    G
Sbjct: 508 LAGFTGDGLVCK-DVDECLVGNGGCHA------KAQCTNTVGSRNCSCLPGYIGD----G 556

Query: 663 IYCCLHCGLEHCFAAVLCTLS 601
             C   C L+ CFA V CT S
Sbjct: 557 FGCAGACELQPCFAGVTCTFS 577



>sp|Q9UUI8|YIY4_SCHPO Protein C22F8.04 in chromosome
           I.>pir|T38194|T38194 hypothetical protein SPAC22F8.04 -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC22F8_1717196 S.pombe chromosome I cosmid
           c22F8.
          Length = 383

 Score = 35.0 bits (79), Expect = 3.2
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 4/100 (4%)
 Frame = -2

Query: 893 KFVLFANFSIVGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLSILLVL 714
           KF+      IV     L +  V FYQI++  ++P + LL  VL   +         LLV+
Sbjct: 156 KFIFVKILGIVSKTYCLAFVPVSFYQISRGLLLPFTILLSFVLLKQKTRLFPFGGCLLVM 215

Query: 713 LGVAICTVTDVSVNAKGFIAAFIAVWSTALQ----QYYVH 606
           LG       +  V   G I    + ++TA++    ++YVH
Sbjct: 216 LGFGFGVRFESHVAPIGIILGVWSSFTTAIESVAVKHYVH 255



>gb:AB121211_1201132 Marsupenaeus japonicus mjTSPc mRNA for
           thrombospondin, complete cds.
          Length = 991

 Score = 34.7 bits (78), Expect = 4.1
 Identities = 25/71 (35%), Positives = 31/71 (43%)
 Frame = -1

Query: 813 CKVEYDTCLMFIGSCAG*CAILERHQAKHFVGSPGCCYLYSY*CECQCKGIYCCLHCGLE 634
           CK + D CL+  G C        + Q  + VGS  C  L  Y  +    G  C   C L+
Sbjct: 395 CK-DVDECLVGNGGCHA------KAQCTNTVGSRNCSCLPGYIGD----GFGCAGACELQ 443

Query: 633 HCFAAVLCTLS 601
            CFA V CT S
Sbjct: 444 PCFAGVTCTFS 454



>gb:AE014298_1126743 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003574_1216044 Drosophila melanogaster
           chromosome X, section 73 of 74 of the complete
           sequence.>gb:BT003539_1356941 Drosophila melanogaster
           RE05288 full insert cDNA.
          Length = 373

 Score = 34.7 bits (78), Expect = 4.1
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 6/106 (5%)
 Frame = -3

Query: 502 WLTDKSVGAYHYT-LSAVSLIVLSCTIAIGT-----NLSQFICIGRFTAVSFQVLGHMKT 341
           WL   S   + +T +  +   V++   A G      N+  F  +   T +++ V    K 
Sbjct: 207 WLYMDSFAVFRHTAIKNLDYRVIALLFADGVLNWLQNIIAFSVLSLVTPLTYAVASASKR 266

Query: 340 ILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVWYGNASSKAGGKER 203
           I V+ +  L  G     +  V GM +AIVG++ Y  A     G+E+
Sbjct: 267 IFVIAVSLLILGNPVTWVNCV-GMTLAIVGVLCYNRAKQLTRGREQ 311



>gb:NCB11C21_1689007 Neurospora crassa DNA linkage group V BAC clone
           B11C21.
          Length = 418

 Score = 34.3 bits (77), Expect = 5.4
 Identities = 19/69 (27%), Positives = 36/69 (52%)
 Frame = -3

Query: 445 IVLSCTIAIGTNLSQFICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMG 266
           ++L+  +A   N+S    IGR + +   + G +K IL++    + +      +Q  LG  
Sbjct: 242 LLLNAVVAFMLNISSVCLIGRTSGLVMTLTGILKNILLVVASVMIWQTSITPLQ-FLGYA 300

Query: 265 IAIVGMVWY 239
           IA+ G+V+Y
Sbjct: 301 IALAGLVYY 309



>gb:AY062475_1565131 Arabidopsis thaliana
            phosphate/phosphoenolpyruvate translocator-like protein
            (At5g04160; F21E1_80) mRNA, complete
            cds.>gb:AY093253_1575207 Arabidopsis thaliana
            phosphate/phosphoenolpyruvate translocator-like protein
            (At5g04160) mRNA, complete cds.
          Length = 309

 Score = 33.9 bits (76), Expect = 7.0
 Identities = 39/177 (22%), Positives = 74/177 (41%), Gaps = 11/177 (6%)
 Frame = -2

Query: 1061 TSVGIIIVNKALMANFGFS---XXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIK 891
            +++G++++NK L++N+GF                   ++++  +L  +Q        R +
Sbjct: 22   SNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYISIVFLKLVPLQH----LKSRSQ 77

Query: 890  FVLFANFSI------VGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLS 729
            F+  A  SI      VG N+SL +  V F Q    +    + L   ++   R +  T  +
Sbjct: 78   FLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTFKREAWVTYGA 137

Query: 728  ILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL--QRKYSLGSFNLL 564
            ++ V+ GV I +  +   +  GFI    A  + A +      L       L S NL+
Sbjct: 138  LVPVVAGVVIASGGEPGFHWFGFIMCISATAARAFKSVLQGILLSSEGEKLNSMNLM 194



>gb:ATF21E1_1549581 Arabidopsis thaliana DNA chromosome 5, BAC clone
            F21E1 (ESSA project).>gb:AY084240_1569332 Arabidopsis
            thaliana clone 100777 mRNA, complete sequence.
          Length = 309

 Score = 33.9 bits (76), Expect = 7.0
 Identities = 39/177 (22%), Positives = 74/177 (41%), Gaps = 11/177 (6%)
 Frame = -2

Query: 1061 TSVGIIIVNKALMANFGFS---XXXXXXXXXXXXXXLMTLILKRLGYIQDSNLPWSERIK 891
            +++G++++NK L++N+GF                   ++++  +L  +Q        R +
Sbjct: 22   SNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYISIVFLKLVPLQH----LKSRSQ 77

Query: 890  FVLFANFSI------VGMNVSLMWNSVGFYQIAKLSMIPVSCLLEVVLDSVRYSRDTKLS 729
            F+  A  SI      VG N+SL +  V F Q    +    + L   ++   R +  T  +
Sbjct: 78   FLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYLMTFKREAWVTYGA 137

Query: 728  ILLVLLGVAICTVTDVSVNAKGFIAAFIAVWSTALQQYYVHFL--QRKYSLGSFNLL 564
            ++ V+ GV I +  +   +  GFI    A  + A +      L       L S NL+
Sbjct: 138  LVPVVAGVVIASGGEPGFHWFGFIMCISATAARAFKSVLQGILLSSEGEKLNSMNLM 194



>gb:AX647441_1472346 Sequence 1633 from Patent EP1270724.
          Length = 309

 Score = 33.9 bits (76), Expect = 7.0
 Identities = 33/142 (23%), Positives = 56/142 (39%), Gaps = 21/142 (14%)
 Frame = -1

Query: 888 CFICKLLNCWNECEFDVELCGILSDCKVEYDTCLMFIGSCAG*CAILERHQAKHF---VG 718
           C +  L  C N C + V +C     C   +    + +  C   CA +  +        V 
Sbjct: 69  CVLVYLCVCGNVCMYAVCMCA----CMCVHVCIGVHVYVCTCVCARVYVYTCVWVYLRVD 124

Query: 717 SPGCCYLYSY*CECQCKGIYCCLH---CGLEH-CFAAVLCT--LSSTEVLTRIFQFIGGI 556
              C ++ +Y C C C  ++ C+H   C   H C +A +C+   +S  VL  ++  I  +
Sbjct: 125 MYACMHVCAYLCMCNCVCVHVCIHAYVCVCVHVCISAYVCSRVYASVSVLCGMYVSIVCV 184

Query: 555 -----LH-------HYRLHLCC 526
                +H       H  +H CC
Sbjct: 185 CMCACMHLYMCMCAHIWMHACC 206



>gb:AY606321_2366823 Avian infectious bronchitis virus isolate
           2296/95 spike glycoprotein S1 subunit (S1) gene, partial
           cds.
          Length = 538

 Score = 33.5 bits (75), Expect = 9.2
 Identities = 13/23 (56%), Positives = 14/23 (60%)
 Frame = -1

Query: 726 FVGSPGCCYLYSY*CECQCKGIY 658
           F G   CCY YSY    QCKG+Y
Sbjct: 364 FTGRATCCYAYSYNGRRQCKGVY 386



>gb:AE017274_424519 Bacillus cereus ATCC 10987, section 11 of 18 of
           the complete genome.>gb:AE017194_1062938 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 120

 Score = 33.5 bits (75), Expect = 9.2
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 2/70 (2%)
 Frame = -3

Query: 400 FICIGRFTAVSFQVLGHMKTILVLTLGFLFFGKEGMNIQVVLGMGIAIVGMVW--YGNAS 227
           F   G   +V++ V   M  + + T+GF++FG E +NI  +L +   +VG+V   + + +
Sbjct: 48  FALKGMEMSVAYAVWSGMGIVTITTIGFIYFG-ESINIIKILAILFILVGVVILNFNSTA 106

Query: 226 SKAGGKERVQ 197
            +A  KE V+
Sbjct: 107 HEAKKKEMVE 116


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,153,810,918
Number of Sequences: 1806583
Number of extensions: 23315267
Number of successful extensions: 54864
Number of sequences better than 10.0: 92
Number of HSP's better than 10.0 without gapping: 52285
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54796
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 100104869256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)