BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13726
         (721 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY120762_1579644 Arabidopsis thaliana KNAT3 homeodomain prote...   205   8e-52   
gb:AY086091_1571149 Arabidopsis thaliana clone 21240 mRNA, compl...   205   8e-52   
sp|P48000|HKL3_ARATH|HKL3_ARATH Homeobox protein knotted-1 like 3 (KNAT3).>...   205   8e-52   Arabidopsis thaliana [mouse-ear cress]
gb:LEU76409_1684762 Lycopersicon esculentum homeobox 1 protein (...   203   2e-51   
gb:AK118296_1816283 Arabidopsis thaliana At5g11060 mRNA for puta...   202   4e-51   
gb:ATKNAT4_1553535 A.thaliana mRNA for KNAT4 homeobox protein.        202   4e-51   
sp|P48001|HKL4_ARATH|HKL4_ARATH Homeobox protein knotted-1 like 4 (KNAT4).>...   202   5e-51   Arabidopsis thaliana [mouse-ear cress]
sp|O04136|HKL3_MALDO|HKL3_MALDO Homeobox protein knotted-1 like 3 (KNAP3).>...   202   5e-51   Malus domestica [apple tree]
pir|T03875|T03875 probable homeobox protein OSH45, splice form O...   202   6e-51   Oryza sativa Japonica Group [Japonica rice]
pir|T03874|T03874 probable homeobox protein OSH45, splice form O...   201   1e-50   Oryza sativa Japonica Group [Japonica rice]
sp|O22300|HKLB_LYCES|HKLB_LYCES Homeobox protein knotted-1 like LET12.>pir|...   200   2e-50   Solanum lycopersicum
gb:AP003918_1835210 Oryza sativa (japonica cultivar-group) genom...   199   3e-50   
gb:D49703S2_1674627 Oryza sativa (japonica cultivar-group) OSH45...   199   3e-50   
pir|T02220|T02220 homeobox protein NTH23 - common tobacco>gb:AB0...   196   3e-49   Nicotiana tabacum [American tobacco]
gb:AB061818_1522092 Oryza sativa (japonica cultivar-group) HOS59...   195   8e-49   
gb:AB007628_1510119 Oryza sativa (japonica cultivar-group) HOS59...   195   8e-49   
gb:AF544051_1810417 Hordeum vulgare knotted 7 (kn7) mRNA, comple...   194   1e-48   
gb:AB061817_1522091 Oryza sativa (japonica cultivar-group) HOS58...   190   3e-47   
gb:AB043957_1520040 Ceratopteris richardii mRNA for CRKNOX3, com...   190   3e-47   
gb:AB007627_1510118 Oryza sativa (japonica cultivar-group) HOS58...   190   3e-47   
sp|P48002|HKL5_ARATH|HKL5_ARATH Homeobox protein knotted-1 like 5 (KNAT5) (...   186   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AY667451_1620714 Selaginella kraussiana KNOTTED1-like protein...   185   8e-46   
gb:AF544050_1810416 Hordeum vulgare knotted 6 (kn6) mRNA, partia...   180   2e-44   
gb:AC098695_1736866 Oryza sativa (japonica cultivar-group) chrom...   179   3e-44   
gb:LEU76410_1684763 Lycopersicon esculentum homeobox 2 protein (...   179   3e-44   
gb:AB061819_1522093 Oryza sativa (japonica cultivar-group) HOS66...   179   3e-44   
gb:AB007629_1510120 Oryza sativa (japonica cultivar-group) HOS66...   179   3e-44   
gb:AK118326_1816309 Arabidopsis thaliana At1g62990 mRNA for puta...   178   1e-43   
gb:AF308451_1784799 Arabidopsis thaliana homeodomain transcripti...   178   1e-43   
pir|A96655|A96655 hypothetical protein F16P17.16 [imported] - Ar...   178   1e-43   Arabidopsis thaliana [mouse-ear cress]
sp|P46606|HD1_BRANA|HD1_BRANA Homeobox protein HD1.>pir|S47535|S47535 home...   178   1e-43   Brassica napus [oilseed rape]
gb:AY084398_1569488 Arabidopsis thaliana clone 106887 mRNA, comp...   177   2e-43   
gb:AF285148_1783116 Physcomitrella patens class 2 KNOTTED1-like ...   175   6e-43   
sp|P56660|HKL2_MAIZE|HKL2_MAIZE Homeobox protein knotted-1 like 2 (Fragment).    175   6e-43   Zea mays [maize]
gb:ATKNAT5_1553536 A.thaliana mRNA for KNAT5 homeobox protein.        171   1e-41   
sp|P56664|HKL6_MAIZE|HKL6_MAIZE Homeobox protein knotted-1 like 6 (Fragment...   171   2e-41   Zea mays [maize]
sp|P56659|HKL1_MAIZE|HKL1_MAIZE Homeobox protein knotted-1 like 1 (Fragment).    166   4e-40   Zea mays [maize]
gb:AB182944_1529259 Triticum aestivum Wknox1b gene for KN1 homeo...   108   1e-22   
gb:AB182943_1529258 Triticum aestivum Wknox1a gene for KN1 homeo...   108   1e-22   
gb:AF457120S2_1801306 Zea mays knotted1-like homeodomain protein...   106   4e-22   
gb:AF457118_1801303 Zea mays knotted1-like homeodomain protein l...   106   4e-22   
gb:AF022390_1761991 Hordeum vulgare knotted class 1 homeodomain ...   106   4e-22   
pir|JQ2379|JQ2379 homeobox 1 protein OSH1 - rice>gb:AC145380_174...   106   4e-22   Oryza sativa [red rice]
sp|P46609|OSH1_ORYSA|OSH1_ORYSA Homeobox protein OSH1.>gb:RICOSH1_1703703 O...   106   4e-22   Oryza sativa [red rice]
sp|Q43484|KNX3_HORVU|KNX3_HORVU Homeobox protein KNOX3 (Hooded protein).>pi...   106   4e-22   Hordeum vulgare [barley]
sp|P56668|HKLB_MAIZE|HKLB_MAIZE Homeobox protein knotted-1 like 11 (Fragment).   106   4e-22   Zea mays [maize]
gb:AP002881_1823595 Oryza sativa (japonica cultivar-group) genom...   106   5e-22   
gb:AF457122S2_1801308 Zea mays knotted1-like homeodomain protein...   106   5e-22   
gb:AF457119_1801304 Zea mays knotted1-like homeodomain protein l...   106   5e-22   
gb:AB028883_1518118 Oryza sativa mRNA for knotted1-type homeobox...   106   5e-22   
gb:AB007626_1510117 Oryza sativa (japonica cultivar-group) HOS16...   106   5e-22   
pir|T02783|T02783 probable homeotic protein - rice>gb:AB007624_1...   105   6e-22   Oryza sativa [red rice]
sp|P24345|HKN1_MAIZE|HKN1_MAIZE Homeotic protein knotted-1.>pir|S14283|S142...   105   6e-22   Zea mays [maize]
sp|P56663|HKL5_MAIZE|HKL5_MAIZE Homeobox protein knotted-1 like 5 (Fragment).    105   6e-22   Zea mays [maize]
gb:AF457124S2_1801310 Zea mays knotted1-like homeodomain protein...   105   8e-22   
gb:AF100455_1768101 Zea mays knotted class 1 homeodomain protein...   105   8e-22   
sp|P56669|HLG3_MAIZE|HLG3_MAIZE Homeobox protein liguleless 3 (Fragment).        105   8e-22   Zea mays [maize]
gb:AB025573_1516211 Nicotiana tabacum NTH1 mRNA for KN1-type hom...   105   1e-21   
gb:AF544052_1810418 Nicotiana tabacum knotted 1 (kn1) mRNA, comp...   104   1e-21   
gb:AF544047_1810413 Hordeum vulgare knotted 4 (kn4) gene, partia...   103   2e-21   
gb:AY667449_1620712 Selaginella kraussiana KNOTTED1-like protein...   103   3e-21   
gb:AF533597_1809465 Lycopersicon esculentum knotted protein TKN4...   103   4e-21   
gb:AF375968_1792979 Lycopersicon esculentum knotted homeodomain ...   103   4e-21   
gb:AY781901_1628330 Saccharum hybrid cultivar isolate c53a homeo...   103   4e-21   
sp|Q41330|HKN1_LYCES|HKN1_LYCES Homeotic protein knotted-1 (TKN1).>pir|T077...   102   9e-21   Solanum lycopersicum
gb:AB015999_1512740 Ipomoea nil Pkn1 (knotted-like gene) mRNA, c...   101   1e-20   
gb:AF544054_1810420 Nicotiana tabacum knotted 3 (kn3) mRNA, part...   101   2e-20   
gb:AB025714_1516735 Nicotiana tabacum mRNA for homeobox 20, comp...   101   2e-20   
sp|O04135|HKL2_MALDO|HKL2_MALDO Homeobox protein knotted-1 like 2 (KNAP2).>...   101   2e-20   Malus domestica [apple tree]
gb:AF544053_1810419 Nicotiana tabacum knotted 2 (kn2) mRNA, part...   100   2e-20   
gb:AB016002_1512743 Ipomoea nil PKn3 (knotted-like gene) mRNA, c...   100   2e-20   
gb:AY755413_1626930 Populus alba x Populus tremula homeodomain p...   100   3e-20   
gb:AY684937_1622268 Populus balsamifera subsp. trichocarpa x Pop...   100   3e-20   
gb:DOR276389_1675995 Dendrobium grex Madame Thong-IN mRNA for kn...   100   4e-20   
gb:AY169493_1586531 Nicotiana tabacum Knotted-1-like homeobox pr...   100   4e-20   
gb:AY096803_1576297 Helianthus annuus knotted-1-like protein 2 (...   100   4e-20   
gb:AB016001_1512742 Ipomoea nil PKn2s1 (knotted-like gene) mRNA,...   100   4e-20   
gb:AB016000_1512741 Ipomoea nil PKn2 (knotted-like gene) mRNA, c...   100   4e-20   
pir|T01735|T01735 homeobox protein NTH15 - common tobacco>gb:AB0...   100   4e-20   Nicotiana tabacum [American tobacco]
sp|O04134|HKL1_MALDO|HKL1_MALDO Homeobox protein knotted-1 like 1 (KNAP1).>...   100   4e-20   Malus domestica [apple tree]
gb:AF482995_1804027 Arabidopsis thaliana RLD homeodomain protein...    99   6e-20   
gb:AF482994_1804026 Arabidopsis thaliana Landsberg erecta homeod...    99   6e-20   
gb:AC133450_1741458 Oryza sativa chromosome 3 BAC OSJNBa0072F13 ...    99   6e-20   
gb:AY655754_1620249 Streptocarpus saxorum STM1 protein mRNA, com...    99   6e-20   
gb:AY080857_1568547 Arabidopsis thaliana putative homeobox prote...    99   6e-20   
gb:AY072735_1567388 Antirrhinum majus invaginata (ina) mRNA, com...    99   6e-20   
gb:AB028884_1518119 Oryza sativa mRNA for knotted1-type homeobox...    99   6e-20   
gb:AE005173_893905 Arabidopsis thaliana chromosome 1, bottom arm...    99   6e-20   
pir|S68456|S68456 homeotic protein shootmeristemless, KNOTTED-li...    99   6e-20   Arabidopsis thaliana [mouse-ear cress]
sp|Q9M6D9|STM_BRAOL|STM_BRAOL Homeobox protein Shootmeristemless.>gb:AF193...    99   6e-20   Brassica oleracea
sp|Q38874|STM_ARATH|STM_ARATH Homeobox protein SHOOT MERISTEMLESS.>pir|T01...    99   6e-20   Arabidopsis thaliana [mouse-ear cress]
sp|P46639|HKL1_ARATH|HKL1_ARATH Homeobox protein knotted-1 like 1 (KNAT1).>...    99   6e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AF308454_1784801 Medicago truncatula knotted class I homeodom...    99   8e-20   
gb:AC116369_1739293 Oryza sativa chromosome 3 BAC OSJNBb0113I20 ...    99   8e-20   
gb:AC090683_1734403 Oryza sativa chromosome 3 BAC OSJNBa0035I24 ...    99   8e-20   
gb:AY655753_1620248 Streptocarpus rexii STM1 protein mRNA, compl...    99   8e-20   
gb:AY655752_1620247 Streptocarpus dunnii STM1 protein mRNA, part...    99   8e-20   
gb:AB043956_1520039 Ceratopteris richardii mRNA for CRKNOX2, com...    99   8e-20   
pir|T06382|T06382 Knox protein 1 - garden pea>gb:AF063307_176541...    99   8e-20   Pisum sativum [garden pea]
sp|Q41853|RSH1_MAIZE|RSH1_MAIZE Homeobox protein rough sheath 1.>pir|T03946...    99   8e-20   Zea mays [maize]
gb:PMU90091_1700843 Picea mariana homeobox transcription factor ...    99   1e-19   
gb:AY684938_1622269 Populus balsamifera subsp. trichocarpa x Pop...    99   1e-19   
gb:AY680405_1622080 Picea mariana homeobox transcription factor ...    99   1e-19   
gb:AY680400_1622075 Picea abies homeobox transcription factor KN...    99   1e-19   
gb:AY680398_1622073 Pinus taeda homeobox transcription factor KN...    99   1e-19   
gb:AY680392_1622067 Picea glauca homeobox transcription factor K...    99   1e-19   
gb:AY423709_1605483 Populus alba x Populus tremula putative Kn1-...    99   1e-19   
gb:AY312168_1598229 Zea mays homeobox transcription factor GNARL...    99   1e-19   
gb:AY072736_1567389 Antirrhinum majus hirzina (hirz) mRNA, compl...    99   1e-19   
gb:AB025713_1516734 Nicotiana tabacum mRNA for homeobox 9, compl...    99   1e-19   
pir|A96729|A96729 homeotic protein (ATK1), 26548-32058 [imported...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
pir|S57818|S57818 homeotic protein ATK1 - Arabidopsis thaliana>g...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
sp|P46640|HKL2_ARATH|HKL2_ARATH Homeobox protein knotted-1 like 2 (KNAT2) (...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AF170172_1774244 Acetabularia acetabulum KNOX1 homeodomain pr...    98   1e-19   
gb:AY680402_1622077 Pinus taeda homeobox transcription factor KN...    98   1e-19   
gb:AY112704_1578154 Petunia x hybrida shootmeristemless-like mRN...    98   1e-19   
sp|P56662|HKL4_MAIZE|HKL4_MAIZE Homeobox protein knotted-1 like 4 (Fragment).     98   1e-19   Zea mays [maize]
gb:AP004301_1839821 Oryza sativa (japonica cultivar-group) genom...    98   2e-19   
gb:AF544045_1810411 Hordeum vulgare knotted 1 (kn1) mRNA, comple...    98   2e-19   
gb:LEU76407_1684760 Lycopersicon esculentum knotted 2 protein (T...    98   2e-19   
gb:HTU519674_1682195 Helianthus tuberosus mRNA for putative knot...    98   2e-19   
gb:AY096804_1576298 Helianthus annuus knotted-1-like protein 3 (...    98   2e-19   
gb:AY096802_1576296 Helianthus annuus knotted-1-like protein 1 (...    98   2e-19   
gb:AB016071_1512760 Oryza sativa (japonica cultivar-group) mRNA,...    98   2e-19   
gb:AB007623_1510114 Oryza sativa (japonica cultivar-group) Hos3 ...    98   2e-19   
pir|T02785|T02785 probable homeotic protein - rice>gb:AF050181_1...    98   2e-19   Oryza sativa Japonica Group [Japonica rice]
sp|P46608|HMB1_SOYBN|HMB1_SOYBN Homeobox protein SBH1.>pir|S42543|S42543 hy...    98   2e-19   Glycine max [soybeans]
sp|P56667|HKLA_MAIZE|HKLA_MAIZE Homeobox protein knotted-1 like 10 (Fragment).    98   2e-19   Zea mays [maize]
sp|O22299|HKL6_LYCES|HKL6_LYCES Homeobox protein knotted-1 like LET6.>pir|T...    98   2e-19   Solanum lycopersicum
gb:AF063248_1765407 Picea abies homeobox protein mRNA, complete ...    97   2e-19   
gb:PMU90092_1700844 Picea mariana homeobox transcription factor ...    97   2e-19   
gb:AY680403_1622078 Pinus taeda homeobox transcription factor KN...    97   2e-19   
gb:AY680394_1622069 Picea glauca homeobox transcription factor K...    97   2e-19   
gb:AY680393_1622068 Pinus strobus homeobox transcription factor ...    97   2e-19   
gb:AY680391_1622066 Pinus strobus homeobox transcription factor ...    97   2e-19   
gb:AB043955_1520038 Ceratopteris richardii mRNA for CRKNOX1s, co...    97   2e-19   
gb:AB043954_1520037 Ceratopteris richardii mRNA for CRKNOX1, com...    97   2e-19   
pir|T07777|T07777 probable homeobox protein H1 - potato>gb:STU65...    97   2e-19   Solanum tuberosum [potatoes]
sp|P56666|HKL8_MAIZE|HKL8_MAIZE Homeobox protein knotted-1 like 8 (Fragment).     97   2e-19   Zea mays [maize]
gb:AB025715_1516736 Nicotiana tabacum mRNA for homeobox 22, comp...    97   3e-19   
sp|P56661|HKL3_MAIZE|HKL3_MAIZE Homeobox protein knotted-1 like 3 (Fragment).     97   4e-19   Zea mays [maize]
gb:AB071664_1522926 Oryza sativa (indica cultivar-group) gene fo...    96   5e-19   
gb:AB071513_1522882 Oryza meridionalis gene for transcription fa...    96   5e-19   
gb:AB071498_1522867 Oryza glaberrima gene for transcription fact...    96   5e-19   
gb:AB071477_1522846 Oryza rufipogon gene for transcription facto...    96   5e-19   
gb:AB071460_1522829 Oryza sativa (japonica cultivar-group) gene ...    96   5e-19   
gb:AB071454_1522823 Oryza sativa gene for transcription factor O...    96   5e-19   
gb:AB071439_1522809 Oryza sativa (indica cultivar-group) gene fo...    96   5e-19   
gb:AB071504_1522873 Oryza glaberrima gene for transcription fact...    96   6e-19   
gb:AF483278_1804042 Picea abies KNOTTED1-like homeodomain protei...    96   8e-19   
gb:AF100326_1768094 Dendrobium grex Madame Thong-IN homeobox pro...    96   8e-19   
gb:AY601274_1617427 Chelidonium majus shoot meristemless-like pr...    96   8e-19   
gb:AY680399_1622074 Pinus strobus homeobox transcription factor ...    95   1e-18   
gb:BT002930_1636518 Arabidopsis thaliana clone RAFL14-89-I21 (R2...    94   2e-18   
gb:AB072362_1522995 Arabidopsis thaliana KNAT6L mRNA for homeodo...    94   2e-18   
gb:AB072361_1522994 Arabidopsis thaliana KNAT6S mRNA for homeodo...    94   2e-18   
gb:AE005172_891291 Arabidopsis thaliana chromosome 1, top arm co...    94   2e-18   
gb:AF483277_1804041 Picea abies KNOTTED1-like homeodomain protei...    94   2e-18   
gb:LEU76408_1684761 Lycopersicon esculentum knotted 3 protein (T...    94   2e-18   
gb:AY680404_1622079 Pinus taeda homeobox transcription factor KN...    94   2e-18   
gb:AY680395_1622070 Pinus strobus homeobox transcription factor ...    94   2e-18   
gb:AF284817_1783102 Physcomitrella patens class 1 KNOTTED1-like ...    94   3e-18   
gb:AC092781_1735736 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    93   5e-18   
gb:AB071451_1522820 Oryza sativa (japonica cultivar-group) gene ...    93   5e-18   
gb:AF527947_1808527 Brassica oleracea homeodomain protein BOSTM-...    92   7e-18   
gb:AF544046_1810412 Hordeum vulgare knotted 2 (kn2) gene, partia...    91   2e-17   
gb:AB071452_1522821 Oryza sativa gene for transcription factor O...    91   2e-17   
gb:AF285147_1783115 Physcomitrella patens class 1 KNOTTED1-like ...    91   2e-17   
gb:AB071663_1522925 Oryza sativa (japonica cultivar-group) gene ...    88   2e-16   
gb:AB071437_1522807 Oryza sativa (japonica cultivar-group) gene ...    88   2e-16   
gb:AB028882_1518117 Oryza sativa mRNA for knotted1-type homeobox...    88   2e-16   
gb:AB007625_1510116 Oryza sativa (japonica cultivar-group) HOS13...    88   2e-16   
gb:AB028886_1518121 Oryza sativa mRNA for knotted1-type homeobox...    86   5e-16   
gb:AF011554_1761173 Oryza officinalis homeobox protein (Knotted-...    85   1e-15   
gb:AY667450_1620713 Selaginella kraussiana KNOTTED1-like protein...    84   3e-15   
gb:AF003527_1760656 Avena vaviloviana knotted-1 homeobox protein...    82   1e-14   
gb:AC090683_1734401 Oryza sativa chromosome 3 BAC OSJNBa0035I24 ...    82   1e-14   
gb:AF110101_1768714 Santalum album knotted 1 homolog (SE1) mRNA,...    77   4e-13   
gb:AF011553_1761172 Pennisetum americanum homeobox protein (Knot...    77   4e-13   
gb:AF003602_1760661 Oryza sativa homeobox protein gene, partial ...    74   3e-12   
gb:AY532908_1612134 Emericella nidulans AhpA (ahpA) gene, comple...    73   4e-12   
gb:AF288769_1783514 Physcomitrella patens homeobox protein (MKN4...    72   8e-12   
gb:AF011552_1761171 Hordeum marinum homeobox protein (Knotted-1)...    72   8e-12   
gb:AF288767_1783512 Physcomitrella patens homeobox protein (MKN2...    72   1e-11   
gb:AY091593_1936207 Homo sapiens MEIS1-related protein 2 (MEIS3)...    70   5e-11   
gb:CR382131_1664665 Yarrowia lipolytica chromosome E of strain C...    70   5e-11   
gb:HSU68385_2025669 Human Meis1-related protein 2 (MRG2), mRNA, ...    69   6e-11   
gb:BC069251_1987888 Homo sapiens Meis1, myeloid ecotropic viral ...    69   6e-11   
sp|Q99687|MEI3_HUMAN|MEI3_HUMAN Homeobox protein Meis3 (Meis1-related prote...    69   6e-11   Homo sapiens [man]
gb:BC084920_2564156 Xenopus laevis Meis3 homeoprotein, mRNA (cDN...    67   2e-10   
gb:BC075589_2558685 Xenopus tropicalis Meis1, myeloid ecotropic ...    67   2e-10   
gb:BC044024_2548430 Xenopus laevis similar to myeloid ecotropic ...    67   2e-10   
gb:BC003762_2089319 Mus musculus myeloid ecotropic viral integra...    67   2e-10   
sp|P97368|MEI3_MOUSE|MEI3_MOUSE Homeobox protein Meis3 (Meis1-related prote...    67   2e-10   Mus musculus [mouse]
gb:AF072895_2471716 Xenopus laevis Meis3 homeoprotein (Meis3) mR...    67   3e-10   
gb:AF375871_2490226 Danio rerio transcription factor Meis1.1 (me...    67   4e-10   
gb:AF382393_2490548 Danio rerio pbx/knotted-1 homeobox Prep1.1 m...    66   5e-10   
gb:BC052701_2101222 Mus musculus Pbx/knotted 1 homeobox, mRNA (c...    66   5e-10   
gb:HSY13613_2028332 Homo sapiens mRNA for homeodomain protein Pr...    66   5e-10   
gb:HSU68727_2025680 Human homeobox-containing protein mRNA, comp...    66   5e-10   
gb:AY196965_1938961 Homo sapiens homeobox-containing protein PKN...    66   5e-10   
gb:AY142115_1937003 Homo sapiens PKNOX1B (PKNOX1) mRNA, complete...    66   5e-10   
sp|O70477|PNX1_MOUSE|PNX1_MOUSE Homeobox protein PKNOX1 (PBX/knotted homeob...    66   5e-10   Mus musculus [mouse]
sp|P55347|PNX1_HUMAN|PNX1_HUMAN Homeobox protein PKNOX1 (PBX/knotted homeob...    66   5e-10   Homo sapiens [man]
gb:BC066375_2554266 Danio rerio myeloid ecotropic viral integrat...    66   7e-10   
gb:BC065980_2554233 Danio rerio myeloid ecotropic viral integrat...    66   7e-10   
gb:BC056515_2551790 Danio rerio myeloid ecotropic viral integrat...    66   7e-10   
gb:AF375872_2490227 Danio rerio transcription factor Meis2.2 (me...    66   7e-10   
gb:AF202934_2479958 Gallus gallus myeloid ecotropic viral insert...    66   7e-10   
gb:AF199011_2479668 Gallus gallus homeoprotein Meis2 (Meis2) mRN...    66   7e-10   
gb:BC017375_2092462 Mus musculus myeloid ecotropic viral integra...    66   7e-10   
gb:BC001516_1967651 Homo sapiens Meis1, myeloid ecotropic viral ...    66   7e-10   
gb:AF179898_1888387 Homo sapiens TALE homeobox protein Meis2d mR...    66   7e-10   
gb:AF179896_1888385 Homo sapiens TALE homeobox protein Meis2b mR...    66   7e-10   
gb:AF178948_1888209 Homo sapiens TALE homeobox protein Meis2a mR...    66   7e-10   
gb:AF017418_1876779 Homo sapiens homeobox protein MEIS2 (MEIS2) ...    66   7e-10   
gb:CSA518935_1375699 Cupiennius salei mRNA for homothorax 2 (hth...    66   7e-10   
gb:CR857152_1181401 Pongo pygmaeus mRNA; cDNA DKFZp469A1832 (fro...    66   7e-10   
sp|P97367|MEI2_MOUSE|MEI2_MOUSE Homeobox protein Meis2 (Meis1-related prote...    66   7e-10   Mus musculus [mouse]
sp|O14770|MEI2_HUMAN|MEI2_HUMAN Homeobox protein Meis2 (Meis1-related prote...    66   7e-10   Homo sapiens [man]
gb:XLU68388_2583499 Xenopus laevis XMeis1-3 protein mRNA, partia...    65   1e-09   
gb:AF202933_2479957 Gallus gallus myeloid ecotropic viral insert...    65   1e-09   
gb:BC023689_2094212 Mus musculus myeloid ecotropic viral integra...    65   1e-09   
gb:AL603984_2071254 Mouse DNA sequence from clone RP23-137B16 on...    65   1e-09   
sp|P79937|MEI1_XENLA|MEI1_XENLA Homeobox protein Meis1 (XMeis1).>gb:XLU6838...    65   1e-09   Xenopus laevis [clawed frog]
sp|Q60954|MEI1_MOUSE|MEI1_MOUSE Homeobox protein Meis1 (Myeloid ecotropic v...    65   1e-09   Mus musculus [mouse]
sp|O00470|MEI1_HUMAN|MEI1_HUMAN Homeobox protein Meis1.>gb:BC043503_1983430...    65   1e-09   Homo sapiens [man]
gb:GMA551279_1385409 Glomeris marginata partial mRNA for homotho...    65   2e-09   
gb:CSA518945_1375707 Cupiennius salei mRNA for homothorax 1 (hth...    65   2e-09   
gb:AY204697_1309652 Venturia canescens homeodomain-containing pr...    64   2e-09   
gb:BC056317_2551757 Danio rerio myeloid ecotropic viral integrat...    64   3e-09   
gb:BC054667_2551074 Danio rerio pbx/knotted 1 homeobox 1.1, mRNA...    64   3e-09   
gb:AF170065_2478261 Danio rerio meis2 mRNA, complete cds.              64   3e-09   
gb:MMU57343_2122566 Mus musculus homeobox protein Meis2 mRNA, co...    64   3e-09   
gb:TCA518941_1399639 Tribolium castaneum mRNA for homothorax (ht...    64   3e-09   
gb:AB086816_2463972 Gallus gallus PREP2 gene for TALE homeodomai...    64   4e-09   
gb:AF487460_2066955 Mus musculus homeodomain containing transcri...    64   4e-09   
gb:BC045626_1983599 Homo sapiens PBX/knotted 1 homeobox 2, mRNA ...    64   4e-09   
gb:AF036584_1234922 Drosophila melanogaster homothorax homeoprot...    64   4e-09   
gb:AF026788_1234331 Drosophila melanogaster homothorax (hth) mRN...    64   4e-09   
gb:HSM808766_1188023 Homo sapiens mRNA; cDNA DKFZp686G20229 (fro...    64   4e-09   
gb:AK082952_1173756 Mus musculus 12 days embryo spinal cord cDNA...    64   4e-09   
gb:AE014297_1138861 Drosophila melanogaster chromosome 3R, compl...    64   4e-09   
gb:AE014297_1138860 Drosophila melanogaster chromosome 3R, compl...    64   4e-09   
gb:AE014297_1138859 Drosophila melanogaster chromosome 3R, compl...    64   4e-09   
pir|JC7766|JC7766 three-amino-acid loop extension(TALE) homeodom...    64   4e-09   Homo sapiens [man]
sp|Q96KN3|PNX2_HUMAN|PNX2_HUMAN Homeobox protein PKNOX2 (PBX/knotted homeob...    64   4e-09   Homo sapiens [man]
gb:AF222995_2480857 Danio rerio homeobox transcription factor Me...    63   5e-09   
gb:AY705698_1347637 Oikopleura dioica Meis-b gene, complete cds.       63   5e-09   
gb:AY705696_1347635 Oikopleura dioica Prep gene, partial cds.          63   5e-09   
gb:CR860477_1184544 Pongo pygmaeus mRNA; cDNA DKFZp459B221 (from...    63   5e-09   
gb:AB086818_2463973 Danio rerio prep2 gene for TALE homeodomain ...    63   6e-09   
gb:CNS07EGG_1374133 chromosome X of strain GB-M1 of Encephalitoz...    63   6e-09   
gb:XLU68387_2583498 Xenopus laevis XMeis1-2 protein mRNA, comple...    62   8e-09   
gb:BC065977_2554230 Danio rerio myeloid ecotropic viral integrat...    62   8e-09   
gb:BC000735_1966988 Homo sapiens PBX/knotted 1 homeobox 1, mRNA ...    62   1e-08   
gb:AY705697_1347636 Oikopleura dioica Meis-a gene, partial cds.        62   1e-08   
gb:AF497480_1905258 Homo sapiens TGF beta-induced transcription ...    62   1e-08   
sp|Q8IUE1|TGLX_HUMAN|TGLX_HUMAN Homeobox protein TGIF2LX (TGFB-induced fact...    62   1e-08   Homo sapiens [man]
sp|Q8MIE9|TGLX_GORGO|TGLX_GORGO Homeobox protein TGIF2LX (TGFB-induced fact...    62   1e-08   Gorilla gorilla gorilla [lowland gorilla]
sp|Q8MIB7|TGLX_PANTR|TGLX_PANTR Homeobox protein TGIF2LX (TGFB-induced fact...    61   2e-08   Pan troglodytes
gb:AF406703_1796911 Solanum tuberosum BEL1-related homeotic prot...    61   2e-08   
gb:BT000779_1635050 Arabidopsis thaliana clone RAFL07-07-D11 (R1...    61   2e-08   
pir|T48224|T48224 probable homeodomain protein - Arabidopsis tha...    61   2e-08   Arabidopsis thaliana [mouse-ear cress]
pir|D84679|D84679 probable homeodomain transcription factor [imp...    61   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AE016819_1748787 Ashbya gossypii (= Eremothecium gossypii) AT...    60   3e-08   
gb:ATH519491_1552854 Arabidopsis thaliana mRNA for homeodomain p...    60   3e-08   
gb:AX969880_1485189 Sequence 683 from Patent EP1104808.                60   4e-08   
pir|D85435|D85435 BEL1-like homeobox 2 protein (BLH2) [imported]...    60   4e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q8IUE0|TGLY_HUMAN|TGLY_HUMAN Homeobox protein TGIF2LY (TGFB-induced fact...    60   4e-08   Homo sapiens [man]
gb:AF353092_1790538 Arabidopsis thaliana BEL1-like homeobox 4 (B...    60   5e-08   
gb:AC111016_1738825 Oryza sativa (japonica cultivar-group) chrom...    60   5e-08   
gb:AC006692_1203746 Caenorhabditis elegans cosmid T28F12, comple...    60   5e-08   
gb:AC006692_1203744 Caenorhabditis elegans cosmid T28F12, comple...    60   5e-08   
pir|T02415|T02415 probable homeodomain transcription factor [imp...    60   5e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q8MIB8|TGLX_PONPY|TGLX_PONPY Homeobox protein TGIF2LX (TGFB-induced fact...    60   5e-08   Pongo pygmaeus [orang utan]
gb:AY449635_1950773 Cercopithecus aethiops X-linked TGIF-like pr...    59   7e-08   
gb:AY082396_1569182 Zea mays knotted1-interacting protein (kip) ...    59   7e-08   
sp|Q8MIC2|TGLX_PAPHA|TGLX_PAPHA Homeobox protein TGIF2LX (TGFB-induced fact...    59   7e-08   Papio hamadryas [baboon]
gb:AF406699_1796907 Solanum tuberosum BEL1-related homeotic prot...    59   9e-08   
gb:AB071331_1522782 Oryza sativa (japonica cultivar-group) mRNA ...    59   9e-08   
gb:AB071330_1522781 Oryza sativa (indica cultivar-group) mRNA fo...    59   9e-08   
sp|Q8MID1|TGLX_MIOTA|TGLX_MIOTA Homeobox protein TGIF2LX (TGFB-induced fact...    59   9e-08   
sp|Q8MID8|TGLX_MACFA|TGLX_MACFA Homeobox protein TGIF2LX (TGFB-induced fact...    59   9e-08   
gb:AF406702_1796910 Solanum tuberosum BEL1-related homeotic prot...    59   1e-07   
gb:AY050459_1562233 Arabidopsis thaliana AT4g36870/C7A10_490 mRN...    59   1e-07   
sp|P41817|CUP9_YEAST|CUP9_YEAST Homeobox protein CUP9.>pir|A56344|A56344 co...    59   1e-07   
gb:AF376049_2490256 Danio rerio transcription factor Meis4.1a (m...    58   1e-07   
gb:AF406697_1796905 Solanum tuberosum BEL1-related homeotic prot...    58   1e-07   
gb:AF375964_1792975 Lycopersicon esculentum bell-like homeodomai...    58   1e-07   
gb:AF334759_1787476 Hordeum vulgare homeodomain protein JUBEL2 (...    58   1e-07   
gb:AF334758_1787475 Hordeum vulgare homeodomain protein JUBEL1 (...    58   1e-07   
gb:AF053769_1764475 Malus x domestica homeodomain protein (Mdh1)...    58   1e-07   
gb:AC079736_1732773 Oryza sativa (japonica cultivar-group) chrom...    58   1e-07   
gb:AC079736_1732772 Oryza sativa (japonica cultivar-group) chrom...    58   1e-07   
gb:AY524972_1611542 Oryza sativa (indica cultivar-group) benzoth...    58   1e-07   
gb:AC117176_1208020 Dictyostelium discoideum chromosome 2 map 50...    58   1e-07   
sp|Q8MIE6|TGLX_HYLLA|TGLX_HYLLA Homeobox protein TGIF2LX (TGFB-induced fact...    58   1e-07   
gb:BC086156_2564738 Xenopus laevis hypothetical LOC495635, mRNA ...    58   2e-07   
gb:BC012700_2091629 Mus musculus TG interacting factor, mRNA (cD...    58   2e-07   
gb:BC031268_1980108 Homo sapiens TGFB-induced factor (TALE famil...    58   2e-07   
gb:AY665270_1958575 Pan troglodytes transforming growth factor-b...    58   2e-07   
gb:AY650366_1958313 Macaca fascicularis transforming growth fact...    58   2e-07   
gb:AF179900_1888389 Homo sapiens TALE homeobox TG-interacting fa...    58   2e-07   
pir|H86329|H86329 F6F9.25 protein - Arabidopsis thaliana>gb:AE00...    58   2e-07   
sp|P70284|TGIF_MOUSE|TGIF_MOUSE 5'-TG-3' interacting factor (Homeobox prote...    58   2e-07   
sp|Q15583|TGIF_HUMAN|TGIF_HUMAN 5'-TG-3' interacting factor (Homeobox prote...    58   2e-07   
gb:AF406701_1796909 Solanum tuberosum BEL1-related homeotic prot...    57   3e-07   
gb:AF375966_1792977 Lycopersicon esculentum bell-like homeodomai...    57   3e-07   
gb:AF353094_1790540 Arabidopsis thaliana BEL1-like homeodomain 1...    57   3e-07   
gb:CR380949_1649474 Candida glabrata strain CBS138 chromosome C ...    57   3e-07   
gb:AY062545_1565201 Arabidopsis thaliana Similar to homeodomain ...    57   3e-07   
gb:AY056796_1563845 Arabidopsis thaliana At2g16400/F16F14.10 mRN...    57   3e-07   
pir|H84539|H84539 probable homeodomain transcription factor [imp...    57   3e-07   
pir|H84774|H84774 probable homeodomain transcription factor [imp...    57   3e-07   
pir|F96784|F96784 hypothetical protein F1B16.6 [imported] - Arab...    57   3e-07   
gb:MMTGIFPRO_2117712 M.musculus mRNA for mTGIF protein.                57   3e-07   
gb:AF406700_1796908 Solanum tuberosum BEL1-related homeotic prot...    57   3e-07   
gb:AF003526_1760655 Aegilops longissima knotted-1 homeobox prote...    57   3e-07   
gb:AC079736_1732774 Oryza sativa (japonica cultivar-group) chrom...    57   3e-07   
gb:AF406698_1796906 Solanum tuberosum BEL1-related homeotic prot...    57   4e-07   
gb:GGN318871_1679988 Gnetum gnemon partial mRNA for putative BEL...    57   4e-07   
gb:AC007290_1535768 Arabidopsis thaliana chromosome 2 clone T22O...    57   4e-07   
pir|T05281|T05281 probable homeobox protein T4L20.190 - Arabidop...    57   4e-07   
pir|C84670|C84670 probable homeodomain transcription factor [imp...    57   4e-07   
sp|Q8MID6|TGLX_MACMU|TGLX_MACMU Homeobox protein TGIF2LX (TGFB-induced fact...    57   4e-07   
gb:BC064716_2553885 Xenopus tropicalis hypothetical protein MGC7...    56   6e-07   
gb:BC044016_2548423 Xenopus laevis TGFB-induced factor (TALE fam...    56   6e-07   
gb:BC025404_1978501 Homo sapiens Meis1, myeloid ecotropic viral ...    56   6e-07   
gb:AY665227_1958532 Saimiri boliviensis transforming growth fact...    56   6e-07   
gb:AC104428_1737599 Oryza sativa (japonica cultivar-group) chrom...    56   6e-07   
sp|P53147|YGJ6_YEAST|YGJ6_YEAST Hypothetical homeobox protein in PRP20-VPS4...    56   6e-07   
gb:AP000616_1820513 Oryza sativa (japonica cultivar-group) genom...    56   7e-07   
gb:CNS07EGD_1373489 chromosome VI of strain GB-M1 of Encephalito...    56   7e-07   
gb:AE016959_1023614 Oryza sativa (japonica cultivar-group) chrom...    56   7e-07   
gb:BC077101_2559821 Danio rerio iroquois homeobox protein 1, b, ...    55   1e-06   
gb:AY391467_2531603 Danio rerio TGFB-induced factor (TGIF) mRNA,...    55   1e-06   
gb:AY017308_2508433 Danio rerio iroquois homeobox protein Ziro1 ...    55   1e-06   
gb:AF414134_2493247 Danio rerio iroquois 1 mRNA, complete cds.         55   1e-06   
gb:AY449640_1950778 Saimiri sciureus X-linked TGIF-like protein ...    55   1e-06   
gb:AE013599_1131480 Drosophila melanogaster chromosome 2R, compl...    55   1e-06   
gb:AE013599_1131479 Drosophila melanogaster chromosome 2R, compl...    55   1e-06   
gb:AE013599_1131478 Drosophila melanogaster chromosome 2R, compl...    55   1e-06   
gb:AE013599_1131477 Drosophila melanogaster chromosome 2R, compl...    55   1e-06   
gb:AY054513_1563167 Arabidopsis thaliana homeotic protein BEL1 h...    55   2e-06   
gb:AB006707_1510039 Arabidopsis thaliana genomic DNA, chromosome...    55   2e-06   
pir|A57632|A57632 homeotic protein BEL1 - Arabidopsis thaliana         55   2e-06   
sp|Q90655|AKR_CHICK|AKR_CHICK Homeodomain protein AKR (Avian knotted-relat...    55   2e-06   
gb:AF288768_1783513 Physcomitrella patens homeobox protein (MKN3...    54   2e-06   
gb:CR380954_1651181 Candida glabrata strain CBS138 chromosome H ...    54   2e-06   
gb:AY705703_1347642 Oikopleura dioica Irx-d gene, partial cds.         54   2e-06   
gb:AY845129_2546913 Danio rerio Iroquois 4b protein (irx4b) mRNA...    54   3e-06   
gb:BC065966_2554220 Danio rerio iroquois homeobox protein 4a, mR...    54   4e-06   
gb:AY845128_2546912 Danio rerio Iroquois 4a protein (irx4a) mRNA...    54   4e-06   
gb:AF338157_2488345 Xenopus laevis iroquois-4 homeobox transcrip...    54   4e-06   
gb:AC149071_2467662 Xenopus tropicalis BAC clone ISB10250N9 cont...    54   4e-06   
gb:AY449641_1950779 Lagothrix lagotricha X-linked TGIF-like prot...    54   4e-06   
gb:AF544049_1810415 Hordeum vulgare knotted 8 (kn8) gene, partia...    54   4e-06   
gb:AF375965_1792976 Lycopersicon esculentum bell-like homeodomai...    54   4e-06   
gb:AX400034_1467347 Sequence 205 from Patent WO0218424.                54   4e-06   
gb:CEH25HOME_1365042 Caenorhabditis elegans mRNA for CEH-25 home...    54   4e-06   
gb:AC006692_1203748 Caenorhabditis elegans cosmid T28F12, comple...    54   4e-06   
gb:AC006692_1203747 Caenorhabditis elegans cosmid T28F12, comple...    54   4e-06   
gb:AC006692_1203745 Caenorhabditis elegans cosmid T28F12, comple...    54   4e-06   
gb:AK029490_1161516 Mus musculus adult male testis cDNA, RIKEN f...    54   4e-06   
gb:AK017884_1159367 Mus musculus 8 days embryo whole body cDNA, ...    54   4e-06   
sp|Q9GZN2|TGI2_HUMAN|TGI2_HUMAN Homeobox protein TGIF2 (TGFB-induced factor...    54   4e-06   
sp|Q9QY61|IRX4_MOUSE|IRX4_MOUSE Iroquois-class homeodomain protein IRX-4 (I...    54   4e-06   
sp|P78413|IRX4_HUMAN|IRX4_HUMAN Iroquois-class homeodomain protein IRX-4 (I...    54   4e-06   
sp|Q9YGS0|IRX4_CHICK|IRX4_CHICK Iroquois-class homeodomain protein IRX-4 (I...    54   4e-06   
gb:BC081024_2561933 Xenopus laevis MGC81646 protein, mRNA (cDNA ...    53   5e-06   
gb:AB043620_2462046 Gallus gallus PBX1B mRNA, complete cds.            53   5e-06   
gb:AB043619_2462045 Gallus gallus PBX1A mRNA, complete cds.            53   5e-06   
gb:BT008000_2150932 Synthetic construct Homo sapiens pre-B-cell ...    53   5e-06   
gb:BC002244_2088996 Mus musculus pre B-cell leukemia transcripti...    53   5e-06   
gb:HUMTRAA1_2037855 Human translocation (t1;19) fusion protein (...    53   5e-06   
gb:AB064996_1869656 Macaca fascicularis mRNA for pre-B-cell leuk...    53   5e-06   
pir|C34734|C34734 transcription factor 3/homeotic protein prl mu...    53   5e-06   
pir|B34734|B34734 transcription factor 3/homeotic protein prl mu...    53   5e-06   
pir|A54863|A54863 homeobox protein - mouse>gb:AL357568_1925025 H...    53   5e-06   
pir|B33061|B33061 homeotic protein prl - human>gb:HUMPRLAA_20358...    53   5e-06   
sp|P40424|PBX1_HUMAN|PBX1_HUMAN Pre-B-cell leukemia transcription factor-1 ...    53   5e-06   
gb:BX883044_2111412 Rattus norvegicus chromosome 20, major histo...    53   6e-06   
gb:BC087615_2110097 Mus musculus cDNA clone MGC:91042 IMAGE:4978...    53   6e-06   
gb:HSPBX2_2019457 Human PBX2 mRNA.                                     53   6e-06   
gb:AL662884_1931898 Human DNA sequence from clone XXbac-300A18 o...    53   6e-06   
gb:AL662830_1931645 Human DNA sequence from clone XXbac-173E2 on...    53   6e-06   
gb:AF375967_1792978 Lycopersicon esculentum bell-like homeodomai...    53   6e-06   
gb:CR382136_1668744 Debaryomyces hansenii chromosome D of strain...    53   6e-06   
gb:AF391292_1267445 Branchiostoma floridae cosmid MPMGc117N2261,...    53   6e-06   
sp|Q9BYU1|PBX4_HUMAN|PBX4_HUMAN Pre-B-cell leukemia transcription factor-4 ...    53   6e-06   
sp|O35984|PBX2_MOUSE|PBX2_MOUSE Pre-B-cell leukemia transcription factor-2 ...    53   6e-06   
sp|P40425|PBX2_HUMAN|PBX2_HUMAN Pre-B-cell leukemia transcription factor-2 ...    53   6e-06   
sp|Q93348|IRXH_CAEEL|IRXH_CAEEL Putative iroquois-class homeobox protein C3...    53   6e-06   
gb:GGA237599_2572675 Gallus gallus mRNA for iroquois homologue-2.      52   1e-05   
gb:BC081317_2562205 Xenopus tropicalis irx2-prov protein, mRNA (...    52   1e-05   
gb:BC077951_2560597 Xenopus laevis homeobox Iroquois protein 2, ...    52   1e-05   
gb:BC065681_2554126 Danio rerio iroquois homeobox protein 2, a, ...    52   1e-05   
gb:AY845127_2546911 Danio rerio Iroquois 2a protein (irx2a) mRNA...    52   1e-05   
gb:AF319962_2487560 Gallus gallus clone 5 iroquois-related homeo...    52   1e-05   
gb:MMU300183_2120529 Mus musculus partial mRNA for Pbx4 protein,...    52   1e-05   
gb:BC032875_2097384 Mus musculus pre-B-cell leukemia transcripti...    52   1e-05   
gb:AY449637_1950775 Callithrix jacchus X-linked TGIF-like protei...    52   1e-05   
gb:AY449636_1950774 Pygathrix nemaeus X-linked TGIF-like protein...    52   1e-05   
gb:AY705695_1347634 Oikopleura dioica Pbx gene, complete cds.          52   1e-05   
gb:AE014296_1136035 Drosophila melanogaster chromosome 3L, compl...    52   1e-05   
pir|T03095|T03095 homeoprotein Sail - fruit fly (Drosophila mela...    52   1e-05   
sp|Q99NE9|PBX4_MOUSE|PBX4_MOUSE Pre-B-cell leukemia transcription factor-4 ...    52   1e-05   
gb:AF162696_2477779 Danio rerio Pbx4 homeodomain protein (pbx4) ...    52   1e-05   
gb:AK125053_1915801 Homo sapiens cDNA FLJ43063 fis, clone BRTHA3...    52   1e-05   
gb:AY705702_1347641 Oikopleura dioica Irx-b gene, complete cds.        52   1e-05   
gb:AY705701_1347640 Oikopleura dioica Irx-e gene, complete cds.        52   1e-05   
sp|P78412|IRX6_HUMAN|IRX6_HUMAN Iroquois-class homeodomain protein IRX-6 (I...    52   1e-05   
gb:DRE245964_2571031 Danio rerio mRNA for Pbx3b homeodomain prot...    51   2e-05   
gb:BC081037_2561946 Xenopus laevis MGC81734 protein, mRNA (cDNA ...    51   2e-05   
gb:BC056322_2551762 Danio rerio iroquois homeobox protein 2, a, ...    51   2e-05   
gb:AP005003_1847111 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:CR382122_1655257 Kluyveromyces lactis strain NRRL Y-1140 chro...    51   2e-05   
gb:AY313149_1318637 Saccoglossus kowalevskii iroquois (iro) mRNA...    51   2e-05   
gb:DRE245963_2571030 Danio rerio mRNA for Pbx1b homeodomain prot...    51   2e-05   
gb:BC066446_2554336 Danio rerio pre-B-cell leukemia transcriptio...    51   2e-05   
gb:AF480430_2497020 Xenopus laevis pre-B-cell leukemia transcrip...    51   2e-05   
gb:AC007392_1875258 Homo sapiens BAC clone RP11-444B4 from 2, co...    51   2e-05   
gb:AP003714_1832364 Oryza sativa (japonica cultivar-group) genom...    51   2e-05   
gb:ATHIGEN_1553244 A.thaliana AtH1 gene.                               51   2e-05   
sp|P48731|ATH1_ARATH|ATH1_ARATH Homeobox protein ATH1.>pir|T05306|T05306 ho...    51   2e-05   
gb:AF398433_2491911 Danio rerio iroquois homeodomain transcripti...    50   3e-05   
gb:GGN318874_1679991 Gnetum gnemon partial mRNA for putative BEL...    50   3e-05   
gb:CSA518944_1375706 Cupiennius salei mRNA for extradenticle 2 (...    50   3e-05   
gb:CSA518943_1375705 Cupiennius salei mRNA for extradenticle-1 (...    50   3e-05   
gb:AC006692_1203749 Caenorhabditis elegans cosmid T28F12, comple...    50   3e-05   
gb:GGA238354_2572680 Gallus gallus mRNA for iroquois homologue-1.      50   4e-05   
gb:DRE245965_2571032 Danio rerio mRNA for pbxy homeodomain prote...    50   4e-05   
gb:BC067972_2554956 Xenopus tropicalis hypothetical protein MGC6...    50   4e-05   
gb:BC066730_2554567 Danio rerio iroquois homeobox protein 3b, mR...    50   4e-05   
gb:AY512587_2535768 Danio rerio iroquois homeobox protein 5b (ir...    50   4e-05   
gb:AY043241_2509452 Danio rerio iroquois homeobox protein ziro1-...    50   4e-05   
gb:AY017309_2508434 Danio rerio iroquois homeobox protein Ziro5 ...    50   4e-05   
gb:AL672083_2504308 Zebrafish DNA sequence from clone BUSM1-69G1...    50   4e-05   
gb:AF359505_2489230 Danio rerio iroquois homeobox protein Ziro1 ...    50   4e-05   
gb:AF340184_2488549 Danio rerio iroquois 3 homeobox protein mRNA...    50   4e-05   
gb:AF338158_2488346 Xenopus laevis iroquois-5 homeobox transcrip...    50   4e-05   
gb:AF319964_2487562 Gallus gallus clone 18 iroquois-related home...    50   4e-05   
gb:AF319963_2487561 Gallus gallus clone 12 iroquois-related home...    50   4e-05   
gb:AF157620_2477674 Gallus gallus iroquois-related homeobox tran...    50   4e-05   
gb:AF124095_2475217 Danio rerio iroquois homeobox protein Ziro3 ...    50   4e-05   
gb:AF027175_2469230 Xenopus laevis homeobox transcription factor...    50   4e-05   
gb:AC149069_2467661 X. tropicalis BAC clone ISB1-177L8 containin...    50   4e-05   
gb:AB091387_2464446 Oryzias latipes Iro3 mRNA for iroquois homeo...    50   4e-05   
gb:MMU271054_2119971 Mus musculus partial mRNA for iroquois home...    50   4e-05   
gb:MMIRX2_2116157 Mus musculus mRNA for iroquois homeobox protei...    50   4e-05   
gb:MMIRX1_2116156 Mus musculus mRNA for iroquois homeobox protei...    50   4e-05   
gb:BC085500_2109244 Mus musculus Iroquois related homeobox 3 (Dr...    50   4e-05   
gb:BC085291_2109168 Mus musculus Iroquois related homeobox 2 (Dr...    50   4e-05   
gb:AF165986_2057552 Mus musculus iroquois-class homeobox protein...    50   4e-05   
gb:AF165985_2057551 Mus musculus iroquois-class homeobox protein...    50   4e-05   
gb:HSU90309_2027124 Human iroquois-class homeodomain protein IRX...    50   4e-05   
gb:HSU90304_2027119 Human iroquois-class homeodomain protein IRX...    50   4e-05   
gb:BC074850_1989350 Homo sapiens iroquois homeobox protein 5, mR...    50   4e-05   
gb:BC029160_1979422 Homo sapiens, clone IMAGE:5181034, mRNA, par...    50   4e-05   
gb:BC023667_1978182 Homo sapiens iroquois homeobox protein 3, mR...    50   4e-05   
gb:AY335943_1944099 Homo sapiens homeodomain protein IRXB1 (IRX3...    50   4e-05   
gb:AF319967_1896582 Homo sapiens clone 19-3 iroquois-related hom...    50   4e-05   
gb:AK035140_1164001 Mus musculus 12 days embryo embryonic body b...    50   4e-05   
sp|Q9ER75|IRX6_MOUSE|IRX6_MOUSE Iroquois-class homeodomain protein IRX-6 (I...    50   4e-05   
sp|Q9JKQ4|IRX5_MOUSE|IRX5_MOUSE Iroquois-class homeodomain protein IRX-5 (I...    50   4e-05   
sp|P78411|IRX5_HUMAN|IRX5_HUMAN Iroquois-class homeodomain protein IRX-5 (I...    50   4e-05   
sp|P81067|IRX3_MOUSE|IRX3_MOUSE Iroquois-class homeodomain protein IRX-3 (I...    50   4e-05   
sp|P78415|IRX3_HUMAN|IRX3_HUMAN Iroquois-class homeodomain protein IRX-3 (I...    50   4e-05   
sp|P81066|IRX2_MOUSE|IRX2_MOUSE Iroquois-class homeodomain protein IRX-2 (I...    50   4e-05   
sp|Q9BZI1|IRX2_HUMAN|IRX2_HUMAN Iroquois-class homeodomain protein IRX-2 (I...    50   4e-05   
sp|P81068|IRX1_MOUSE|IRX1_MOUSE Iroquois-class homeodomain protein IRX-1 (I...    50   4e-05   
sp|P78414|IRX1_HUMAN|IRX1_HUMAN Iroquois-class homeodomain protein IRX-1 (I...    50   4e-05   
gb:BC076162_2559036 Danio rerio iroquois homeobox protein 6a, mR...    50   5e-05   
gb:AJ719751_2501938 Gallus gallus mRNA for hypothetical protein,...    50   5e-05   
gb:AF319965_2487563 Gallus gallus clone 30 iroquois-related home...    50   5e-05   
gb:AF020200_2051042 Mus musculus transcription factor PBX3b (PBX...    50   5e-05   
gb:AL445186_1927339 Human DNA sequence from clone RP11-336P12 on...    50   5e-05   
gb:AF355142_1898812 Homo sapiens pre-B-cell leukemia transcripti...    50   5e-05   
gb:AF355141_1898811 Homo sapiens pre-B-cell leukemia transcripti...    50   5e-05   
gb:DMCAUP_1378507 D.melanogaster mRNA for caupolican homeoprotein.     50   5e-05   
sp|O35317|PBX3_MOUSE|PBX3_MOUSE Pre-B-cell leukemia transcription factor-3 ...    50   5e-05   
sp|P40426|PBX3_HUMAN|PBX3_HUMAN Pre-B-cell leukemia transcription factor-3 ...    50   5e-05   
gb:BC071048_2555922 Xenopus laevis hypothetical protein MGC83856...    49   7e-05   
gb:TCA518940_1399638 Tribolium castaneum mRNA for extradenticle ...    49   7e-05   
gb:DMDPBXA_1378660 D.melanogaster for Dpbx gene.                       49   7e-05   
gb:DMARA_1378102 D.melanogaster mRNA for araucan homeoprotein.         49   7e-05   
gb:BT016078_1358523 Drosophila melanogaster LP02208 full insert ...    49   7e-05   
gb:BT015986_1358431 Drosophila melanogaster RE59515 full insert ...    49   7e-05   
gb:AY705700_1347639 Oikopleura dioica Irx-a gene, partial cds.         49   7e-05   
gb:AY600514_1340196 Tribolium castaneum iroquois-like protein (i...    49   7e-05   
sp|P40427|EXD_DROME|EXD_DROME Homeobox protein extradenticle.>pir|A48840|A...    49   7e-05   
sp|P54269|CAUP_DROME|CAUP_DROME Homeobox protein caupolican.>gb:AE014296_11...    49   7e-05   
sp|Q24248|ARA_DROME|ARA_DROME Homeobox protein araucan.>gb:AE014296_113603...    49   7e-05   
gb:XLRNAIRO1_2583099 Xenopus laevis mRNA for an homeobox Iro pro...    49   1e-04   
gb:GGA238355_2572681 Gallus gallus partial mRNA for iroquois hom...    49   1e-04   
gb:AY705699_1347638 Oikopleura dioica Irx-c gene, complete cds.        49   1e-04   
gb:AY449639_1950777 Aotus trivirgatus X-linked TGIF-like protein...    48   2e-04   
gb:AE014134_1126823 Drosophila melanogaster chromosome 2L, compl...    47   3e-04   
sp|P41779|HM20_CAEEL|HM20_CAEEL Homeobox protein ceh-20.>pir|T16221|T16221 ...    47   3e-04   


>gb:AY120762_1579644 Arabidopsis thaliana KNAT3 homeodomain protein
           (At5g25220) mRNA, complete cds.>gb:BT000139_1634417
           Arabidopsis thaliana KNAT3 homeodomain protein
           (At5g25220) mRNA, complete cds.
          Length = 306

 Score =  205 bits (521), Expect = 8e-52
 Identities = 100/122 (81%), Positives = 106/122 (86%), Gaps = 1/122 (0%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct: 186 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP 245

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKS-AAEKSSTE 364
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KRKS A + S  E
Sbjct: 246 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE 303

Query: 363 HF 358
            F
Sbjct: 304 RF 305



>gb:AY086091_1571149 Arabidopsis thaliana clone 21240 mRNA, complete
           sequence.
          Length = 431

 Score =  205 bits (521), Expect = 8e-52
 Identities = 100/122 (81%), Positives = 106/122 (86%), Gaps = 1/122 (0%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct: 311 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP 370

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKS-AAEKSSTE 364
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KRKS A + S  E
Sbjct: 371 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE 428

Query: 363 HF 358
            F
Sbjct: 429 RF 430



>sp|P48000|HKL3_ARATH Homeobox protein knotted-1 like 3
           (KNAT3).>gb:AC006259_1533879 Arabidopsis thaliana BAC
           F21J6 from chromosome V, containing KNAT3 and mapping
           near 60.5 cM, complete sequence.>gb:ATKNAT3_1553534
           A.thaliana mRNA for KNAT3 homeobox protein.
          Length = 431

 Score =  205 bits (521), Expect = 8e-52
 Identities = 100/122 (81%), Positives = 106/122 (86%), Gaps = 1/122 (0%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct: 311 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP 370

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKS-AAEKSSTE 364
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KRKS A + S  E
Sbjct: 371 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVL--KNKRKSNAGDNSGRE 428

Query: 363 HF 358
            F
Sbjct: 429 RF 430



>gb:LEU76409_1684762 Lycopersicon esculentum homeobox 1 protein
           (THox1) mRNA, partial cds.
          Length = 392

 Score =  203 bits (517), Expect = 2e-51
 Identities = 97/114 (85%), Positives = 104/114 (91%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct: 278 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP 337

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAE 379
           YPTEEDKARL +ETGLQLKQINNWFINQRKRNWH+NP      S K+KRKSA E
Sbjct: 338 YPTEEDKARLARETGLQLKQINNWFINQRKRNWHSNP--STSSSQKSKRKSAGE 389



>gb:AK118296_1816283 Arabidopsis thaliana At5g11060 mRNA for
           putative HOMEOBOX PROTEIN KNOTTED-1 LIKE 4 (KNAT4),
           complete cds, clone: RAFL19-58-H14.
          Length = 393

 Score =  202 bits (515), Expect = 4e-51
 Identities = 95/119 (79%), Positives = 105/119 (88%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct: 275 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP 334

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAEKSSTE 364
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP       +K +R +A E S  +
Sbjct: 335 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRD 392



>gb:ATKNAT4_1553535 A.thaliana mRNA for KNAT4 homeobox protein.
          Length = 393

 Score =  202 bits (515), Expect = 4e-51
 Identities = 95/119 (79%), Positives = 105/119 (88%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct: 275 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP 334

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAEKSSTE 364
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP       +K +R +A E S  +
Sbjct: 335 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVSKNK-RRSNAGENSGRD 392



>sp|P48001|HKL4_ARATH Homeobox protein knotted-1 like 4
           (KNAT4).>pir|T51795|T51795 HOMEOBOX PROTEIN KNOTTED-1
           LIKE 4 (KNAT4) - Arabidopsis thaliana>gb:ATT5K6_1556198
           Arabidopsis thaliana DNA chromosome 5, BAC clone T5K6
           (ESSA project).
          Length = 419

 Score =  202 bits (514), Expect = 5e-51
 Identities = 96/122 (78%), Positives = 105/122 (86%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LK+WWQSHSKWP
Sbjct: 275 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKSWWQSHSKWP 334

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAEKSSTEH 361
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KR+   E  + E 
Sbjct: 335 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTVS--KNKRRRYMESLNLEG 392

Query: 360 FM 355
           F+
Sbjct: 393 FL 394



>sp|O04136|HKL3_MALDO Homeobox protein knotted-1 like 3
           (KNAP3).>pir|T17010|T17010 knotted1-like homeobox
           protein - apple tree>gb:MDKNOX1_1685936 M.domestica mRNA
           for knotted1-like homeobox protein.
          Length = 427

 Score =  202 bits (514), Expect = 5e-51
 Identities = 94/109 (86%), Positives = 99/109 (90%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct: 319 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP 378

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKR 394
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KR
Sbjct: 379 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSTVLKSKRKR 427



>pir|T03875|T03875 probable homeobox protein OSH45, splice form
           OSH45 [similarity] - rice>gb:D49703S2_1674626 Oryza
           sativa (japonica cultivar-group) OSH45 gene for OSH42,
           OSH44 and OSH45 transcripts, exon 2, 3, 4, 5, 6 and 7,
           complete cds.
          Length = 374

 Score =  202 bits (513), Expect = 6e-51
 Identities = 96/113 (84%), Positives = 102/113 (90%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct: 259 SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP 318

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAA 382
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        KTKRKS A
Sbjct: 319 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRKSNA 369



>pir|T03874|T03874 probable homeobox protein OSH45, splice form
           OSH44 [similarity] - rice>gb:D49703S2_1674625 Oryza
           sativa (japonica cultivar-group) OSH45 gene for OSH42,
           OSH44 and OSH45 transcripts, exon 2, 3, 4, 5, 6 and 7,
           complete cds.
          Length = 375

 Score =  201 bits (510), Expect = 1e-50
 Identities = 95/112 (84%), Positives = 101/112 (90%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct: 259 SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP 318

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSA 385
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        KTKRK A
Sbjct: 319 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRKRA 368



>sp|O22300|HKLB_LYCES Homeobox protein knotted-1 like
           LET12.>pir|T04318|T04318 homeobox protein LeT12, class
           II knotted-like - tomato>gb:LEAF000142_1684203
           Lycopersicon esculentum class II knotted-like
           homeodomain protein (LeT12) mRNA, complete cds.
          Length = 426

 Score =  200 bits (508), Expect = 2e-50
 Identities = 92/108 (85%), Positives = 99/108 (91%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEKI DIREEI+RKRRAGKLPGDTTS+LKAWWQSHSKWP
Sbjct: 316 SERSLMERVRQELKHELKQGYKEKIVDIREEILRKRRAGKLPGDTTSVLKAWWQSHSKWP 375

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTK 397
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        +T+
Sbjct: 376 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSTSSSQKSQTQ 423



>gb:AP003918_1835210 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1705_A03.>gb:AP005390_1850927 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0075O18.
          Length = 181

 Score =  199 bits (507), Expect = 3e-50
 Identities = 94/110 (85%), Positives = 100/110 (90%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct: 63  SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP 122

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        KTKRK
Sbjct: 123 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRK 170



>gb:D49703S2_1674627 Oryza sativa (japonica cultivar-group) OSH45
           gene for OSH42, OSH44 and OSH45 transcripts, exon 2, 3,
           4, 5, 6 and 7, complete cds.
          Length = 171

 Score =  199 bits (507), Expect = 3e-50
 Identities = 94/110 (85%), Positives = 100/110 (90%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKH+LKQGYKEK+ DIREEI+RKRRAGKLPGDTTS LKAWWQSH+KWP
Sbjct: 63  SERSLMERVRQELKHELKQGYKEKLIDIREEILRKRRAGKLPGDTTSTLKAWWQSHAKWP 122

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        KTKRK
Sbjct: 123 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPSSSTSV--KTKRK 170



>pir|T02220|T02220 homeobox protein NTH23 - common
           tobacco>gb:AB004797_1509182 Nicotiana tabacum NTH23
           mRNA, complete cds.
          Length = 422

 Score =  196 bits (499), Expect = 3e-49
 Identities = 90/109 (82%), Positives = 98/109 (89%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELKHDLKQGYKEK+ DIREEI+RKRRAGKLPGDTTS+LKAWWQSH+KWP
Sbjct: 314 SERSLMERVRQELKHDLKQGYKEKLVDIREEILRKRRAGKLPGDTTSVLKAWWQSHAKWP 373

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKR 394
           YPTEEDKA+LVQETGLQLKQINNWFINQRKR+WH+N         K KR
Sbjct: 374 YPTEEDKAKLVQETGLQLKQINNWFINQRKRDWHSNASSSTTSKSKRKR 422



>gb:AB061818_1522092 Oryza sativa (japonica cultivar-group) HOS59
           mRNA for KNOX family class 2 homeodomain protein,
           complete cds.>gb:AP003517_1830262 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0062J02.>gb:AP004008_1836271 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1226_A12.
          Length = 317

 Score =  195 bits (495), Expect = 8e-49
 Identities = 89/108 (82%), Positives = 96/108 (88%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           ERSL+ERVRQELKH+LKQGY+EK+ DIREEI+RKRRAGKLPGDT S LKAWWQ+HSKWPY
Sbjct: 204 ERSLVERVRQELKHELKQGYREKLVDIREEILRKRRAGKLPGDTASTLKAWWQAHSKWPY 263

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKR 394
           PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KR
Sbjct: 264 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPASSSSDKSKRKR 311



>gb:AB007628_1510119 Oryza sativa (japonica cultivar-group) HOS59
           mRNA, complete cds.
          Length = 178

 Score =  195 bits (495), Expect = 8e-49
 Identities = 89/108 (82%), Positives = 96/108 (88%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           ERSL+ERVRQELKH+LKQGY+EK+ DIREEI+RKRRAGKLPGDT S LKAWWQ+HSKWPY
Sbjct: 65  ERSLVERVRQELKHELKQGYREKLVDIREEILRKRRAGKLPGDTASTLKAWWQAHSKWPY 124

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKR 394
           PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KR
Sbjct: 125 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPASSSSDKSKRKR 172



>gb:AF544051_1810417 Hordeum vulgare knotted 7 (kn7) mRNA, complete
           cds.
          Length = 340

 Score =  194 bits (494), Expect = 1e-48
 Identities = 89/115 (77%), Positives = 100/115 (86%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           ERSL+ERVRQELKH+LKQGY+EK+ DIREEI+RKRRAGKLPGDT S LKAWWQ+H+KWPY
Sbjct: 191 ERSLVERVRQELKHELKQGYREKLVDIREEILRKRRAGKLPGDTASTLKAWWQAHAKWPY 250

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAEKS 373
           PTEEDKARLVQETGLQLKQINNWFINQRKRNWH+NP        K KR ++  K+
Sbjct: 251 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHSNPTSSSSDKSKRKRYNSRLKT 305



>gb:AB061817_1522091 Oryza sativa (japonica cultivar-group) HOS58
           mRNA for KNOX family class 2 homeodomain protein,
           partial cds.
          Length = 212

 Score =  190 bits (482), Expect = 3e-47
 Identities = 88/109 (80%), Positives = 98/109 (89%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           ERSL+ERVR ELK++LKQGYKEK+ DIREEI+RKRRAGKLPGDT S+LKAWWQ+HSKWPY
Sbjct: 94  ERSLVERVRHELKNELKQGYKEKLVDIREEILRKRRAGKLPGDTASILKAWWQAHSKWPY 153

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           PTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NP        KTK+K
Sbjct: 154 PTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNP---ASSGEKTKKK 199



>gb:AB043957_1520040 Ceratopteris richardii mRNA for CRKNOX3,
           complete cds.
          Length = 436

 Score =  190 bits (482), Expect = 3e-47
 Identities = 87/110 (79%), Positives = 99/110 (90%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           TER+LMERVRQELK++LK GYK++I D+REEI+RKRRAGKLPGDTTS+LKAWW +HSKWP
Sbjct: 328 TERTLMERVRQELKNELKNGYKDRIVDVREEILRKRRAGKLPGDTTSVLKAWWHAHSKWP 387

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE++KARLVQETGLQLKQINNWFINQRKRNWH+NP        KTKRK
Sbjct: 388 YPTEDEKARLVQETGLQLKQINNWFINQRKRNWHSNPSSTAAM--KTKRK 435



>gb:AB007627_1510118 Oryza sativa (japonica cultivar-group) HOS58
           mRNA, complete cds.
          Length = 183

 Score =  190 bits (482), Expect = 3e-47
 Identities = 88/109 (80%), Positives = 98/109 (89%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           ERSL+ERVR ELK++LKQGYKEK+ DIREEI+RKRRAGKLPGDT S+LKAWWQ+HSKWPY
Sbjct: 65  ERSLVERVRHELKNELKQGYKEKLVDIREEILRKRRAGKLPGDTASILKAWWQAHSKWPY 124

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           PTE+DKARLVQETGLQLKQINNWFINQRKRNWH+NP        KTK+K
Sbjct: 125 PTEDDKARLVQETGLQLKQINNWFINQRKRNWHSNP---ASSGEKTKKK 170



>sp|P48002|HKL5_ARATH Homeobox protein knotted-1 like 5 (KNAT5)
           (Homeodomain containing protein 1).>pir|T04641|T04641
           homeobox protein 1 - Arabidopsis
           thaliana>gb:ATCHRIV76_1547125 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 76.>gb:ATF10N7_1548221
           Arabidopsis thaliana DNA chromosome 4, BAC clone F10N7
           (ESSA project).>gb:D43962_1674592 Arabidopsis thaliana
           mRNA for homeodomein containing protein 1, complete
           cds.>gb:AF306661_1784520 Arabidopsis thaliana
           homeodomain transcription factor KNAT5 (KNAT5) mRNA,
           complete cds.
          Length = 383

 Score =  186 bits (472), Expect = 4e-46
 Identities = 87/109 (79%), Positives = 98/109 (89%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           ERSLMERV++ELKH+LKQG+KEKI DIREEIMRKRRAGKLPGDTTS+LK WW++HSKWPY
Sbjct: 271 ERSLMERVKKELKHELKQGFKEKIVDIREEIMRKRRAGKLPGDTTSVLKEWWRTHSKWPY 330

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           PTEEDKA+LVQETGLQLKQINNWFINQRKRNW++N       + K KRK
Sbjct: 331 PTEEDKAKLVQETGLQLKQINNWFINQRKRNWNSNSSTSSTLT-KNKRK 378



>gb:AY667451_1620714 Selaginella kraussiana KNOTTED1-like protein
           (KNOX3) mRNA, complete cds.
          Length = 363

 Score =  185 bits (469), Expect = 8e-46
 Identities = 83/111 (74%), Positives = 96/111 (86%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           TER+LMERVRQELKH+LK GY+ +I D+R EI+RKRRAGKLPGDTTS+LKAWW +HSKWP
Sbjct: 253 TERTLMERVRQELKHELKHGYRARIVDVRXEILRKRRAGKLPGDTTSVLKAWWHAHSKWP 312

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKS 388
           YPTE++KARLVQETGL+LKQINNWFINQRKRNWH +P      + K K KS
Sbjct: 313 YPTEDEKARLVQETGLELKQINNWFINQRKRNWHHHPSSSASTTSKLKCKS 363



>gb:AF544050_1810416 Hordeum vulgare knotted 6 (kn6) mRNA, partial
           cds.
          Length = 149

 Score =  180 bits (457), Expect = 2e-44
 Identities = 83/110 (75%), Positives = 95/110 (86%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           TERSLMERVRQELK +LKQG+K +I D+REEI+RKRRAGKLPGDTT++LK WWQ H+KWP
Sbjct: 42  TERSLMERVRQELKIELKQGFKSRIGDVREEILRKRRAGKLPGDTTTILKQWWQEHAKWP 101

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 102 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSQTSTL---KSKRK 148



>gb:AC098695_1736866 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1126B12, complete sequence.
          Length = 143

 Score =  179 bits (455), Expect = 3e-44
 Identities = 83/110 (75%), Positives = 95/110 (86%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG+K +I D+REEI+RKRRAGKLPGDTT++LK WWQ HSKWP
Sbjct: 36  SERSLMERVRQELKIELKQGFKSRIEDVREEILRKRRAGKLPGDTTTILKQWWQQHSKWP 95

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 96  YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSQTSTL---KSKRK 142



>gb:LEU76410_1684763 Lycopersicon esculentum homeobox 2 protein
           (THox2) mRNA, complete cds.
          Length = 310

 Score =  179 bits (455), Expect = 3e-44
 Identities = 81/109 (74%), Positives = 94/109 (86%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG++ +I D+REEI+RKRRAGKLPGDTT++LK WWQ HSKWP
Sbjct: 202 SERSLMERVRQELKIELKQGFRSRIEDVREEILRKRRAGKLPGDTTTVLKNWWQQHSKWP 261

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKR 394
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH+N         K KR
Sbjct: 262 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHSNSQSVTSLKSKRKR 310



>gb:AB061819_1522093 Oryza sativa (japonica cultivar-group) HOS66
           mRNA for KNOX family class 2 homeodomain protein,
           complete cds.
          Length = 314

 Score =  179 bits (455), Expect = 3e-44
 Identities = 83/110 (75%), Positives = 95/110 (86%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG+K +I D+REEI+RKRRAGKLPGDTT++LK WWQ HSKWP
Sbjct: 207 SERSLMERVRQELKIELKQGFKSRIEDVREEILRKRRAGKLPGDTTTILKQWWQQHSKWP 266

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 267 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSQTSTL---KSKRK 313



>gb:AB007629_1510120 Oryza sativa (japonica cultivar-group) HOS66
           mRNA, partial cds.
          Length = 196

 Score =  179 bits (455), Expect = 3e-44
 Identities = 83/110 (75%), Positives = 95/110 (86%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG+K +I D+REEI+RKRRAGKLPGDTT++LK WWQ HSKWP
Sbjct: 89  SERSLMERVRQELKIELKQGFKSRIEDVREEILRKRRAGKLPGDTTTILKQWWQQHSKWP 148

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 149 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSQTSTL---KSKRK 195



>gb:AK118326_1816309 Arabidopsis thaliana At1g62990 mRNA for
           putative homeodomain transcription factor KNAT6 (KNAT6),
           complete cds, clone: RAFL19-60-J07.
          Length = 284

 Score =  178 bits (451), Expect = 1e-43
 Identities = 83/110 (75%), Positives = 94/110 (85%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG+K +I D+REEIMRKRRAGKLPGDTT++LK WWQ H KWP
Sbjct: 176 SERSLMERVRQELKLELKQGFKSRIEDVREEIMRKRRAGKLPGDTTTVLKNWWQQHCKWP 235

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 236 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSHSLTSL--KSKRK 283



>gb:AF308451_1784799 Arabidopsis thaliana homeodomain transcription
           factor KNAT7 (KNAT7) mRNA, complete cds.
          Length = 291

 Score =  178 bits (451), Expect = 1e-43
 Identities = 83/110 (75%), Positives = 94/110 (85%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG+K +I D+REEIMRKRRAGKLPGDTT++LK WWQ H KWP
Sbjct: 183 SERSLMERVRQELKLELKQGFKSRIEDVREEIMRKRRAGKLPGDTTTVLKNWWQQHCKWP 242

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 243 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSHSLTSL--KSKRK 290



>pir|A96655|A96655 hypothetical protein F16P17.16 [imported] -
           Arabidopsis thaliana>gb:AE005173_893967 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F16P17_1677647 Sequence of BAC F16P17 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 283

 Score =  178 bits (451), Expect = 1e-43
 Identities = 83/110 (75%), Positives = 94/110 (85%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG+K +I D+REEIMRKRRAGKLPGDTT++LK WWQ H KWP
Sbjct: 175 SERSLMERVRQELKLELKQGFKSRIEDVREEIMRKRRAGKLPGDTTTVLKNWWQQHCKWP 234

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 235 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSHSLTSL--KSKRK 282



>sp|P46606|HD1_BRANA Homeobox protein HD1.>pir|S47535|S47535
           homeodomain-containing protein -
           rape>gb:BNHDIBOX_1633556 B.napus hd1 mRNA for
           homeodomain-containing protein.
          Length = 294

 Score =  178 bits (451), Expect = 1e-43
 Identities = 83/110 (75%), Positives = 94/110 (85%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ERSLMERVRQELK +LKQG+K +I D+REEIMRKRRAGKLPGDTT++LK WWQ H KWP
Sbjct: 186 SERSLMERVRQELKLELKQGFKSRIEDVREEIMRKRRAGKLPGDTTTVLKNWWQQHCKWP 245

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 246 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSHSLTSL--KSKRK 293



>gb:AY084398_1569488 Arabidopsis thaliana clone 106887 mRNA,
           complete sequence.
          Length = 283

 Score =  177 bits (448), Expect = 2e-43
 Identities = 82/110 (74%), Positives = 94/110 (85%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +E+SLMERVRQELK +LKQG+K +I D+REEIMRKRRAGKLPGDTT++LK WWQ H KWP
Sbjct: 175 SEKSLMERVRQELKLELKQGFKSRIEDVREEIMRKRRAGKLPGDTTTVLKNWWQQHCKWP 234

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE+DKA+LV+ETGLQLKQINNWFINQRKRNWH N         K+KRK
Sbjct: 235 YPTEDDKAKLVEETGLQLKQINNWFINQRKRNWHNNSHSLTSL--KSKRK 282



>gb:AF285148_1783116 Physcomitrella patens class 2 KNOTTED1-like
           protein MKN1-3 (MKN1-3) gene, complete cds.
          Length = 533

 Score =  175 bits (444), Expect = 6e-43
 Identities = 78/110 (70%), Positives = 96/110 (87%)
 Frame = -2

Query: 720 TERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWP 541
           +ER+LMERVRQELK++LKQGY+ +I D+REEI+RKRRAGKLP  TT++LKAWWQ+HSKWP
Sbjct: 424 SERTLMERVRQELKYELKQGYRARIVDVREEILRKRRAGKLPEGTTTVLKAWWQAHSKWP 483

Query: 540 YPTEEDKARLVQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           YPTE++K R +QETGL+LKQ+NNWFINQRKRNWH+NP        K+KRK
Sbjct: 484 YPTEDEKERRIQETGLELKQVNNWFINQRKRNWHSNPLSSSSEL-KSKRK 532



>sp|P56660|HKL2_MAIZE Homeobox protein knotted-1 like 2 (Fragment).
          Length = 88

 Score =  175 bits (444), Expect = 6e-43
 Identities = 78/88 (88%), Positives = 84/88 (95%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           VRQELKH+LKQGY++K+ DIREEI+RKRRAGKLPGDT S LKAWWQ+HSKWPYPTEEDKA
Sbjct: 1   VRQELKHELKQGYRDKLVDIREEILRKRRAGKLPGDTASTLKAWWQAHSKWPYPTEEDKA 60

Query: 516 RLVQETGLQLKQINNWFINQRKRNWHTN 433
           RLVQETGLQLKQINNWFINQRKRNWH N
Sbjct: 61  RLVQETGLQLKQINNWFINQRKRNWHNN 88



>gb:ATKNAT5_1553536 A.thaliana mRNA for KNAT5 homeobox protein.
          Length = 104

 Score =  171 bits (433), Expect = 1e-41
 Identities = 79/100 (79%), Positives = 89/100 (89%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELKH+LKQG+KEKI DIREEIMRKRRAGKLPGDTTS+LK WW++HSKWPYPTEEDKA+L
Sbjct: 1   KELKHELKQGFKEKIVDIREEIMRKRRAGKLPGDTTSVLKEWWRTHSKWPYPTEEDKAKL 60

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRK 391
           VQETGLQLKQINNWFINQRKRNW++N       + K KRK
Sbjct: 61  VQETGLQLKQINNWFINQRKRNWNSNSSTSSTLT-KNKRK 99



>sp|P56664|HKL6_MAIZE Homeobox protein knotted-1 like 6
           (Fragment).>sp|P56665|HKL7_MAIZE Homeobox protein
           knotted-1 like 7 (Fragment).
          Length = 85

 Score =  171 bits (432), Expect = 2e-41
 Identities = 76/85 (89%), Positives = 83/85 (97%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK++LKQGYKEK+ DIREEIMRKRRAGKLPGDT S+LKAWWQ+HSKWPYPTE+DKARLV
Sbjct: 1   ELKNELKQGYKEKLVDIREEIMRKRRAGKLPGDTASVLKAWWQAHSKWPYPTEDDKARLV 60

Query: 507 QETGLQLKQINNWFINQRKRNWHTN 433
           QETGLQLKQINNWFINQRKRNWH+N
Sbjct: 61  QETGLQLKQINNWFINQRKRNWHSN 85



>sp|P56659|HKL1_MAIZE Homeobox protein knotted-1 like 1 (Fragment).
          Length = 88

 Score =  166 bits (420), Expect = 4e-40
 Identities = 73/88 (82%), Positives = 82/88 (93%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           VRQELK +LKQG+K +I D+REEI+RKRRAGKLPGDTTS+LK WWQ HSKWPYPTE+DKA
Sbjct: 1   VRQELKLELKQGFKSRIEDVREEILRKRRAGKLPGDTTSILKQWWQEHSKWPYPTEDDKA 60

Query: 516 RLVQETGLQLKQINNWFINQRKRNWHTN 433
           +LV+ETGLQLKQINNWFINQRKRNWH N
Sbjct: 61  KLVEETGLQLKQINNWFINQRKRNWHNN 88



>gb:AB182944_1529259 Triticum aestivum Wknox1b gene for KN1 homeobox
           protein, complete cds.>gb:AB182945_1529260 Triticum
           aestivum Wknox1d gene for KN1 homeobox protein, complete
           cds.>gb:AF224499_1778572 Triticum aestivum
           KNOTTED-1-like homeobox protein b (knox1b) mRNA,
           complete cds.>gb:AF224500_1778573 Triticum aestivum
           KNOTTED-1-like homeobox protein d (knox1d) mRNA,
           complete cds.
          Length = 363

 Score =  108 bits (269), Expect = 1e-22
 Identities = 45/85 (52%), Positives = 60/85 (70%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           V QELKH L + Y   ++ +++E+ +K++ GKLP D    L +WW+ H KWPYP+E  K 
Sbjct: 242 VDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKDARQQLLSWWEMHYKWPYPSESQKV 301

Query: 516 RLVQETGLQLKQINNWFINQRKRNW 442
            L + TGL LKQINNWFINQRKR+W
Sbjct: 302 ALAESTGLDLKQINNWFINQRKRHW 326



>gb:AB182943_1529258 Triticum aestivum Wknox1a gene for KN1 homeobox
           protein, complete cds.>gb:AF224498_1778571 Triticum
           aestivum KNOTTED-1-like homeobox protein a (knox1a)
           mRNA, complete cds.
          Length = 362

 Score =  108 bits (269), Expect = 1e-22
 Identities = 45/85 (52%), Positives = 60/85 (70%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           V QELKH L + Y   ++ +++E+ +K++ GKLP D    L +WW+ H KWPYP+E  K 
Sbjct: 241 VDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKDARQQLLSWWEMHYKWPYPSESQKV 300

Query: 516 RLVQETGLQLKQINNWFINQRKRNW 442
            L + TGL LKQINNWFINQRKR+W
Sbjct: 301 ALAESTGLDLKQINNWFINQRKRHW 325



>gb:AF457120S2_1801306 Zea mays knotted1-like homeodomain protein
           liguleless4a (lg4a) gene, exons 4, 5, and partial cds.
          Length = 151

 Score =  106 bits (265), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL
Sbjct: 35  RELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRL 94

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 95  AAATGLDPKQINNWFINQRKRHW 117



>gb:AF457118_1801303 Zea mays knotted1-like homeodomain protein
           liguleless4a (lg4a) mRNA, complete cds.
          Length = 307

 Score =  106 bits (265), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL
Sbjct: 191 RELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRL 250

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 251 AAATGLDPKQINNWFINQRKRHW 273



>gb:AF022390_1761991 Hordeum vulgare knotted class 1 homeodomain
           protein (k) mRNA, complete cds.
          Length = 364

 Score =  106 bits (265), Expect = 4e-22
 Identities = 44/85 (51%), Positives = 60/85 (70%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           V QELKH L + Y   ++ +++E+ +K++ GKLP +    L +WW+ H KWPYP+E  K 
Sbjct: 243 VDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKEARQQLLSWWEMHYKWPYPSESQKV 302

Query: 516 RLVQETGLQLKQINNWFINQRKRNW 442
            L + TGL LKQINNWFINQRKR+W
Sbjct: 303 ALAESTGLDLKQINNWFINQRKRHW 327



>pir|JQ2379|JQ2379 homeobox 1 protein OSH1 -
           rice>gb:AC145380_1744355 Oryza sativa chromosome 3 BAC
           OSJNBa0013A09 genomic sequence, complete sequence.
          Length = 361

 Score =  106 bits (265), Expect = 4e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           V QELKH L + Y   ++ +++E+ +K++ GKLP D    L  WW+ H KWPYP+E  K 
Sbjct: 239 VDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKDARQQLLNWWELHYKWPYPSESQKV 298

Query: 516 RLVQETGLQLKQINNWFINQRKRNW 442
            L + TGL LKQINNWFINQRKR+W
Sbjct: 299 ALAESTGLDLKQINNWFINQRKRHW 323



>sp|P46609|OSH1_ORYSA Homeobox protein OSH1.>gb:RICOSH1_1703703
           Oryza sativa (japonica cultivar-group) OSH1 gene for
           homeobox protein.
          Length = 361

 Score =  106 bits (265), Expect = 4e-22
 Identities = 45/85 (52%), Positives = 59/85 (69%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           V QELKH L + Y   ++ +++E+ +K++ GKLP D    L  WW+ H KWPYP+E  K 
Sbjct: 239 VDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKDARQQLLNWWELHYKWPYPSESQKV 298

Query: 516 RLVQETGLQLKQINNWFINQRKRNW 442
            L + TGL LKQINNWFINQRKR+W
Sbjct: 299 ALAESTGLDLKQINNWFINQRKRHW 323



>sp|Q43484|KNX3_HORVU Homeobox protein KNOX3 (Hooded
           protein).>pir|S58871|S58871 homeotic protein Knox3 -
           barley>gb:HVKNOX3_1682435 H.vulgare Knox3 gene.
          Length = 364

 Score =  106 bits (265), Expect = 4e-22
 Identities = 44/85 (51%), Positives = 60/85 (70%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           V QELKH L + Y   ++ +++E+ +K++ GKLP +    L +WW+ H KWPYP+E  K 
Sbjct: 243 VDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKEARQQLLSWWEMHYKWPYPSESQKV 302

Query: 516 RLVQETGLQLKQINNWFINQRKRNW 442
            L + TGL LKQINNWFINQRKR+W
Sbjct: 303 ALAESTGLDLKQINNWFINQRKRHW 327



>sp|P56668|HKLB_MAIZE Homeobox protein knotted-1 like 11 (Fragment).
          Length = 88

 Score =  106 bits (265), Expect = 4e-22
 Identities = 47/83 (56%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL
Sbjct: 3   RELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRL 62

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 63  AAATGLDPKQINNWFINQRKRHW 85



>gb:AP002881_1823595 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0035H10.>gb:AP003206_1825144 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1146F03.
          Length = 301

 Score =  106 bits (264), Expect = 5e-22
 Identities = 47/82 (57%), Positives = 57/82 (69%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL 
Sbjct: 188 ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALLEWWNTHYRWPYPTEEDKLRLA 247

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 248 ARTGLDPKQINNWFINQRKRHW 269



>gb:AF457122S2_1801308 Zea mays knotted1-like homeodomain protein
           liguleless4b (lg4b) gene, exons 4, 5 and partial cds.
          Length = 148

 Score =  106 bits (264), Expect = 5e-22
 Identities = 47/83 (56%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL
Sbjct: 33  RELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRL 92

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 93  AAMTGLDPKQINNWFINQRKRHW 115



>gb:AF457119_1801304 Zea mays knotted1-like homeodomain protein
           liguleless4b (lg4b) mRNA, complete cds.
          Length = 298

 Score =  106 bits (264), Expect = 5e-22
 Identities = 47/83 (56%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL
Sbjct: 183 RELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRL 242

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 243 AAMTGLDPKQINNWFINQRKRHW 265



>gb:AB028883_1518118 Oryza sativa mRNA for knotted1-type homeobox
           protein OSH6, complete cds.
          Length = 301

 Score =  106 bits (264), Expect = 5e-22
 Identities = 47/82 (57%), Positives = 57/82 (69%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL 
Sbjct: 188 ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALLEWWNTHYRWPYPTEEDKLRLA 247

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 248 ARTGLDPKQINNWFINQRKRHW 269



>gb:AB007626_1510117 Oryza sativa (japonica cultivar-group) HOS16
           mRNA, partial cds.
          Length = 138

 Score =  106 bits (264), Expect = 5e-22
 Identities = 47/82 (57%), Positives = 57/82 (69%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL 
Sbjct: 25  ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALLEWWNTHYRWPYPTEEDKLRLA 84

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 85  ARTGLDPKQINNWFINQRKRHW 106



>pir|T02783|T02783 probable homeotic protein -
           rice>gb:AB007624_1510115 Oryza sativa (japonica
           cultivar-group) HOS9 mRNA, partial
           cds.>gb:AB028885_1518120 Oryza sativa mRNA for
           knotted1-type homeobox protein OSH71, complete
           cds.>gb:AC130598_1740717 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0056I11,
           complete sequence.>gb:AF050180_1764149 Oryza sativa
           strain Indica IR58 KNOX class homeodomain protein
           (Oskn2) mRNA, complete cds.
          Length = 311

 Score =  105 bits (263), Expect = 6e-22
 Identities = 47/82 (57%), Positives = 57/82 (69%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL 
Sbjct: 197 ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLA 256

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 257 AMTGLDPKQINNWFINQRKRHW 278



>sp|P24345|HKN1_MAIZE Homeotic protein knotted-1.>pir|S14283|S14283
           transcription factor Knotted-1 -
           maize>gb:AY260164_1593425 Zea mays KNOTTED1 (kn1) gene,
           complete cds.>gb:AY312169_1598230 Zea mays homeobox
           transcription factor KNOTTED1 (kn1) gene, complete
           cds.>gb:ZMKN1_1731915 Z.mays Knotted-1 (Kn-1) gene.
          Length = 359

 Score =  105 bits (263), Expect = 6e-22
 Identities = 44/85 (51%), Positives = 59/85 (69%)
 Frame = -2

Query: 696 VRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKA 517
           V QELKH L + Y   ++ +++E+ +K++ GKLP +    L +WW  H KWPYP+E  K 
Sbjct: 239 VDQELKHHLLKKYSGYLSSLKQELSKKKKKGKLPKEARQQLLSWWDQHYKWPYPSETQKV 298

Query: 516 RLVQETGLQLKQINNWFINQRKRNW 442
            L + TGL LKQINNWFINQRKR+W
Sbjct: 299 ALAESTGLDLKQINNWFINQRKRHW 323



>sp|P56663|HKL5_MAIZE Homeobox protein knotted-1 like 5 (Fragment).
          Length = 85

 Score =  105 bits (263), Expect = 6e-22
 Identities = 47/82 (57%), Positives = 57/82 (69%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  S L  WW +H +WPYPTEEDK RL 
Sbjct: 1   ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARSALMDWWNTHYRWPYPTEEDKVRLA 60

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 61  AMTGLDPKQINNWFINQRKRHW 82



>gb:AF457124S2_1801310 Zea mays knotted1-like homeodomain protein
           liguleless3 (lg3) gene, exons 4, 5 and partial cds.
          Length = 146

 Score =  105 bits (262), Expect = 8e-22
 Identities = 46/82 (56%), Positives = 58/82 (70%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  ++L  WW +H +WPYPTEEDK RL 
Sbjct: 33  ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARTVLLEWWNTHYRWPYPTEEDKVRLA 92

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 93  AMTGLDPKQINNWFINQRKRHW 114



>gb:AF100455_1768101 Zea mays knotted class 1 homeodomain protein
           liguleless3 (lg3) mRNA, complete cds.
          Length = 295

 Score =  105 bits (262), Expect = 8e-22
 Identities = 46/82 (56%), Positives = 58/82 (70%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  ++L  WW +H +WPYPTEEDK RL 
Sbjct: 182 ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARTVLLEWWNTHYRWPYPTEEDKVRLA 241

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 242 AMTGLDPKQINNWFINQRKRHW 263



>sp|P56669|HLG3_MAIZE Homeobox protein liguleless 3 (Fragment).
          Length = 85

 Score =  105 bits (262), Expect = 8e-22
 Identities = 46/82 (56%), Positives = 58/82 (70%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  ++L  WW +H +WPYPTEEDK RL 
Sbjct: 1   ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARTVLLEWWNTHYRWPYPTEEDKVRLA 60

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQRKR+W
Sbjct: 61  AMTGLDPKQINNWFINQRKRHW 82



>gb:AB025573_1516211 Nicotiana tabacum NTH1 mRNA for KN1-type
           homeobox protein, complete cds.
          Length = 327

 Score =  105 bits (261), Expect = 1e-21
 Identities = 45/82 (54%), Positives = 59/82 (71%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R+E ++KR+ GKLP D  + L  WW +H +WPYPTEE+K RL 
Sbjct: 210 ELKETLMRKYSGYLSSLRKEFLKKRKKGKLPKDARTALLEWWNTHYRWPYPTEEEKNRLS 269

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 270 EITGLDPKQINNWFINQRKRHW 291



>gb:AF544052_1810418 Nicotiana tabacum knotted 1 (kn1) mRNA,
           complete cds.
          Length = 327

 Score =  104 bits (260), Expect = 1e-21
 Identities = 45/82 (54%), Positives = 59/82 (71%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R+E ++KR+ GKLP D  + L  WW +H +WPYPTEE+K RL 
Sbjct: 210 ELKETLMRKYSGYLSSLRKEFLKKRKKGKLPKDARTALLDWWNTHYRWPYPTEEEKNRLS 269

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 270 EITGLDPKQINNWFINQRKRHW 291



>gb:AF544047_1810413 Hordeum vulgare knotted 4 (kn4) gene, partial
           cds.
          Length = 136

 Score =  103 bits (258), Expect = 2e-21
 Identities = 44/87 (50%), Positives = 58/87 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELKH L + Y   +  +R+E  ++R+ GKLP +    L  WW+ HSKWPYP+E +K  L
Sbjct: 24  KELKHQLLRKYGGYVGSLRQEFCKRRKKGKLPKEARQKLLHWWELHSKWPYPSETEKIAL 83

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNP 430
            + TGL  KQINNWFINQRKR+W   P
Sbjct: 84  AESTGLDQKQINNWFINQRKRHWKPAP 110



>gb:AY667449_1620712 Selaginella kraussiana KNOTTED1-like protein
           (KNOX1) mRNA, complete cds.
          Length = 460

 Score =  103 bits (257), Expect = 3e-21
 Identities = 43/83 (51%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   I+ ++ E ++K++ GKLP D+  +L  WW  H KWPYP+E +KA L
Sbjct: 355 KELKEQLMRKYSGYISSLKHEFLKKKKKGKLPKDSRQILLNWWSVHYKWPYPSESEKASL 414

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 415 AESTGLDQKQINNWFINQRKRHW 437



>gb:AF533597_1809465 Lycopersicon esculentum knotted protein TKN4
           (kn4) mRNA, complete cds.
          Length = 335

 Score =  103 bits (256), Expect = 4e-21
 Identities = 44/82 (53%), Positives = 60/82 (73%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R+E ++KR+ GKLP +   +L  WW++H +WPYPTEE+K RL 
Sbjct: 222 ELKEMLMRKYSGYLSSLRKEFLKKRKKGKLPKEARIVLLDWWKNHYRWPYPTEEEKNRLS 281

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 282 EMTGLDQKQINNWFINQRKRHW 303



>gb:AF375968_1792979 Lycopersicon esculentum knotted homeodomain
           protein 4 (KN4) mRNA, partial cds.
          Length = 338

 Score =  103 bits (256), Expect = 4e-21
 Identities = 44/82 (53%), Positives = 60/82 (73%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R+E ++KR+ GKLP +   +L  WW++H +WPYPTEE+K RL 
Sbjct: 225 ELKEMLMRKYSGYLSSLRKEFLKKRKKGKLPKEARIVLLDWWKNHYRWPYPTEEEKNRLS 284

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 285 EMTGLDQKQINNWFINQRKRHW 306



>gb:AY781901_1628330 Saccharum hybrid cultivar isolate c53a homeobox
           protein mRNA, complete cds.
          Length = 315

 Score =  103 bits (256), Expect = 4e-21
 Identities = 44/82 (53%), Positives = 58/82 (70%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   ++ +R E ++KR+ GKLP D  ++L  WW +H +WPYPTEEDK RL 
Sbjct: 182 ELKEMLLKKYSGCLSRLRSEFLKKRKKGKLPKDARTVLLEWWNTHYRWPYPTEEDKVRLA 241

Query: 507 QETGLQLKQINNWFINQRKRNW 442
             TGL  KQINNWFINQ+K++W
Sbjct: 242 AMTGLDPKQINNWFINQKKKHW 263



>sp|Q41330|HKN1_LYCES Homeotic protein knotted-1
           (TKN1).>pir|T07776|T07776 Kn1 like-homeo box protein -
           tomato>gb:LEU32247_1684729 Lycopersicon esculentum
           Knotted 1 mRNA, complete cds.
          Length = 355

 Score =  102 bits (253), Expect = 9e-21
 Identities = 46/112 (41%), Positives = 66/112 (58%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP D    L  WW+ H KWPYP+E +K  L
Sbjct: 235 RELKNHLLRKYSGYLSSLKQELSKKKKKGKLPKDARQKLITWWELHYKWPYPSESEKVAL 294

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAEKSSTEHFM 355
            + TGL  KQINNWFINQRKR+W  +             +SAA      H+M
Sbjct: 295 AESTGLDQKQINNWFINQRKRHWKPSEDMQFMVMDGLHPQSAAALYMEGHYM 346



>gb:AB015999_1512740 Ipomoea nil Pkn1 (knotted-like gene) mRNA,
           complete cds.
          Length = 333

 Score =  101 bits (252), Expect = 1e-20
 Identities = 44/83 (53%), Positives = 57/83 (68%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L Q Y   I+ ++ E  +K++ GKLP D   +L  WW+ H +WPYPTE+DK  L
Sbjct: 229 RELKSRLLQKYGGHISSLKLEFSKKKKKGKLPKDARQILLEWWKGHYRWPYPTEDDKISL 288

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 289 AELTGLDQKQINNWFINQRKRHW 311



>gb:AF544054_1810420 Nicotiana tabacum knotted 3 (kn3) mRNA, partial
           cds.
          Length = 340

 Score =  101 bits (251), Expect = 2e-20
 Identities = 45/112 (40%), Positives = 67/112 (59%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP D    L +WW+ H KWPYP+E +K  L
Sbjct: 220 RELKNHLLRKYSGYLSSLKQELSKKKKKGKLPKDARQKLLSWWELHYKWPYPSESEKVAL 279

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAEKSSTEHFM 355
            + TGL  KQINNWFINQRKR+W  +             ++AA      H+M
Sbjct: 280 AETTGLDQKQINNWFINQRKRHWKPSEDMQFMVMDGLHPQNAAALYMEGHYM 331



>gb:AB025714_1516735 Nicotiana tabacum mRNA for homeobox 20,
           complete cds.
          Length = 356

 Score =  101 bits (251), Expect = 2e-20
 Identities = 45/112 (40%), Positives = 67/112 (59%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP D    L +WW+ H KWPYP+E +K  L
Sbjct: 236 RELKNHLLRKYSGYLSSLKQELSKKKKKGKLPKDARQKLLSWWELHYKWPYPSESEKVAL 295

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNPXXXXXXSHKTKRKSAAEKSSTEHFM 355
            + TGL  KQINNWFINQRKR+W  +             ++AA      H+M
Sbjct: 296 AETTGLDQKQINNWFINQRKRHWKPSEDMQFMVMDGLHPQNAAALYMEGHYM 347



>sp|O04135|HKL2_MALDO Homeobox protein knotted-1 like 2
           (KNAP2).>pir|T17008|T17008 knotted1-like homeobox
           protein - apple tree>gb:MDKN12_1685935 M.domestica mRNA
           for kn1-like protein (1791 bp).
          Length = 397

 Score =  101 bits (251), Expect = 2e-20
 Identities = 41/83 (49%), Positives = 59/83 (71%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP D    L +WW+ H KWPYP+E +K  L
Sbjct: 278 RELKNHLLRKYSGYLSSLKQELSKKKKKGKLPKDARQKLLSWWELHYKWPYPSESEKVAL 337

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 338 AESTGLDQKQINNWFINQRKRHW 360



>gb:AF544053_1810419 Nicotiana tabacum knotted 2 (kn2) mRNA, partial
           cds.
          Length = 341

 Score =  100 bits (250), Expect = 2e-20
 Identities = 41/83 (49%), Positives = 59/83 (71%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP D    L +WW+ H KWPYP+E +K  L
Sbjct: 221 RELKNHLLRKYSGYLSSLKQELSKKKKKGKLPKDARQKLLSWWELHYKWPYPSESEKVAL 280

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 281 AETTGLDQKQINNWFINQRKRHW 303



>gb:AB016002_1512743 Ipomoea nil PKn3 (knotted-like gene) mRNA,
           complete cds.
          Length = 358

 Score =  100 bits (250), Expect = 2e-20
 Identities = 43/83 (51%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           Q++K  L + Y   ++ +R+E ++KR+ GKLP D    L  WW SH +WPY TEE+K +L
Sbjct: 241 QQIKEMLMRKYSGYLSSLRKEFLKKRKKGKLPKDARVALLDWWNSHYRWPYTTEEEKNKL 300

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 301 SEATGLDQKQINNWFINQRKRHW 323



>gb:AY755413_1626930 Populus alba x Populus tremula homeodomain
           protein ARBORKNOX1 (ARBORKNOX1) mRNA, complete cds.
          Length = 361

 Score =  100 bits (248), Expect = 3e-20
 Identities = 43/83 (51%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           QELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 242 QELKGQLLRRYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLAL 301

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 302 AESTGLDQKQINNWFINQRKRHW 324



>gb:AY684937_1622268 Populus balsamifera subsp. trichocarpa x
           Populus deltoides homeobox transcription factor KN2
           (Kn2) mRNA, complete cds.
          Length = 373

 Score =  100 bits (248), Expect = 3e-20
 Identities = 43/83 (51%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           QELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 254 QELKGQLLRRYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLAL 313

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 314 AESTGLDQKQINNWFINQRKRHW 336



>gb:DOR276389_1675995 Dendrobium grex Madame Thong-IN mRNA for
           knotted1-like homeobox protein.
          Length = 286

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 41/83 (49%), Positives = 57/83 (68%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + Y   ++ +++E  +K++ GKLP +   +L  WW +H KWPYPTE DK  L
Sbjct: 181 RDLKEKLLRKYSGYLSSLKQEFSKKKKKGKLPKEARQILFEWWTAHYKWPYPTEADKIAL 240

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 241 AEATGLDQKQINNWFINQRKRHW 263



>gb:AY169493_1586531 Nicotiana tabacum Knotted-1-like homeobox
           protein H1 (H1) mRNA, complete cds.
          Length = 343

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 43/83 (51%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           QELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 224 QELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWTRHYKWPYPSESQKLAL 283

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 284 AESTGLDQKQINNWFINQRKRHW 306



>gb:AY096803_1576297 Helianthus annuus knotted-1-like protein 2
           (kn2) mRNA, complete cds.
          Length = 358

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 40/83 (48%), Positives = 59/83 (71%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP +    L +WW+ H KWPYP+E +K  L
Sbjct: 236 RELKNHLLRKYSGYLSSLKQELSKKKKKGKLPKEARQKLLSWWELHYKWPYPSESEKVAL 295

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 296 AESTGLDQKQINNWFINQRKRHW 318



>gb:AB016001_1512742 Ipomoea nil PKn2s1 (knotted-like gene) mRNA,
           complete cds.
          Length = 237

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           + S+ +   ++LK+ L + Y   ++ ++ E  +K++ GKLP +    L  WW  H KWPY
Sbjct: 122 QESITKTEERQLKNTLLRKYGSHLSSLKLEFSKKKKKGKLPKEARQTLLDWWSDHYKWPY 181

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNW 442
           PTE DK  L + TGL  KQINNWFINQRKR+W
Sbjct: 182 PTEADKIALAESTGLDQKQINNWFINQRKRHW 213



>gb:AB016000_1512741 Ipomoea nil PKn2 (knotted-like gene) mRNA,
           complete cds.
          Length = 322

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 42/92 (45%), Positives = 59/92 (64%)
 Frame = -2

Query: 717 ERSLMERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPY 538
           + S+ +   ++LK+ L + Y   ++ ++ E  +K++ GKLP +    L  WW  H KWPY
Sbjct: 207 QESITKTEERQLKNTLLRKYGSHLSSLKLEFSKKKKKGKLPKEARQTLLDWWSDHYKWPY 266

Query: 537 PTEEDKARLVQETGLQLKQINNWFINQRKRNW 442
           PTE DK  L + TGL  KQINNWFINQRKR+W
Sbjct: 267 PTEADKIALAESTGLDQKQINNWFINQRKRHW 298



>pir|T01735|T01735 homeobox protein NTH15 - common
           tobacco>gb:AB004785_1509180 Nicotiana tabacum NTH15
           mRNA, complete cds.
          Length = 342

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 43/83 (51%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           QELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 223 QELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWTRHYKWPYPSESQKLAL 282

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 283 AESTGLDQKQINNWFINQRKRHW 305



>sp|O04134|HKL1_MALDO Homeobox protein knotted-1 like 1
           (KNAP1).>pir|T17009|T17009 knotted1-like homeobox
           protein - apple tree>gb:MDKN11_1685934 M.domestica mRNA
           for kn1-like protein (1759 bp).
          Length = 398

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 40/83 (48%), Positives = 59/83 (71%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP +    L +WW+ H KWPYP+E +K  L
Sbjct: 279 RELKNHLLRKYSGYLSSLKQELSKKKKKGKLPKEARQKLLSWWELHYKWPYPSESEKVAL 338

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 339 AESTGLDQKQINNWFINQRKRHW 361



>gb:AF482995_1804027 Arabidopsis thaliana RLD homeodomain protein
           KNAT1/BP mRNA, complete cds.
          Length = 400

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 40/83 (48%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 280 RELKNHLLKKYSGYLSSLKQELSKKKKKGKLPKEARQKLLTWWELHYKWPYPSESEKVAL 339

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 340 AESTGLDQKQINNWFINQRKRHW 362



>gb:AF482994_1804026 Arabidopsis thaliana Landsberg erecta
           homeodomain protein KNAT1/BP mRNA, complete cds.
          Length = 400

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 40/83 (48%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 280 RELKNHLLKKYSGYLSSLKQELSKKKKKGKLPKEARQKLLTWWELHYKWPYPSESEKVAL 339

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 340 AESTGLDQKQINNWFINQRKRHW 362



>gb:AC133450_1741458 Oryza sativa chromosome 3 BAC OSJNBa0072F13
           genomic sequence, complete sequence.
          Length = 336

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/87 (48%), Positives = 56/87 (64%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LKH L + Y   + D+R+   ++ + GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 201 KQLKHQLLRKYGGSLGDLRQVFSKRTKKGKLPKEARQKLLHWWELHYKWPYPSEMEKMTL 260

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNP 430
            Q TGL  KQINNWFINQRKR+W   P
Sbjct: 261 AQTTGLDQKQINNWFINQRKRHWKPTP 287



>gb:AY655754_1620249 Streptocarpus saxorum STM1 protein mRNA,
           complete cds.
          Length = 353

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/82 (51%), Positives = 55/82 (67%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   + ++++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L 
Sbjct: 235 ELKGQLLRKYSGYLGNLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLALA 294

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL+ KQINNWFINQRKR+W
Sbjct: 295 ESTGLEQKQINNWFINQRKRHW 316



>gb:AY080857_1568547 Arabidopsis thaliana putative homeobox protein
           (At1g62360) mRNA, partial cds.
          Length = 326

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E+ K  L
Sbjct: 205 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSEQQKLAL 264

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 265 AESTGLDQKQINNWFINQRKRHW 287



>gb:AY072735_1567388 Antirrhinum majus invaginata (ina) mRNA,
           complete cds.
          Length = 351

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 231 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLAL 290

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            ++TGL  KQINNWFINQRKR+W
Sbjct: 291 AEQTGLDQKQINNWFINQRKRHW 313



>gb:AB028884_1518119 Oryza sativa mRNA for knotted1-type homeobox
           protein OSH43, complete cds.
          Length = 341

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/87 (48%), Positives = 56/87 (64%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LKH L + Y   + D+R+   ++ + GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 206 KQLKHQLLRKYGGSLGDLRQVFSKRTKKGKLPKEARQKLLHWWELHYKWPYPSEMEKMTL 265

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNP 430
            Q TGL  KQINNWFINQRKR+W   P
Sbjct: 266 AQTTGLDQKQINNWFINQRKRHWKPTP 292



>gb:AE005173_893905 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC003113_1531104 Genomic sequence
           for Arabidopsis thaliana BAC F24O1 from chromosome I,
           complete sequence.
          Length = 377

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E+ K  L
Sbjct: 256 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSEQQKLAL 315

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 316 AESTGLDQKQINNWFINQRKRHW 338



>pir|S68456|S68456 homeotic protein shootmeristemless, KNOTTED-like
           - Arabidopsis thaliana>gb:ATU32344_1556908 Arabidopsis
           thaliana Shootmeristemless (STM) mRNA, complete cds.
          Length = 382

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E+ K  L
Sbjct: 261 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSEQQKLAL 320

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 321 AESTGLDQKQINNWFINQRKRHW 343



>sp|Q9M6D9|STM_BRAOL Homeobox protein
           Shootmeristemless.>gb:AF193813_1775565 Brassica oleracea
           shoot meristemless (Stm) mRNA, complete cds.
          Length = 383

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E+ K  L
Sbjct: 262 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSEQQKLAL 321

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 322 AESTGLDQKQINNWFINQRKRHW 344



>sp|Q38874|STM_ARATH Homeobox protein SHOOT
           MERISTEMLESS.>pir|T01446|T01446 hypothetical protein
           F24O1.8 - Arabidopsis thaliana
          Length = 382

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E+ K  L
Sbjct: 261 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSEQQKLAL 320

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 321 AESTGLDQKQINNWFINQRKRHW 343



>sp|P46639|HKL1_ARATH Homeobox protein knotted-1 like 1
           (KNAT1).>pir|D85080|D85080 KNAT1 homeobox-like protein
           [imported] - Arabidopsis thaliana>gb:AC006267_1533941
           Arabidopsis thaliana BAC F9M13 from chromosome IV near
           21.5 cM, complete sequence.>gb:ATCHRIV22_1544531
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 22.>gb:ATU14174_1556769 Arabidopsis thaliana clone
           KNAT1 knotted-like homeobox protein gene, partial
           cds.>gb:AY080834_1568527 Arabidopsis thaliana putative
           KNAT1 homeobox protein (At4g08150) mRNA, complete
           cds.>gb:AY113982_1578393 Arabidopsis thaliana putative
           KNAT1 homeobox protein (At4g08150) mRNA, complete cds.
          Length = 398

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 40/83 (48%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E+ +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 278 RELKNHLLKKYSGYLSSLKQELSKKKKKGKLPKEARQKLLTWWELHYKWPYPSESEKVAL 337

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 338 AESTGLDQKQINNWFINQRKRHW 360



>gb:AF308454_1784801 Medicago truncatula knotted class I homeodomain
           KNOX mRNA, complete cds.
          Length = 381

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 262 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLAL 321

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 322 AESTGLDQKQINNWFINQRKRHW 344



>gb:AC116369_1739293 Oryza sativa chromosome 3 BAC OSJNBb0113I20
           genomic sequence, complete sequence.
          Length = 175

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 43/87 (49%), Positives = 56/87 (64%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L   Y   ++ +  E+ +K++ GKLP D    L  WWQ H +WPYP+E +KA L
Sbjct: 37  KELKSHLLNKYSGYLSSLWRELSKKKKKGKLPRDARQKLLHWWQLHYRWPYPSELEKAAL 96

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNP 430
            + TGL  KQINNWFINQRKR+W   P
Sbjct: 97  AESTGLDAKQINNWFINQRKRHWKPTP 123



>gb:AC090683_1734403 Oryza sativa chromosome 3 BAC OSJNBa0035I24
           genomic sequence, complete sequence.
          Length = 337

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 43/87 (49%), Positives = 56/87 (64%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L   Y   ++ +  E+ +K++ GKLP D    L  WWQ H +WPYP+E +KA L
Sbjct: 199 KELKSHLLNKYSGYLSSLWRELSKKKKKGKLPRDARQKLLHWWQLHYRWPYPSELEKAAL 258

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNP 430
            + TGL  KQINNWFINQRKR+W   P
Sbjct: 259 AESTGLDAKQINNWFINQRKRHWKPTP 285



>gb:AY655753_1620248 Streptocarpus rexii STM1 protein mRNA, complete
           cds.
          Length = 358

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   + ++++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 239 RELKGQLLRRYSGYLGNLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLAL 298

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 299 AESTGLDQKQINNWFINQRKRHW 321



>gb:AY655752_1620247 Streptocarpus dunnii STM1 protein mRNA, partial
           cds.
          Length = 356

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 42/83 (50%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   + ++++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 237 RELKGQLLRRYSGYLGNLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSESQKLAL 296

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 297 AESTGLDQKQINNWFINQRKRHW 319



>gb:AB043956_1520039 Ceratopteris richardii mRNA for CRKNOX2,
           complete cds.
          Length = 430

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 41/83 (49%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           Q+LK  L + Y   I  +++E ++K++ GKLP +   +L  WW  H KWPYP+E +K  L
Sbjct: 288 QKLKEQLLRKYSGYIFKLKQEFLKKKKKGKLPREARQMLLDWWTQHYKWPYPSEAEKTAL 347

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 348 AESTGLDQKQINNWFINQRKRHW 370



>pir|T06382|T06382 Knox protein 1 - garden pea>gb:AF063307_1765410
           Pisum sativum Knox class 1 protein (Hop1) mRNA, complete
           cds.>gb:AF080104_1766433 Pisum sativum knotted1-like
           class I homeodomain protein (PsKn1) mRNA, complete cds.
          Length = 371

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 252 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLAL 311

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 312 AESTGLDQKQINNWFINQRKRHW 334



>sp|Q41853|RSH1_MAIZE Homeobox protein rough sheath
           1.>pir|T03946|T03946 Kn1 like-homeo box protein RS1 -
           maize>gb:MZERS1R_1688035 Zea mays RS1 mRNA, complete
           cds.
          Length = 351

 Score = 99.0 bits (245), Expect = 8e-20
 Identities = 41/83 (49%), Positives = 57/83 (68%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 231 KELKYQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIAL 290

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 291 AESTGLDQKQINNWFINQRKRHW 313



>gb:PMU90091_1700843 Picea mariana homeobox transcription factor
           SKN1 mRNA, complete cds.
          Length = 433

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 315 RELKDHLLRRYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWSLHDKWPYPSETEKIAL 374

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 375 AECTGLDQKQINNWFINQRKRHW 397



>gb:AY684938_1622269 Populus balsamifera subsp. trichocarpa x
           Populus deltoides homeobox transcription factor KN3
           (Kn3) mRNA, complete cds.
          Length = 368

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 40/83 (48%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   +  +++E+ +K++ GKLP +    L +WW+ H KWPYP+E +K  L
Sbjct: 249 RELKNHLLRKYSGYLGSLKQELSKKKKKGKLPKEARQKLLSWWELHYKWPYPSETEKVAL 308

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 309 AETTGLDQKQINNWFINQRKRHW 331



>gb:AY680405_1622080 Picea mariana homeobox transcription factor KN4
           (Kn4) mRNA, complete cds.
          Length = 438

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 41/83 (49%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y    + +++E ++K++ GKLP +    L  WW  H KWPYP+E DK  L
Sbjct: 328 RELKDQLLRKYSGYFSSLKQEFLKKKKKGKLPKEARQKLLEWWNVHYKWPYPSETDKVSL 387

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 388 AESTGLDQKQINNWFINQRKRHW 410



>gb:AY680400_1622075 Picea abies homeobox transcription factor KN4
           (Kn4) gene, exons 4, 5 and partial
           cds.>gb:AY680401_1622076 Picea glauca homeobox
           transcription factor KN4 (Kn4) gene, exons 4, 5 and
           partial cds.
          Length = 135

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 41/83 (49%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y    + +++E ++K++ GKLP +    L  WW  H KWPYP+E DK  L
Sbjct: 25  RELKDQLLRKYSGYFSSLKQEFLKKKKKGKLPKEARQKLLEWWNVHYKWPYPSETDKVSL 84

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 85  AESTGLDQKQINNWFINQRKRHW 107



>gb:AY680398_1622073 Pinus taeda homeobox transcription factor KN4
           (Kn4) gene, exons 4, 5 and partial cds.
          Length = 135

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 41/83 (49%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y    + +++E ++K++ GKLP +    L  WW  H KWPYP+E DK  L
Sbjct: 25  RELKDQLLRKYSGYFSSLKQEFLKKKKKGKLPKEARQKLLEWWNVHYKWPYPSETDKVAL 84

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 85  AESTGLDQKQINNWFINQRKRHW 107



>gb:AY680392_1622067 Picea glauca homeobox transcription factor KN1
           (Kn1) gene, exons 4, 5 and partial cds.
          Length = 142

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 24  RELKDHLLRRYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWSLHDKWPYPSETEKIAL 83

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 84  AECTGLDQKQINNWFINQRKRHW 106



>gb:AY423709_1605483 Populus alba x Populus tremula putative
           Kn1-like homeobox protein mRNA, partial cds.
          Length = 186

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 40/83 (48%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   +  +++E+ +K++ GKLP +    L +WW+ H KWPYP+E +K  L
Sbjct: 86  RELKNHLLRKYSGYLGSLKQELSKKKKKGKLPKEARQKLLSWWELHYKWPYPSETEKVAL 145

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 146 AETTGLDQKQINNWFINQRKRHW 168



>gb:AY312168_1598229 Zea mays homeobox transcription factor GNARLY1
           (gn1) gene, complete cds.
          Length = 360

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 41/83 (49%), Positives = 57/83 (68%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 237 KELKYQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIAL 296

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 297 AEATGLDQKQINNWFINQRKRHW 319



>gb:AY072736_1567389 Antirrhinum majus hirzina (hirz) mRNA, complete
           cds.
          Length = 353

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 42/82 (51%), Positives = 53/82 (64%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L 
Sbjct: 235 ELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLEWWSRHYKWPYPSESQKLALA 294

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 295 ESTGLDQKQINNWFINQRKRHW 316



>gb:AB025713_1516734 Nicotiana tabacum mRNA for homeobox 9, complete
           cds.
          Length = 322

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 43/88 (48%), Positives = 57/88 (64%)
 Frame = -2

Query: 705 MERVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEE 526
           M R   E+K  L + Y   I+ +++E  +K + GKLP +   +L  WW +H KWPYPTE 
Sbjct: 215 MCRSENEIKDKLMRKYSGYISSLKQEFSKKNKKGKLPREARQILLNWWTTHYKWPYPTEG 274

Query: 525 DKARLVQETGLQLKQINNWFINQRKRNW 442
           +K  L + TGL  KQINNWFINQRKR+W
Sbjct: 275 EKICLAESTGLDPKQINNWFINQRKRHW 302



>pir|A96729|A96729 homeotic protein (ATK1), 26548-32058 [imported] -
           Arabidopsis thaliana>gb:AE005173_894635 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010796_1537110 Arabidopsis thaliana
           chromosome 1 BAC F24J13 genomic sequence, complete
           sequence.
          Length = 311

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + +   I+ ++ E  +K++ GKLP +    L  WW  H+KWPYPTE DK  L
Sbjct: 208 RDLKDQLLRKFGSHISSLKLEFSKKKKKGKLPREARQALLDWWNVHNKWPYPTEGDKISL 267

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            +ETGL  KQINNWFINQRKR+W
Sbjct: 268 AEETGLDQKQINNWFINQRKRHW 290



>pir|S57818|S57818 homeotic protein ATK1 - Arabidopsis
           thaliana>gb:ATATK1DNA_1544103 A.thaliana ATK1
           gene.>gb:ATATK1RNA_1544104 A.thaliana mRNA for ATK1
           protein.
          Length = 311

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + +   I+ ++ E  +K++ GKLP +    L  WW  H+KWPYPTE DK  L
Sbjct: 207 RDLKDQLLRKFGSHISSLKLEFSKKKKKGKLPREARQALLDWWNVHNKWPYPTEGDKIAL 266

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            +ETGL  KQINNWFINQRKR+W
Sbjct: 267 AEETGLDQKQINNWFINQRKRHW 289



>sp|P46640|HKL2_ARATH Homeobox protein knotted-1 like 2 (KNAT2)
           (ATK1).>gb:ATU14175_1556770 Arabidopsis thaliana clone
           KNAT2 knotted-like homeobox protein gene, partial cds.
          Length = 310

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + +   I+ ++ E  +K++ GKLP +    L  WW  H+KWPYPTE DK  L
Sbjct: 207 RDLKDQLLRKFGSHISSLKLEFSKKKKKGKLPREARQALLDWWNVHNKWPYPTEGDKISL 266

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            +ETGL  KQINNWFINQRKR+W
Sbjct: 267 AEETGLDQKQINNWFINQRKRHW 289



>gb:AF170172_1774244 Acetabularia acetabulum KNOX1 homeodomain
           protein (Knox1) mRNA, complete cds.
          Length = 382

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 41/87 (47%), Positives = 59/87 (67%)
 Frame = -2

Query: 699 RVRQELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDK 520
           R  QE +  LKQ Y++++  ++EE  ++++ GKLP  +  +LK+WW+ H  WPYPT+  K
Sbjct: 189 RNEQEQRVLLKQKYRQELLALKEEFSKRKKRGKLPTHSIEVLKSWWKEHIAWPYPTDSAK 248

Query: 519 ARLVQETGLQLKQINNWFINQRKRNWH 439
             L  +T L   QINNWFINQRKR+WH
Sbjct: 249 RSLASQTNLTSIQINNWFINQRKRHWH 275



>gb:AY680402_1622077 Pinus taeda homeobox transcription factor KN1
           (Kn1) mRNA, complete cds.
          Length = 434

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 42/83 (50%), Positives = 57/83 (68%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK+ L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 316 RELKNHLLRKYCGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWSLHDKWPYPSETEKIAL 375

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 376 AECTGLDQKQINNWFINQRKRHW 398



>gb:AY112704_1578154 Petunia x hybrida shootmeristemless-like mRNA,
           complete cds.
          Length = 347

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 228 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWTRHYKWPYPSESQKLAL 287

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 288 AESTGLDQKQINNWFINQRKRHW 310



>sp|P56662|HKL4_MAIZE Homeobox protein knotted-1 like 4 (Fragment).
          Length = 85

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 41/82 (50%), Positives = 56/82 (68%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK+ L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L 
Sbjct: 1   ELKYQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIALA 60

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 61  EATGLDQKQINNWFINQRKRHW 82



>gb:AP004301_1839821 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0483E09.
          Length = 412

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 41/83 (49%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 292 KELKFQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIAL 351

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 352 AESTGLDQKQINNWFINQRKRHW 374



>gb:AF544045_1810411 Hordeum vulgare knotted 1 (kn1) mRNA, complete
           cds.
          Length = 349

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 40/83 (48%), Positives = 57/83 (68%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK+ L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 229 KDLKYQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIAL 288

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 289 AESTGLDQKQINNWFINQRKRHW 311



>gb:LEU76407_1684760 Lycopersicon esculentum knotted 2 protein
           (TKn2) mRNA, complete cds.
          Length = 354

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 235 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLVDWWLRHIKWPYPSESQKLAL 294

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 295 AESTGLDQKQINNWFINQRKRHW 317



>gb:HTU519674_1682195 Helianthus tuberosus mRNA for putative
           knotted-1-like protein (knot1HT gene).
          Length = 362

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 245 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWTRHYKWPYPSEAQKLAL 304

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 305 AESTGLDQKQINNWFINQRKRHW 327



>gb:AY096804_1576298 Helianthus annuus knotted-1-like protein 3
           (kn3) mRNA, partial cds.
          Length = 189

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 72  RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWTRHYKWPYPSEAQKLAL 131

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 132 AESTGLDQKQINNWFINQRKRHW 154



>gb:AY096802_1576296 Helianthus annuus knotted-1-like protein 1
           (kn1) mRNA, complete cds.
          Length = 362

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 243 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWTRHYKWPYPSEAQKLAL 302

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 303 AESTGLDQKQINNWFINQRKRHW 325



>gb:AB016071_1512760 Oryza sativa (japonica cultivar-group) mRNA,
           complete cds.>gb:AP006172_1861327 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0088O14.
          Length = 355

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 41/83 (49%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 235 KELKFQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIAL 294

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 295 AESTGLDQKQINNWFINQRKRHW 317



>gb:AB007623_1510114 Oryza sativa (japonica cultivar-group) Hos3
           mRNA, partial cds.
          Length = 355

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 41/83 (49%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 235 KELKFQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIAL 294

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 295 AESTGLDQKQINNWFINQRKRHW 317



>pir|T02785|T02785 probable homeotic protein -
           rice>gb:AF050181_1764150 Oryza sativa strain Indica IR58
           KNOX class homeodomain protein (Oskn3) mRNA, complete
           cds.
          Length = 357

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 41/83 (49%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +R+E  +K++ GKLP +    L  WW+ H KWPYP+E +K  L
Sbjct: 237 KELKFQLLKKYSGYLSSLRQEFSKKKKKGKLPKEARQKLLHWWELHYKWPYPSETEKIAL 296

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 297 AESTGLDQKQINNWFINQRKRHW 319



>sp|P46608|HMB1_SOYBN Homeobox protein SBH1.>pir|S42543|S42543
           hypothetical protein - soybean>gb:SOYHOMEOGE_1716020
           Glycine max homeobox-containing (Sbh1) mRNA, complete
           cds.
          Length = 379

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 260 RDLKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLEWWNRHYKWPYPSESQKLAL 319

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 320 AESTGLDQKQINNWFINQRKRHW 342



>sp|P56667|HKLA_MAIZE Homeobox protein knotted-1 like 10 (Fragment).
          Length = 88

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 42/82 (51%), Positives = 56/82 (68%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           +LK+ L   Y   ++ +  E+ RK++ GKLP D    L  WWQ H +WPYP+E +KA L 
Sbjct: 4   DLKNRLLNKYSGYLSSLWRELSRKKKKGKLPRDARQKLLHWWQLHYRWPYPSELEKAALA 63

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL+ KQINNWFINQRKR+W
Sbjct: 64  ESTGLEAKQINNWFINQRKRHW 85



>sp|O22299|HKL6_LYCES Homeobox protein knotted-1 like
           LET6.>pir|T04317|T04317 homeobox protein LeT6, class I
           knotted-like - tomato>gb:LEAF000141_1684202 Lycopersicon
           esculentum class I knotted-like homeodomain protein
           (LeT6) mRNA, complete cds.
          Length = 355

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP+E  K  L
Sbjct: 236 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLVDWWLRHIKWPYPSESQKLAL 295

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 296 AESTGLDQKQINNWFINQRKRHW 318



>gb:AF063248_1765407 Picea abies homeobox protein mRNA, complete
           cds.
          Length = 434

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 316 RELKDHLLRKYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWTVHYKWPYPSETEKIAL 375

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 376 AECTGLDQKQINNWFINQRKRHW 398



>gb:PMU90092_1700844 Picea mariana homeobox transcription factor
           SKN2 mRNA, complete cds.
          Length = 442

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 324 RELKDHLLRKYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWTVHYKWPYPSETEKIAL 383

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 384 AECTGLDQKQINNWFINQRKRHW 406



>gb:AY680403_1622078 Pinus taeda homeobox transcription factor KN2
           (Kn2) mRNA, complete cds.
          Length = 429

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 311 RELKDHLLRKYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWTVHYKWPYPSETEKIAL 370

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 371 AECTGLDQKQINNWFINQRKRHW 393



>gb:AY680394_1622069 Picea glauca homeobox transcription factor KN2
           (Kn2) gene, exons 4, 5 and partial cds.
          Length = 131

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 13  RELKDHLLRKYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWTVHYKWPYPSETEKIAL 72

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 73  AECTGLDQKQINNWFINQRKRHW 95



>gb:AY680393_1622068 Pinus strobus homeobox transcription factor KN2
           (Kn2) gene, exons 4, 5 and partial cds.
          Length = 139

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 21  RELKDHLLRKYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWTVHYKWPYPSETEKIAL 80

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 81  AECTGLDQKQINNWFINQRKRHW 103



>gb:AY680391_1622066 Pinus strobus homeobox transcription factor KN1
           (Kn1) gene, exons 4, 5 and partial cds.
          Length = 142

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 42/83 (50%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KWPYP+E +K  L
Sbjct: 24  RELKDHLLRKYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWTVHYKWPYPSETEKIAL 83

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 84  AECTGLDQKQINNWFINQRKRHW 106



>gb:AB043955_1520038 Ceratopteris richardii mRNA for CRKNOX1s,
           complete cds.
          Length = 240

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 41/83 (49%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           Q++K  L + Y   I  +++E ++K++ GKLP +    L  WW  H KWPYP+E +KA L
Sbjct: 98  QKVKEQLLRKYSGYIYKLKQEFLKKKKKGKLPKNAREKLLDWWNQHYKWPYPSEAEKAAL 157

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 158 AETTGLDQKQINNWFINQRKRHW 180



>gb:AB043954_1520037 Ceratopteris richardii mRNA for CRKNOX1,
           complete cds.
          Length = 512

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 41/83 (49%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           Q++K  L + Y   I  +++E ++K++ GKLP +    L  WW  H KWPYP+E +KA L
Sbjct: 370 QKVKEQLLRKYSGYIYKLKQEFLKKKKKGKLPKNAREKLLDWWNQHYKWPYPSEAEKAAL 429

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 430 AETTGLDQKQINNWFINQRKRHW 452



>pir|T07777|T07777 probable homeobox protein H1 -
           potato>gb:STU65648_1723145 Solanum tuberosum homeodomain
           protein POTH1 mRNA, complete cds.
          Length = 345

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 41/82 (50%), Positives = 55/82 (67%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + +   ++ ++ E  +K++ GKLP +   +L AWW  H +WPYPTE DK  L 
Sbjct: 241 ELKDRLLRKFGSHLSSLKLEFSKKKKKGKLPKEARQMLLAWWDDHFRWPYPTEADKNSLA 300

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 301 ESTGLDPKQINNWFINQRKRHW 322



>sp|P56666|HKL8_MAIZE Homeobox protein knotted-1 like 8 (Fragment).
          Length = 85

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 41/82 (50%), Positives = 55/82 (67%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELKH L + Y   +  +R+E  ++++ GKLP +    L  WW+ H KWPYP+E +K  L 
Sbjct: 1   ELKHQLLRKYGGYLGGLRQEFSKRKKKGKLPKEARQKLLHWWELHYKWPYPSETEKMALA 60

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 61  ETTGLDPKQINNWFINQRKRHW 82



>gb:AB025715_1516736 Nicotiana tabacum mRNA for homeobox 22,
           complete cds.
          Length = 319

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 41/82 (50%), Positives = 55/82 (67%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + +   ++ ++ E  +K++ GKLP +   +L AWW  H +WPYPTE DK  L 
Sbjct: 216 ELKDRLLRKFGSHLSTLKLEFSKKKKKGKLPKEARQMLLAWWNDHYRWPYPTEADKNSLA 275

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 276 ESTGLDPKQINNWFINQRKRHW 297



>sp|P56661|HKL3_MAIZE Homeobox protein knotted-1 like 3 (Fragment).
          Length = 88

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 40/83 (48%), Positives = 58/83 (69%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   + ++R+E+ +KR+  KLP +    L +WW+ H +WPYP+E +K  L
Sbjct: 3   KELKKQLLRKYSGCLGNLRKELCKKRKKDKLPKEARQKLLSWWELHYRWPYPSEMEKIAL 62

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL+ KQINNWFINQRKR+W
Sbjct: 63  AESTGLEQKQINNWFINQRKRHW 85



>gb:AB071664_1522926 Oryza sativa (indica cultivar-group) gene for
           transcription factor OSH3, complete cds, cultivar:IR24.
          Length = 365

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 228 LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 287

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 288 STGLEQKQINNWFINQRKRHW 308



>gb:AB071513_1522882 Oryza meridionalis gene for transcription
           factor OSH3, partial cds, cultivar:W1629.
          Length = 136

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AB071498_1522867 Oryza glaberrima gene for transcription factor
           OSH3, partial cds, cultivar:W440.>gb:AB071505_1522874
           Oryza glaberrima gene for transcription factor OSH3,
           partial cds, cultivar:W025.>gb:AB071506_1522875 Oryza
           glumaepatula gene for transcription factor OSH3, partial
           cds, cultivar:W1187.>gb:AB071508_1522877 Oryza barthii
           gene for transcription factor OSH3, partial cds,
           cultivar:W1416.>gb:AB071512_1522881 Oryza longistaminata
           gene for transcription factor OSH3, partial cds,
           cultivar:W1649.
          Length = 138

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AB071477_1522846 Oryza rufipogon gene for transcription factor
           OSH3, partial cds, cultivar:W629.
          Length = 138

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AB071460_1522829 Oryza sativa (japonica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:532.>gb:AB071463_1522832 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:M24.>gb:AB071467_1522836 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:220.>gb:AB071468_1522837 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:P9.>gb:AB071485_1522854 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:444.>gb:AB071491_1522860 Oryza
           sativa (japonica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:538.>gb:AB071499_1522868 Oryza sativa gene for
           transcription factor OSH3, partial cds, cultivar:221.
          Length = 138

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AB071454_1522823 Oryza sativa gene for transcription factor
           OSH3, partial cds, cultivar:Is6.>gb:AB071455_1522824
           Oryza sativa gene for transcription factor OSH3, partial
           cds, cultivar:Is108.>gb:AB071456_1522825 Oryza sativa
           gene for trascription factor OSH3, partial cds,
           cultivar:325.>gb:AB071457_1522826 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:644.>gb:AB071465_1522834 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:201.>gb:AB071466_1522835 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:206.>gb:AB071470_1522839 Oryza sativa gene for
           transcription factor OSH3, partial cds,
           cultivar:624.>gb:AB071497_1522866 Oryza sativa gene for
           transcription factor OSH3, partial cds, cultivar:306.
          Length = 138

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AB071439_1522809 Oryza sativa (indica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:A39.>gb:AB071440_1522810 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:Km5.>gb:AB071441_1522811 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:710.>gb:AB071442_1522812 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:717.>gb:AB071443_1522813 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:Is24.>gb:AB071444_1522814 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:451.>gb:AB071445_1522815 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:M23.>gb:AB071446_1522816 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:230.>gb:AB071448_1522817 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:C9329.>gb:AB071449_1522818 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:C9392.>gb:AB071450_1522819 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:C9463.>gb:AB071471_1522840 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1654.>gb:AB071472_1522841 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1965.>gb:AB071473_1522842 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W137.>gb:AB071474_1522843 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1976.>gb:AB071475_1522844 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1987.>gb:AB071476_1522845 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W596.>gb:AB071478_1522847 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W630.>gb:AB071479_1522848 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1811.>gb:AB071480_1522849 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1680.>gb:AB071481_1522850 Oryza rufipogon gene
           for transcription factor OSH3, partial cds,
           cultivar:W1865.>gb:AB071482_1522851 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:IR24.>gb:AB071483_1522852 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:721.>gb:AB071484_1522853 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:423.>gb:AB071486_1522855 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:Kasalath.>gb:AB071487_1522856 Oryza sativa
           (indica cultivar-group) gene for transcription factor
           OSH3, partial cds, cultivar:IVT1.>gb:AB071500_1522869
           Oryza sativa (indica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:414.>gb:AB071501_1522870 Oryza sativa (indica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:868.>gb:AB071502_1522871 Oryza
           sativa (indica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:Acc10818.>gb:AB071503_1522872 Oryza sativa
           (indica cultivar-group) gene for transcription factor
           OSH3, partial cds, cultivar:Acc6622.>gb:AB071507_1522876
           Oryza glumaepatula gene for transcription factor OSH3,
           partial cds, cultivar:W1192.>gb:AB071510_1522879 Oryza
           longistaminata gene for transcription factor OSH3,
           partial cds, cultivar:W1618.>gb:AB071511_1522880 Oryza
           meridionalis gene for transcription factor OSH3, partial
           cds, cultivar:W1631.>gb:AB071897_1522966 Oryza sativa
           (indica cultivar-group) gene for Transcription factor
           OSH3, partial cds.
          Length = 138

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AB071504_1522873 Oryza glaberrima gene for transcription factor
           OSH3, partial cds, cultivar:C8549.>gb:AB071509_1522878
           Oryza barthii gene for transcription factor OSH3,
           partial cds, cultivar:W1468.
          Length = 138

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 40/81 (49%), Positives = 55/81 (67%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYTGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AF483278_1804042 Picea abies KNOTTED1-like homeodomain protein 3
           (HBK3) mRNA, complete cds.
          Length = 433

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 41/83 (49%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E M+K++ GKLP D    L  WW  H KW YP+E +K  L
Sbjct: 315 RELKDHLLRRYSGYLSSLKQEFMKKKKKGKLPKDARQKLLDWWSLHDKWSYPSETEKIAL 374

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 375 AECTGLDQKQINNWFINQRKRHW 397



>gb:AF100326_1768094 Dendrobium grex Madame Thong-IN homeobox
           protein OVG2 (ovg2) mRNA, partial cds.
          Length = 101

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 39/77 (50%), Positives = 53/77 (68%)
 Frame = -2

Query: 672 LKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGL 493
           L + Y   ++ +++E  +K++ GKLP +   +L  WW +H KWPYPTE DK  L + TGL
Sbjct: 2   LLRKYSGYLSSLKQEFSKKKKKGKLPKEARQILFEWWTAHYKWPYPTEADKIALAEATGL 61

Query: 492 QLKQINNWFINQRKRNW 442
             KQINNWFINQRKR+W
Sbjct: 62  DQKQINNWFINQRKRHW 78



>gb:AY601274_1617427 Chelidonium majus shoot meristemless-like
           protein (STM) mRNA, partial cds.
          Length = 159

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 40/81 (49%), Positives = 52/81 (64%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +++E ++KR+ GKLP +    L  WW  H KWPYP+E  K  L +
Sbjct: 77  LKGQLLRKYSGYLGSLKQEFLKKRKKGKLPKEARQQLLEWWSRHYKWPYPSESQKIALAE 136

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL  KQINNWFINQRKR+W
Sbjct: 137 STGLDQKQINNWFINQRKRHW 157



>gb:AY680399_1622074 Pinus strobus homeobox transcription factor KN4
           (Kn4) gene, exons 4, 5 and partial cds.
          Length = 124

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 40/83 (48%), Positives = 53/83 (63%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y      +++E ++K++ GKLP +    L  WW  H KWPYP+E DK  L
Sbjct: 14  RELKDQLLRKYSGYFNSLKQEFLKKKKKGKLPKEARQKLLEWWNVHYKWPYPSETDKVSL 73

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            +  GL  KQINNWFINQRKR+W
Sbjct: 74  AESIGLDQKQINNWFINQRKRHW 96



>gb:BT002930_1636518 Arabidopsis thaliana clone RAFL14-89-I21
           (R20256) putative homeodomain transcription factor KNAT6
           (At1g23380) mRNA, complete cds.>gb:BT004370_1637442
           Arabidopsis thaliana clone U20256 putative homeodomain
           transcription factor KNAT6 (At1g23380) mRNA, complete
           cds.
          Length = 327

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + +  +I+ ++ E  +K++ GKLP +    L  WW  H KWPYPTE DK  L
Sbjct: 223 RDLKDRLLRKFGSRISTLKLEFSKKKKKGKLPREARQALLDWWNLHYKWPYPTEGDKIAL 282

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 283 ADATGLDQKQINNWFINQRKRHW 305



>gb:AB072362_1522995 Arabidopsis thaliana KNAT6L mRNA for
           homeodomain transcription factor KNAT6, complete cds.
          Length = 326

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + +  +I+ ++ E  +K++ GKLP +    L  WW  H KWPYPTE DK  L
Sbjct: 222 RDLKDRLLRKFGSRISTLKLEFSKKKKKGKLPREARQALLDWWNLHYKWPYPTEGDKIAL 281

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 282 ADATGLDQKQINNWFINQRKRHW 304



>gb:AB072361_1522994 Arabidopsis thaliana KNAT6S mRNA for
           homeodomain transcription factor KNAT6, complete
           cds.>gb:AC005292_1532434 Genomic sequence for
           Arabidopsis thaliana BAC F26F24 from chromosome I,
           complete sequence.
          Length = 324

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + +  +I+ ++ E  +K++ GKLP +    L  WW  H KWPYPTE DK  L
Sbjct: 220 RDLKDRLLRKFGSRISTLKLEFSKKKKKGKLPREARQALLDWWNLHYKWPYPTEGDKIAL 279

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 280 ADATGLDQKQINNWFINQRKRHW 302



>gb:AE005172_891291 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC007945_1536356 Genomic sequence
           for Arabidopsis thaliana BAC F28C11 from chromosome I,
           complete sequence.
          Length = 344

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           ++LK  L + +  +I+ ++ E  +K++ GKLP +    L  WW  H KWPYPTE DK  L
Sbjct: 240 RDLKDRLLRKFGSRISTLKLEFSKKKKKGKLPREARQALLDWWNLHYKWPYPTEGDKIAL 299

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              TGL  KQINNWFINQRKR+W
Sbjct: 300 ADATGLDQKQINNWFINQRKRHW 322



>gb:AF483277_1804041 Picea abies KNOTTED1-like homeodomain protein 2
           (HBK2) mRNA, partial cds.
          Length = 383

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 39/83 (46%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E ++K++ GKLP +    L  WW  + KWPYP+E  K  L
Sbjct: 263 RELKDQLLRKYSGYLSSLKQEFLKKKKKGKLPKEARQKLLDWWTRNYKWPYPSESQKIAL 322

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 323 AESTGLDQKQINNWFINQRKRHW 345



>gb:LEU76408_1684761 Lycopersicon esculentum knotted 3 protein
           (TKn3) mRNA, complete cds.
          Length = 320

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 40/82 (48%), Positives = 54/82 (65%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L + +   ++ ++ E  +K++ GKLP +   +L AWW  H +WPY TE DK  L 
Sbjct: 215 ELKDRLLRKFGSHLSSLKLEFSKKKKKGKLPKEAREMLLAWWYDHFRWPYSTEADKNSLA 274

Query: 507 QETGLQLKQINNWFINQRKRNW 442
           + TGL  KQINNWFINQRKR+W
Sbjct: 275 ESTGLDPKQINNWFINQRKRHW 296



>gb:AY680404_1622079 Pinus taeda homeobox transcription factor KN3
           (Kn3) mRNA, complete cds.
          Length = 470

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 39/83 (46%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E ++K++ GKLP +    L  WW  + KWPYP+E  K  L
Sbjct: 350 RELKDQLLRKYSGYLSSLKQEFLKKKKKGKLPKEARQKLLDWWTRNYKWPYPSESQKIAL 409

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 410 AESTGLDQKQINNWFINQRKRHW 432



>gb:AY680395_1622070 Pinus strobus homeobox transcription factor KN3
           (Kn3) gene, exons 4, 5 and partial
           cds.>gb:AY680396_1622071 Picea glauca homeobox
           transcription factor KN3 (Kn3) gene, exons 4, 5 and
           partial cds.>gb:AY680397_1622072 Picea mariana homeobox
           transcription factor KN3 (Kn3) gene, exons 4, 5 and
           partial cds.
          Length = 134

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 39/83 (46%), Positives = 55/83 (66%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   ++ +++E ++K++ GKLP +    L  WW  + KWPYP+E  K  L
Sbjct: 14  RELKDQLLRKYSGYLSSLKQEFLKKKKKGKLPKEARQKLLDWWTRNYKWPYPSESQKIAL 73

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 74  AESTGLDQKQINNWFINQRKRHW 96



>gb:AF284817_1783102 Physcomitrella patens class 1 KNOTTED1-like
           protein MKN4 (MKN4) gene, complete cds.
          Length = 488

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 43/83 (51%), Positives = 57/83 (68%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L+  Y + IA ++ E  R R+ GKLP +   +LK W+  HS WPYP+E +KA L
Sbjct: 374 EELKKMLRLKYGKHIAGLKAEFNRVRKKGKLPTNARQILKDWFSRHSYWPYPSEMEKAYL 433

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            +  GL LKQINNWFIN+RKR+W
Sbjct: 434 QRLCGLNLKQINNWFINERKRHW 456



>gb:AC092781_1735736 Oryza sativa chromosome 3 BAC OSJNBb0094O03
           genomic sequence, complete sequence.
          Length = 353

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 41/88 (46%), Positives = 55/88 (62%), Gaps = 1/88 (1%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSH-SKWPYPTEEDKAR 514
           ++LKH L   Y   + D+R+   ++ + GKLP +    L  WW+ H  KWPYP+E +K  
Sbjct: 213 KQLKHQLLMKYGGSLGDLRQAFSKRTKKGKLPKEARLKLLHWWELHYDKWPYPSEVEKMT 272

Query: 513 LVQETGLQLKQINNWFINQRKRNWHTNP 430
           L Q TGL  KQI+NWFINQRKR+W   P
Sbjct: 273 LAQTTGLDQKQISNWFINQRKRHWKPTP 300



>gb:AB071451_1522820 Oryza sativa (japonica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:712.>gb:AB071453_1522822 Oryza sativa (japonica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:708.>gb:AB071458_1522827 Oryza
           sativa (japonica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:J67.>gb:AB071462_1522831 Oryza sativa (japonica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:K8.>gb:AB071464_1522833 Oryza
           sativa gene for transcription factor OSH3, partial cds,
           cultivar:Bm5.>gb:AB071488_1522857 Oryza sativa (japonica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:709.>gb:AB071489_1522858 Oryza
           sativa gene for transcription factor OSH3, partial cds,
           cultivar:718.>gb:AB071490_1522859 Oryza sativa (japonica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:1021.
          Length = 138

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 39/81 (48%), Positives = 54/81 (66%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WP P+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPNPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AF527947_1808527 Brassica oleracea homeodomain protein BOSTM-1
           (STM-1) mRNA, complete cds.
          Length = 380

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 41/83 (49%), Positives = 54/83 (65%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L + Y   +  +++E M+KR+ GKLP +    L  WW  H KWPYP++  K  L
Sbjct: 261 RELKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLDWWSRHYKWPYPSQ--KLAL 318

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            + TGL  KQINNWFINQRKR+W
Sbjct: 319 AESTGLDQKQINNWFINQRKRHW 341



>gb:AF544046_1810412 Hordeum vulgare knotted 2 (kn2) gene, partial
           cds.
          Length = 159

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 41/87 (47%), Positives = 55/87 (63%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +ELK  L   Y   ++ + +++ +K++ GKLP D    L  WWQ H +WPYP+   KA L
Sbjct: 31  KELKSHLLNKYSGYLSSLWKDLSKKKKKGKLPRDARQKLLHWWQLHYRWPYPS---KAAL 87

Query: 510 VQETGLQLKQINNWFINQRKRNWHTNP 430
            + TGL  KQINNWFINQRKR+W   P
Sbjct: 88  AESTGLDAKQINNWFINQRKRHWKPTP 114



>gb:AB071452_1522821 Oryza sativa gene for transcription factor
           OSH3, partial cds, cultivar:701.
          Length = 138

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 39/81 (48%), Positives = 54/81 (66%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  W + H +WPYP+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWCELHYRWPYPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINNWFINQRKR+W
Sbjct: 66  STGLEQKQINNWFINQRKRHW 86



>gb:AF285147_1783115 Physcomitrella patens class 1 KNOTTED1-like
           protein MKN2 (MKN2) gene, partial cds.
          Length = 231

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 39/83 (46%), Positives = 56/83 (67%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +++K  L++ Y   I +++ E  R R+ GKLP    ++LK W+  HS WPYP+E +K  L
Sbjct: 93  EDIKKALRKKYGRHIGELKAEFNRVRKKGKLPTSARTILKDWFNRHSHWPYPSEMEKQYL 152

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
            +  GL LKQINNWFIN+RKR+W
Sbjct: 153 QRICGLNLKQINNWFINERKRHW 175



>gb:AB071663_1522925 Oryza sativa (japonica cultivar-group) gene for
           transcription factor OSH3, complete cds,
           cultivar:Nipponbare.>gb:AC145380_1744353 Oryza sativa
           chromosome 3 BAC OSJNBa0013A09 genomic sequence,
           complete sequence.
          Length = 365

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/81 (46%), Positives = 53/81 (65%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WP P+E +K  L +
Sbjct: 228 LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPNPSEMEKIALAE 287

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINN FINQRKR+W
Sbjct: 288 STGLEQKQINNCFINQRKRHW 308



>gb:AB071437_1522807 Oryza sativa (japonica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:Nipponbare.>gb:AB071438_1522808 Oryza sativa
           (japonica cultivar-group) gene for transcription factor
           OSH3, partial cds,
           cultivar:Akihikari.>gb:AB071459_1522828 Oryza sativa
           (japonica cultivar-group) gene for transcription factor
           OSH3, partial cds, cultivar:J362.>gb:AB071461_1522830
           Oryza sativa (japonica cultivar-group) gene for
           transcription factor OSH3, partial cds,
           cultivar:563.>gb:AB071469_1522838 Oryza sativa (japonica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:848.>gb:AB071492_1522861 Oryza
           sativa (japonica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:548.>gb:AB071493_1522862 Oryza sativa (japonica
           cultivar-group) gene for transcription factor OSH3,
           partial cds, cultivar:562.>gb:AB071494_1522863 Oryza
           sativa (japonica cultivar-group) gene for transcription
           factor OSH3, partial cds,
           cultivar:Asominori.>gb:AB071495_1522864 Oryza sativa
           (japonica cultivar-group) gene for transcription factor
           OSH3, partial cds, cultivar:552.>gb:AB071496_1522865
           Oryza sativa (japonica cultivar-group) gene for
           transcription factor OSH3, partial cds, cultivar:T-65.
          Length = 138

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/81 (46%), Positives = 53/81 (65%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WP P+E +K  L +
Sbjct: 6   LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPNPSEMEKIALAE 65

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINN FINQRKR+W
Sbjct: 66  STGLEQKQINNCFINQRKRHW 86



>gb:AB028882_1518117 Oryza sativa mRNA for knotted1-type homeobox
           protein OSH3, complete cds.
          Length = 367

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/81 (46%), Positives = 53/81 (65%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WP P+E +K  L +
Sbjct: 230 LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPNPSEMEKIALAE 289

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINN FINQRKR+W
Sbjct: 290 STGLEQKQINNCFINQRKRHW 310



>gb:AB007625_1510116 Oryza sativa (japonica cultivar-group) HOS13
           mRNA, partial cds.
          Length = 222

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 38/81 (46%), Positives = 53/81 (65%)
 Frame = -2

Query: 684 LKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           LK  L + Y   +  +R+E+ +KR+ GKLP +    L  WW+ H +WP P+E +K  L +
Sbjct: 85  LKRHLLRKYSGYLGGLRKELSKKRKKGKLPKEARQKLLTWWELHYRWPNPSEMEKIALAE 144

Query: 504 ETGLQLKQINNWFINQRKRNW 442
            TGL+ KQINN FINQRKR+W
Sbjct: 145 STGLEQKQINNCFINQRKRHW 165



>gb:AB028886_1518121 Oryza sativa mRNA for knotted1-type homeobox
           protein OSH10, partial cds.
          Length = 77

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 38/77 (49%), Positives = 49/77 (63%)
 Frame = -2

Query: 687 ELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           ELK  L   Y   ++ +  E+ +K++ GKLP D    L  WWQ H +WPYP+E +KA L 
Sbjct: 1   ELKSHLLNKYSGYLSSLWRELSKKKKKGKLPRDARQKLLHWWQLHYRWPYPSELEKAALA 60

Query: 507 QETGLQLKQINNWFINQ 457
           + TGL  KQINNWFINQ
Sbjct: 61  ESTGLDAKQINNWFINQ 77



>gb:AF011554_1761173 Oryza officinalis homeobox protein (Knotted-1)
           gene, partial cds.
          Length = 58

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 35/55 (63%), Positives = 39/55 (70%)
 Frame = -2

Query: 606 GKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNW 442
           GKLP D    L  WW+ H KWPYP+E  K  L + TGL LKQINNWFINQRKR+W
Sbjct: 2   GKLPKDARQQLLNWWELHYKWPYPSESQKVALAESTGLDLKQINNWFINQRKRHW 56



>gb:AY667450_1620713 Selaginella kraussiana KNOTTED1-like protein
           (KNOX2) mRNA, complete cds.
          Length = 315

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 37/83 (44%), Positives = 51/83 (61%)
 Frame = -2

Query: 690 QELKHDLKQGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARL 511
           +E+K  L + Y   +  + +E ++K++  KLP   T  L+ WW  H + PYP+E  KA L
Sbjct: 210 KEIKRALMKKYGGYLGGLTQEYLKKKKKSKLPSAATKTLRDWWFQHLEHPYPSEAQKATL 269

Query: 510 VQETGLQLKQINNWFINQRKRNW 442
              T L  KQINNWFINQRKR+W
Sbjct: 270 AATTKLDPKQINNWFINQRKRHW 292



>gb:AF003527_1760656 Avena vaviloviana knotted-1 homeobox protein
           gene, partial cds.
          Length = 58

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 34/55 (61%), Positives = 40/55 (72%)
 Frame = -2

Query: 606 GKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNW 442
           GKLP +    L  WW+ HSKWPYP+E +K  L + TGL  KQINNWFINQRKR+W
Sbjct: 2   GKLPKEARLKLLHWWELHSKWPYPSETEKIALAETTGLDQKQINNWFINQRKRHW 56



>gb:AC090683_1734401 Oryza sativa chromosome 3 BAC OSJNBa0035I24
           genomic sequence, complete sequence.
          Length = 337

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 37/86 (43%), Positives = 48/86 (55%), Gaps = 2/86 (2%)
 Frame = -2

Query: 681 KHDLKQGYKEKIADIREEIMRKRR--AGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLV 508
           +  L   Y   +  +  EI  K++   G LP D    L  WW  H +WPYP+E +KA L 
Sbjct: 207 RRHLMNKYSGYLNSLWTEISNKKKNSTGHLPRDARHKLLQWWHLHYRWPYPSEAEKAALA 266

Query: 507 QETGLQLKQINNWFINQRKRNWHTNP 430
           + TGL  KQ+ NWFINQRKR+W   P
Sbjct: 267 ESTGLDKKQVTNWFINQRKRHWKPKP 292



>gb:AF110101_1768714 Santalum album knotted 1 homolog (SE1) mRNA,
           partial cds.
          Length = 58

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 31/55 (56%), Positives = 41/55 (74%)
 Frame = -2

Query: 615 RRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRK 451
           ++ GKLP +  + L  WW +H +WPYPTEE+K +L + TGL  +QINNWFINQRK
Sbjct: 1   KKKGKLPENAKTTLLDWWSTHYRWPYPTEEEKMKLSEITGLDPRQINNWFINQRK 55



>gb:AF011553_1761172 Pennisetum americanum homeobox protein
           (Knotted-1) gene, partial cds.>gb:AF016646_1761511
           Secale cereale ancestrale homeobox protein (Knotted-1)
           gene, partial cds.
          Length = 57

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 33/55 (60%), Positives = 38/55 (69%)
 Frame = -2

Query: 606 GKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNW 442
           GKLP D    L  WW +H  WPYPTEEDK R  +  GL  +QINNWF+NQRKR+W
Sbjct: 2   GKLPKDARLSLMNWWNTHYSWPYPTEEDKRR-GRHDGLDQRQINNWFVNQRKRHW 55



>gb:AF003602_1760661 Oryza sativa homeobox protein gene, partial
           cds.
          Length = 37

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 31/35 (88%), Positives = 34/35 (97%)
 Frame = -2

Query: 555 HSKWPYPTEEDKARLVQETGLQLKQINNWFINQRK 451
           H KWPYPTE+DKA+LV+ETGLQLKQINNWFINQRK
Sbjct: 3   HYKWPYPTEDDKAKLVEETGLQLKQINNWFINQRK 37



>gb:AY532908_1612134 Emericella nidulans AhpA (ahpA) gene, complete
           cds.
          Length = 293

 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 31/58 (53%), Positives = 41/58 (70%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRN 445
           +RR G LP   T +LKAW+ +H   PYP+EEDK  L+  TGL + QI+NWFIN R+R+
Sbjct: 199 RRRRGNLPKPVTEILKAWFHAHLDHPYPSEEDKQMLMSRTGLTINQISNWFINARRRH 256



>gb:AF288769_1783514 Physcomitrella patens homeobox protein (MKN4A)
           gene, partial cds.
          Length = 58

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 32/52 (61%), Positives = 38/52 (73%)
 Frame = -2

Query: 606 GKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRK 451
           GKLP +   +LK W+  HS WPYP+E +KA L +  GL LKQINNWFINQRK
Sbjct: 5   GKLPTNARQILKDWFSRHSYWPYPSEMEKAYLQRLCGLNLKQINNWFINQRK 56



>gb:AF011552_1761171 Hordeum marinum homeobox protein (Knotted-1)
           gene, partial cds.
          Length = 58

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 32/54 (59%), Positives = 38/54 (70%)
 Frame = -2

Query: 606 GKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRN 445
           GKLP +    L  WW+ HSK PYP+E +K  L + TGL  KQINNWFINQRKR+
Sbjct: 2   GKLPKEARQKLLHWWELHSKSPYPSETEKMALGESTGLDQKQINNWFINQRKRH 55



>gb:AF288767_1783512 Physcomitrella patens homeobox protein (MKN2A)
           gene, partial cds.
          Length = 57

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 31/55 (56%), Positives = 39/55 (70%)
 Frame = -2

Query: 615 RRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRK 451
           ++ GKLP    ++LK W+  HS WPYP+E +K  L +  GL LKQINNWFINQRK
Sbjct: 1   KKKGKLPTSARTILKDWFNRHSHWPYPSEMEKQYLQRICGLNLKQINNWFINQRK 55



>gb:AY091593_1936207 Homo sapiens MEIS1-related protein 2 (MEIS3)
           mRNA, partial cds.
          Length = 267

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 29/65 (44%), Positives = 43/65 (66%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+ +E  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 147 DLDQERRRNKKRGIFPKVATNIMRAWLVQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 206

Query: 462 NQRKR 448
           N R+R
Sbjct: 207 NARRR 211



>gb:CR382131_1664665 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 510

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 29/57 (50%), Positives = 40/57 (70%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           KRR G LP   TS+L+ W   H   PYP+E +K+ L+Q+TGL + Q++NWFIN R+R
Sbjct: 427 KRRRGNLPKSVTSILREWLNDHISHPYPSEYEKSLLLQQTGLTMSQLSNWFINARRR 483



>gb:HSU68385_2025669 Human Meis1-related protein 2 (MRG2), mRNA,
           partial cds.
          Length = 209

 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 29/65 (44%), Positives = 43/65 (66%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+ +E  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 88  DLDQEPRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 147

Query: 462 NQRKR 448
           N R+R
Sbjct: 148 NARRR 152



>gb:BC069251_1987888 Homo sapiens Meis1, myeloid ecotropic viral
           integration site 1 homolog 3 (mouse), transcript variant
           2, mRNA (cDNA clone MGC:78607 IMAGE:6211294), complete
           cds.
          Length = 358

 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 29/65 (44%), Positives = 43/65 (66%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+ +E  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 238 DLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 297

Query: 462 NQRKR 448
           N R+R
Sbjct: 298 NARRR 302



>sp|Q99687|MEI3_HUMAN Homeobox protein Meis3 (Meis1-related protein
           2) (Fragment).>gb:CR749687_1181230 Homo sapiens mRNA;
           cDNA DKFZp547H236 (from clone
           DKFZp547H236).>gb:HSM802719_2017541 Homo sapiens mRNA;
           cDNA DKFZp547H236 (from clone DKFZp547H236).
          Length = 382

 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 29/65 (44%), Positives = 43/65 (66%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+ +E  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 262 DLDQERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 321

Query: 462 NQRKR 448
           N R+R
Sbjct: 322 NARRR 326



>gb:BC084920_2564156 Xenopus laevis Meis3 homeoprotein, mRNA (cDNA
           clone MGC:79919 IMAGE:6864577), complete cds.
          Length = 453

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 28/65 (43%), Positives = 42/65 (64%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+  +  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 260 DLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 319

Query: 462 NQRKR 448
           N R+R
Sbjct: 320 NARRR 324



>gb:BC075589_2558685 Xenopus tropicalis Meis1, myeloid ecotropic
           viral integration site 1 homolog (mouse), mRNA (cDNA
           clone MGC:89584 IMAGE:6994394), complete cds.
          Length = 453

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 28/65 (43%), Positives = 42/65 (64%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+  +  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 260 DLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 319

Query: 462 NQRKR 448
           N R+R
Sbjct: 320 NARRR 324



>gb:BC044024_2548430 Xenopus laevis similar to myeloid ecotropic
           viral integration site-related gene 1, mRNA (cDNA clone
           MGC:52546 IMAGE:5571486), complete cds.
          Length = 451

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 28/65 (43%), Positives = 42/65 (64%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+  +  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 260 DLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 319

Query: 462 NQRKR 448
           N R+R
Sbjct: 320 NARRR 324



>gb:BC003762_2089319 Mus musculus myeloid ecotropic viral
           integration site-related gene 2, mRNA (cDNA clone
           MGC:5914 IMAGE:3593200), complete cds.
          Length = 361

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 29/65 (44%), Positives = 42/65 (64%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+  E  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 241 DLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 300

Query: 462 NQRKR 448
           N R+R
Sbjct: 301 NARRR 305



>sp|P97368|MEI3_MOUSE Homeobox protein Meis3 (Meis1-related protein
           2).>gb:MMU57344_2122567 Mus musculus homeobox protein
           Meis3 mRNA, complete cds.
          Length = 378

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 29/65 (44%), Positives = 42/65 (64%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+  E  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 258 DLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 317

Query: 462 NQRKR 448
           N R+R
Sbjct: 318 NARRR 322



>gb:AF072895_2471716 Xenopus laevis Meis3 homeoprotein (Meis3) mRNA,
           complete cds.
          Length = 385

 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 29/65 (44%), Positives = 41/65 (63%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D+ E     R+ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 260 DLDETRRETRKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFI 319

Query: 462 NQRKR 448
           N R+R
Sbjct: 320 NARRR 324



>gb:AF375871_2490226 Danio rerio transcription factor Meis1.1
           (meis1.1) mRNA, complete cds, alternatively
           spliced.>gb:BC060891_2552985 Danio rerio myeloid
           ecotropic viral integration 1, mRNA (cDNA clone
           MGC:73029 IMAGE:4145050), complete cds.
          Length = 388

 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 29/65 (44%), Positives = 42/65 (64%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D  +E  R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 263 DPDKEKKRNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFI 322

Query: 462 NQRKR 448
           N R+R
Sbjct: 323 NARRR 327



>gb:AF382393_2490548 Danio rerio pbx/knotted-1 homeobox Prep1.1
           mRNA, complete cds.>gb:AY052752_2509771 Danio rerio
           homeodomain transcription factor Prep1 (prep1) mRNA,
           complete cds.
          Length = 433

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 46/81 (56%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH 439
           K + G LP   T+++++W   H   PYPTEE+K ++  +T L L Q+NNWFIN R+R   
Sbjct: 267 KNKRGVLPKQATNVMRSWLFQHIAHPYPTEEEKKQIATQTNLTLLQVNNWFINARRRILQ 326

Query: 438 TNPXXXXXXSHKTKRKSAAEK 376
                    + K+K+K A  +
Sbjct: 327 PMLDANSTEASKSKKKVAQSR 347



>gb:BC052701_2101222 Mus musculus Pbx/knotted 1 homeobox, mRNA (cDNA
           clone MGC:64705 IMAGE:5721441), complete cds.
          Length = 436

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 31/87 (35%), Positives = 49/87 (56%)
 Frame = -2

Query: 636 REEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQ 457
           +E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN 
Sbjct: 254 QEDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINA 313

Query: 456 RKRNWHTNPXXXXXXSHKTKRKSAAEK 376
           R+R            + KTK+K A  +
Sbjct: 314 RRRILQPMLDSSCSETPKTKKKPAQNR 340



>gb:HSY13613_2028332 Homo sapiens mRNA for homeodomain protein
           Prep-1.
          Length = 436

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 47/81 (58%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH 439
           K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R+R   
Sbjct: 260 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 319

Query: 438 TNPXXXXXXSHKTKRKSAAEK 376
                    + KTK+K+A  +
Sbjct: 320 PMLDSSCSETPKTKKKTAQNR 340



>gb:HSU68727_2025680 Human homeobox-containing protein mRNA,
           complete cds.
          Length = 435

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 47/81 (58%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH 439
           K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R+R   
Sbjct: 259 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 318

Query: 438 TNPXXXXXXSHKTKRKSAAEK 376
                    + KTK+K+A  +
Sbjct: 319 PMLDSSCSETPKTKKKTAQNR 339



>gb:AY196965_1938961 Homo sapiens homeobox-containing protein PKNOX1
           mRNA, complete cds.>gb:BC007746_1970956 Homo sapiens
           PBX/knotted 1 homeobox 1, transcript variant 1, mRNA
           (cDNA clone MGC:12791 IMAGE:4099156), complete cds.
          Length = 436

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 47/81 (58%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH 439
           K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R+R   
Sbjct: 260 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 319

Query: 438 TNPXXXXXXSHKTKRKSAAEK 376
                    + KTK+K+A  +
Sbjct: 320 PMLDSSCSETPKTKKKTAQNR 340



>gb:AY142115_1937003 Homo sapiens PKNOX1B (PKNOX1) mRNA, complete
           cds; alternatively spliced.
          Length = 405

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 47/81 (58%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH 439
           K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R+R   
Sbjct: 260 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 319

Query: 438 TNPXXXXXXSHKTKRKSAAEK 376
                    + KTK+K+A  +
Sbjct: 320 PMLDSSCSETPKTKKKTAQNR 340



>sp|O70477|PNX1_MOUSE Homeobox protein PKNOX1 (PBX/knotted homeobox
           1).>gb:AF061270_2052863 Mus musculus homeobox protein
           PKNOX1 (Pknox1) mRNA, complete cds.
          Length = 435

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 31/87 (35%), Positives = 49/87 (56%)
 Frame = -2

Query: 636 REEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQ 457
           +E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN 
Sbjct: 253 QEDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINA 312

Query: 456 RKRNWHTNPXXXXXXSHKTKRKSAAEK 376
           R+R            + KTK+K A  +
Sbjct: 313 RRRILQPMLDSSCSETPKTKKKPAQNR 339



>sp|P55347|PNX1_HUMAN Homeobox protein PKNOX1 (PBX/knotted homeobox
           1) (Homeobox protein PREP-1).>gb:AP001748_1933547 Homo
           sapiens genomic DNA, chromosome 21q, section 92/105.
          Length = 435

 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 30/81 (37%), Positives = 47/81 (58%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKRNWH 439
           K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R+R   
Sbjct: 259 KNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRRILQ 318

Query: 438 TNPXXXXXXSHKTKRKSAAEK 376
                    + KTK+K+A  +
Sbjct: 319 PMLDSSCSETPKTKKKTAQNR 339



>gb:BC066375_2554266 Danio rerio myeloid ecotropic viral integration
           site 2.1, mRNA (cDNA clone MGC:76815 IMAGE:6964314),
           complete cds.>gb:DRE300652_2571060 Danio rerio mRNA for
           meis2.1 protein.
          Length = 393

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 275 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 332



>gb:BC065980_2554233 Danio rerio myeloid ecotropic viral integration
           site 2.2, mRNA (cDNA clone MGC:76847 IMAGE:6971497),
           complete cds.
          Length = 390

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>gb:BC056515_2551790 Danio rerio myeloid ecotropic viral integration
           site 2.2, mRNA (cDNA clone MGC:65757 IMAGE:6789004),
           complete cds.
          Length = 397

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>gb:AF375872_2490227 Danio rerio transcription factor Meis2.2
           (meis2.2) mRNA, complete cds.
          Length = 397

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>gb:AF202934_2479958 Gallus gallus myeloid ecotropic viral insertion
           site-2a protein mRNA, partial cds.
          Length = 390

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>gb:AF199011_2479668 Gallus gallus homeoprotein Meis2 (Meis2) mRNA,
           complete cds.
          Length = 401

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>gb:BC017375_2092462 Mus musculus myeloid ecotropic viral
           integration site-related gene 1, mRNA (cDNA clone
           MGC:13943 IMAGE:4191098), complete
           cds.>gb:MMMEIS2D_2116459 Mus musculus mRNA for
           homeodomain protein Meis2d.>gb:MMU68384_2123206 Mus
           musculus Meis1-related protein 1b (Mrg1b) mRNA, complete
           cds.
          Length = 470

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>gb:BC001516_1967651 Homo sapiens Meis1, myeloid ecotropic viral
           integration site 1 homolog 2 (mouse), transcript variant
           f, mRNA (cDNA clone MGC:2820 IMAGE:2964406), complete
           cds.>gb:BC001844_1967897 Homo sapiens Meis1, myeloid
           ecotropic viral integration site 1 homolog 2 (mouse),
           transcript variant f, mRNA (cDNA clone MGC:4493
           IMAGE:2964406), complete cds.
          Length = 381

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 263 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 320



>gb:AF179898_1888387 Homo sapiens TALE homeobox protein Meis2d mRNA,
           complete cds.>gb:BC050431_1984338 Homo sapiens Meis1,
           myeloid ecotropic viral integration site 1 homolog 2
           (mouse), mRNA (cDNA clone MGC:54158 IMAGE:6066728),
           complete cds.
          Length = 470

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>gb:AF179896_1888385 Homo sapiens TALE homeobox protein Meis2b mRNA,
           complete cds.>gb:MMMEIS2B_2116457 Mus musculus mRNA for
           homeodomain protein Meis2b.>gb:MMU68383_2123205 Mus
           musculus Meis1-related protein 1a (Mrg1a) mRNA, complete
           cds.
          Length = 394

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>gb:AF178948_1888209 Homo sapiens TALE homeobox protein Meis2a mRNA,
           complete cds.>gb:MMMEIS2A_2116456 Mus musculus mRNA for
           homeodomain protein Meis2a.
          Length = 401

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>gb:AF017418_1876779 Homo sapiens homeobox protein MEIS2 (MEIS2)
           mRNA, partial cds.
          Length = 124

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 6   RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 63



>gb:CSA518935_1375699 Cupiennius salei mRNA for homothorax 2 (hth2
           gene).
          Length = 471

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 305 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 362



>gb:CR857152_1181401 Pongo pygmaeus mRNA; cDNA DKFZp469A1832 (from
           clone DKFZp469A1832).
          Length = 401

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>sp|P97367|MEI2_MOUSE Homeobox protein Meis2 (Meis1-related protein
           1).>gb:MMMEIS2C_2116458 Mus musculus mRNA for
           homeodomain protein Meis2c.
          Length = 477

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>sp|O14770|MEI2_HUMAN Homeobox protein Meis2 (Meis1-related protein
           1).>gb:AF179897_1888386 Homo sapiens TALE homeobox
           protein Meis2c mRNA, complete cds.
          Length = 477

 Score = 65.9 bits (159), Expect = 7e-10
 Identities = 27/58 (46%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 333



>gb:XLU68388_2583499 Xenopus laevis XMeis1-3 protein mRNA, partial
           cds.
          Length = 137

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 19  RHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 76



>gb:AF202933_2479957 Gallus gallus myeloid ecotropic viral insertion
           site-1a protein mRNA, partial cds.
          Length = 386

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 268 RHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 325



>gb:BC023689_2094212 Mus musculus myeloid ecotropic viral
           integration site 1, mRNA (cDNA clone MGC:36059
           IMAGE:5344307), complete cds.
          Length = 370

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>gb:AL603984_2071254 Mouse DNA sequence from clone RP23-137B16 on
           chromosome 11 Contains a novel gene, the 5' end of the
           Meis1 gene for myeloid ecotropic viral integration site
           1 and two Cpg islands, complete
           sequence.>gb:AL645570_2071714 Mouse DNA sequence from
           clone RP23-377H12 on chromosome 11 Contains two novel
           genes, the 3' end of the Meis1 gene for myeloid
           ecotropic viral integration site 1 and two CpG islands,
           complete sequence.>gb:MMU33630_2120882 Mus musculus
           myeloid ecotropic viral integration site-1b (Meis1b)
           mRNA, complete cds.
          Length = 465

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>sp|P79937|MEI1_XENLA Homeobox protein Meis1
           (XMeis1).>gb:XLU68386_2583497 Xenopus laevis XMeis1-1
           protein mRNA, complete cds.
          Length = 390

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 29/65 (44%), Positives = 41/65 (63%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D  +E  R +  G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 265 DPDKEKKRNKGRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFI 324

Query: 462 NQRKR 448
           N R+R
Sbjct: 325 NARRR 329



>sp|Q60954|MEI1_MOUSE Homeobox protein Meis1 (Myeloid ecotropic
           viral integration site-1).>gb:AL603984_2071255 Mouse DNA
           sequence from clone RP23-137B16 on chromosome 11
           Contains a novel gene, the 5' end of the Meis1 gene for
           myeloid ecotropic viral integration site 1 and two Cpg
           islands, complete sequence.>gb:AL645570_2071715 Mouse
           DNA sequence from clone RP23-377H12 on chromosome 11
           Contains two novel genes, the 3' end of the Meis1 gene
           for myeloid ecotropic viral integration site 1 and two
           CpG islands, complete sequence.>gb:MMU33629_2120881 Mus
           musculus myeloid ecotropic viral integration site-1
           (Meis1) mRNA, complete cds.
          Length = 390

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>sp|O00470|MEI1_HUMAN Homeobox protein Meis1.>gb:BC043503_1983430
           Homo sapiens Meis1, myeloid ecotropic viral integration
           site 1 homolog (mouse), mRNA (cDNA clone MGC:49924
           IMAGE:5531644), complete cds.>gb:HSU85707_2026844 Human
           leukemogenic homolog protein (MEIS1) mRNA, complete cds.
          Length = 390

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 272 RHKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRR 329



>gb:GMA551279_1385409 Glomeris marginata partial mRNA for homothorax
           protein (hth gene).
          Length = 272

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 26/58 (44%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+E+ K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 215 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 272



>gb:CSA518945_1375707 Cupiennius salei mRNA for homothorax 1 (hth1
           gene).
          Length = 505

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 26/58 (44%), Positives = 40/58 (68%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+E+ K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 328 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 385



>gb:AY204697_1309652 Venturia canescens homeodomain-containing
           protein (HOX) mRNA, complete cds.
          Length = 456

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           +++ G LP   TS+++AW   H   PYPTE++K ++  +T L L Q+NNWFIN R+R
Sbjct: 307 RQKRGVLPKQATSIMRAWLFHHLVHPYPTEDEKRQIASQTNLTLLQVNNWFINARRR 363



>gb:BC056317_2551757 Danio rerio myeloid ecotropic viral integration
           site 4.1a, mRNA (cDNA clone MGC:65739 IMAGE:6799906),
           complete cds.
          Length = 380

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 28/65 (43%), Positives = 41/65 (63%)
 Frame = -2

Query: 642 DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFI 463
           D  +E    ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFI
Sbjct: 254 DPDKERKNNKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKRQLSQDTGLTILQVNNWFI 313

Query: 462 NQRKR 448
           N R+R
Sbjct: 314 NARRR 318



>gb:BC054667_2551074 Danio rerio pbx/knotted 1 homeobox 1.1, mRNA
           (cDNA clone MGC:66244 IMAGE:3819079), complete cds.
          Length = 377

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 26/57 (45%), Positives = 38/57 (66%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           K + G LP   T+++++W   H   PYPTEE+K ++  +T L L Q+NNWFIN R+R
Sbjct: 267 KNKRGVLPKQATNVMRSWLFQHIAHPYPTEEEKKQIATQTNLTLLQVNNWFINARRR 323



>gb:AF170065_2478261 Danio rerio meis2 mRNA, complete cds.
          Length = 393

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+TGL   Q+NNWFIN R+R
Sbjct: 275 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTNLQVNNWFINARRR 332



>gb:MMU57343_2122566 Mus musculus homeobox protein Meis2 mRNA,
           complete cds.
          Length = 401

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 26/58 (44%), Positives = 39/58 (67%)
 Frame = -2

Query: 621 RKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           R+++ G  P   T++++AW   H   PYP+EE K +L Q+ GL + Q+NNWFIN R+R
Sbjct: 276 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDAGLTILQVNNWFINARRR 333



>gb:TCA518941_1399639 Tribolium castaneum mRNA for homothorax (hth
           gene).
          Length = 456

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 31/73 (42%), Positives = 46/73 (63%)
 Frame = -2

Query: 666 QGYKEKIADIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQL 487
           +G  E+  D   +  +K+R G  P   T++L+AW   H   PYP+E+ K +L Q+TGL +
Sbjct: 320 EGTGEEDDDTNGKKNQKKR-GIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTI 378

Query: 486 KQINNWFINQRKR 448
            Q+NNWFIN R+R
Sbjct: 379 LQVNNWFINARRR 391



>gb:AB086816_2463972 Gallus gallus PREP2 gene for TALE homeodomain
           transcription factor Prep2, complete cds.
          Length = 477

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = -2

Query: 633 EEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR 454
           E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R
Sbjct: 283 EDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 342

Query: 453 KR 448
           +R
Sbjct: 343 RR 344



>gb:AF487460_2066955 Mus musculus homeodomain containing
           transcription factor PREP2 (Prep2) mRNA, complete
           cds.>gb:BC050865_2100503 Mus musculus Pbx/knotted 1
           homeobox 2, mRNA (cDNA clone MGC:59500 IMAGE:6332968),
           complete cds.
          Length = 461

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = -2

Query: 633 EEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR 454
           E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R
Sbjct: 271 EDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 330

Query: 453 KR 448
           +R
Sbjct: 331 RR 332



>gb:BC045626_1983599 Homo sapiens PBX/knotted 1 homeobox 2, mRNA
           (cDNA clone MGC:39607 IMAGE:5261106), complete cds.
          Length = 459

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = -2

Query: 633 EEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR 454
           E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R
Sbjct: 272 EDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 331

Query: 453 KR 448
           +R
Sbjct: 332 RR 333



>gb:AF036584_1234922 Drosophila melanogaster homothorax homeoprotein
           (hth2) mRNA, complete cds.
          Length = 472

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           +++ G  P   T++L+AW   H   PYP+E+ K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 351 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 407



>gb:AF026788_1234331 Drosophila melanogaster homothorax (hth) mRNA,
           complete cds.
          Length = 458

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           +++ G  P   T++L+AW   H   PYP+E+ K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 337 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 393



>gb:HSM808766_1188023 Homo sapiens mRNA; cDNA DKFZp686G20229 (from
           clone DKFZp686G20229).
          Length = 472

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = -2

Query: 633 EEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR 454
           E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R
Sbjct: 284 EDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 343

Query: 453 KR 448
           +R
Sbjct: 344 RR 345



>gb:AK082952_1173756 Mus musculus 12 days embryo spinal cord cDNA,
           RIKEN full-length enriched library, clone:C530020J07
           product:PREP2 PROTEIN homolog [Homo sapiens], full
           insert sequence.>gb:AB086817_2047842 Mus musculus PREP2
           gene for TALE homeodomain transcription factor Prep2,
           complete cds.
          Length = 474

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = -2

Query: 633 EEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR 454
           E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R
Sbjct: 284 EDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 343

Query: 453 KR 448
           +R
Sbjct: 344 RR 345



>gb:AE014297_1138861 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003687_1220854 Drosophila melanogaster
           chromosome 3R, section 25 of 118 of the complete
           sequence.
          Length = 457

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           +++ G  P   T++L+AW   H   PYP+E+ K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 336 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 392



>gb:AE014297_1138860 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003687_1220853 Drosophila melanogaster
           chromosome 3R, section 25 of 118 of the complete
           sequence.>gb:AF032865_1234641 Drosophila melanogaster
           dorsotonals (dtl) mRNA, complete
           cds.>gb:AF035825_1234850 Drosophila melanogaster
           homothorax (hth1) mRNA, complete cds.
          Length = 487

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           +++ G  P   T++L+AW   H   PYP+E+ K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 366 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 422



>gb:AE014297_1138859 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003687_1220852 Drosophila melanogaster
           chromosome 3R, section 25 of 118 of the complete
           sequence.
          Length = 471

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = -2

Query: 618 KRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           +++ G  P   T++L+AW   H   PYP+E+ K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 350 QKKRGIFPKVATNILRAWLFQHLTHPYPSEDQKKQLAQDTGLTILQVNNWFINARRR 406



>pir|JC7766|JC7766 three-amino-acid loop extension(TALE) homeodomain
           protein, PKNOX2 - human
          Length = 460

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = -2

Query: 633 EEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR 454
           E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R
Sbjct: 272 EDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 331

Query: 453 KR 448
           +R
Sbjct: 332 RR 333



>sp|Q96KN3|PNX2_HUMAN Homeobox protein PKNOX2 (PBX/knotted homeobox
           2) (Homeobox protein PREP-2).>gb:AB065001_1869659 Homo
           sapiens mRNA for PKNOX2, complete
           cds.>gb:HSA417081_2006728 Homo sapiens mRNA for PREP2
           protein.
          Length = 460

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = -2

Query: 633 EEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQR 454
           E+   K + G LP   T+++++W   H   PYPTE++K ++  +T L L Q+NNWFIN R
Sbjct: 272 EDKKSKNKRGVLPKHATNIMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINAR 331

Query: 453 KR 448
           +R
Sbjct: 332 RR 333



>gb:AF222995_2480857 Danio rerio homeobox transcription factor Meis3
           (meis3) mRNA, complete cds.
          Length = 415

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 26/56 (46%), Positives = 38/56 (67%)
 Frame = -2

Query: 615 RRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           ++ G  P   T++++AW   H   PYP+EE K +L Q+TGL + Q+NNWFIN R+R
Sbjct: 256 KKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLSQDTGLTILQVNNWFINARRR 311



>gb:AY705698_1347637 Oikopleura dioica Meis-b gene, complete cds.
          Length = 378

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 29/79 (36%), Positives = 47/79 (59%), Gaps = 2/79 (2%)
 Frame = -2

Query: 678 HDLKQGYKEKIA--DIREEIMRKRRAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQ 505
           HD+     +++   D  ++  + ++ G  P   T++L+AW   +   PYP+EE K  L Q
Sbjct: 203 HDVSSSSSKRVKKEDKDDKKPQPKKRGIFPKQATNILRAWLFQNLTHPYPSEEQKKNLSQ 262

Query: 504 ETGLQLKQINNWFINQRKR 448
           +TGL + Q+NNWFIN R+R
Sbjct: 263 QTGLTILQVNNWFINARRR 281



>gb:AY705696_1347635 Oikopleura dioica Prep gene, partial cds.
          Length = 214

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 27/55 (49%), Positives = 35/55 (63%)
 Frame = -2

Query: 612 RAGKLPGDTTSLLKAWWQSHSKWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 448
           + G LP   T  L+ W   H   PYP+E++K  L Q+TGL L Q+NNWFIN R+R
Sbjct: 157 KRGLLPRQATDTLRGWLFQHLVHPYPSEDEKRNLAQQTGLTLLQVNNWFINARRR 211


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 722,218,839
Number of Sequences: 1806583
Number of extensions: 14783923
Number of successful extensions: 39424
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 38136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39371
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 42871928976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)