BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13722
         (1236 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY084504_1569593 Arabidopsis thaliana clone 10987 mRNA, compl...   246   7e-64   
pir|G84798|G84798 hypothetical protein At2g37920 [imported] - Ar...   246   7e-64   Arabidopsis thaliana [mouse-ear cress]
gb:AY093194_1575148 Arabidopsis thaliana unknown protein (At2g37...   232   1e-59   
gb:AP004144_1838207 Oryza sativa (japonica cultivar-group) genom...   184   4e-45   
pir|C96658|C96658 probable RNA helicase F9N12.13 [imported] - Ar...    95   3e-18   Arabidopsis thaliana [mouse-ear cress]
pir|E84488|E84488 probable RNA helicase [imported] - Arabidopsis...    93   1e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP004776_1844881 Oryza sativa (japonica cultivar-group) genom...    78   4e-13   
gb:AE014187_938840 Plasmodium falciparum 3D7 chromosome 14 compl...    45   0.002   
gb:AE014186_938139 Plasmodium falciparum 3D7 chromosome 11 compl...    45   0.002   
gb:AC115684_1206034 Dictyostelium discoideum chromosome 2 map 31...    45   0.004   
gb:AF482386_1275396 Dictyostelium discoideum ABC transporter Abc...    44   0.005   
gb:PFA929355_1393269 Plasmodium falciparum strain 3D7, chromosom...    44   0.007   
gb:PFMAL13_1191234 Plasmodium falciparum 3D7 chromosome 13, *** ...    44   0.007   
gb:PFA10B_1392017 P.falciparum 10b antigen gene, partial cds.          43   0.012   
gb:AF051898_1236723 Dictyostelium discoideum coronin binding pro...    43   0.012   
gb:AC116986_1207460 Dictyostelium discoideum chromosome 2 map 22...    43   0.012   
gb:AC115607_1205917 Dictyostelium discoideum chromosome 2 map 45...    43   0.012   
gb:AE014185_937789 Plasmodium falciparum 3D7 chromosome 10 compl...    43   0.012   
gb:PFA929359_1393532 Plasmodium falciparum strain 3D7, chromosom...    43   0.015   
gb:PFMAL8P1_1192309 Plasmodium falciparum 3D7 chromosome 8, *** ...    43   0.015   
gb:PFA929353_1393087 Plasmodium falciparum strain 3D7, chromosom...    42   0.020   
gb:AY232271_1311380 Dictyostelium discoideum putative protein Ro...    42   0.020   
gb:AC117081_1207906 Dictyostelium discoideum chromosome 2 map 58...    42   0.020   
gb:PFMAL8P1_1192079 Plasmodium falciparum 3D7 chromosome 8, *** ...    42   0.020   
gb:PFMAL13_1191660 Plasmodium falciparum 3D7 chromosome 13, *** ...    42   0.020   
gb:AC117267_1208054 Dictyostelium discoideum chromosome 2 map 58...    42   0.026   
gb:AC117075_1207755 Dictyostelium discoideum chromosome 2 map 52...    42   0.026   
gb:AC116979_1207104 Dictyostelium discoideum chromosome 2 map 64...    42   0.026   
gb:AC115612_1205926 Dictyostelium discoideum chromosome 2 map 62...    42   0.026   
gb:AY325173_1177842 Rattus norvegicus Aa2-050 mRNA, complete cds.      42   0.026   
gb:AC116977_1207007 Dictyostelium discoideum chromosome 2 map 55...    42   0.034   
gb:AC116305_1206214 Dictyostelium discoideum chromosome 2 map 10...    42   0.034   
gb:AE014186_938336 Plasmodium falciparum 3D7 chromosome 11 compl...    42   0.034   
gb:PFA929353_1393098 Plasmodium falciparum strain 3D7, chromosom...    41   0.044   
gb:AY220914_1310462 Dictyostelium discoideum ComB (comB) gene, c...    41   0.044   
gb:AF375997_1266712 Dictyostelium discoideum glycosyltransferase...    41   0.044   
gb:AC116979_1207090 Dictyostelium discoideum chromosome 2 map 64...    41   0.044   
gb:AC116960_1206800 Dictyostelium discoideum chromosome 2 map co...    41   0.044   
gb:AC116956_1206511 Dictyostelium discoideum chromosome 2 map 14...    41   0.044   
gb:AC116551_1206341 Dictyostelium discoideum chromosome 2 map co...    41   0.044   
gb:AC116305_1206145 Dictyostelium discoideum chromosome 2 map 10...    41   0.044   
gb:AC115612_1205953 Dictyostelium discoideum chromosome 2 map 62...    41   0.044   
gb:AC115598_1205790 Dictyostelium discoideum chromosome 2 map 58...    41   0.044   
gb:AE014187_938716 Plasmodium falciparum 3D7 chromosome 14 compl...    41   0.044   
gb:AE014186_938028 Plasmodium falciparum 3D7 chromosome 11 compl...    41   0.044   
gb:AF429950_1270200 Plasmodium falciparum PDZ domain protein mRN...    41   0.057   
gb:AC116921_1206420 Dictyostelium discoideum chromosome 2 map 46...    41   0.057   
gb:AC116305_1206155 Dictyostelium discoideum chromosome 2 map 10...    41   0.057   
gb:AC115684_1206035 Dictyostelium discoideum chromosome 2 map 31...    41   0.057   
gb:AC115612_1205955 Dictyostelium discoideum chromosome 2 map 62...    41   0.057   
gb:AE014186_938202 Plasmodium falciparum 3D7 chromosome 11 compl...    41   0.057   
gb:PFMAL4P3_1394838 Plasmodium falciparum MAL4P3.                      40   0.075   
gb:PFMAL1P2_1394314 Plasmodium falciparum DNA from MAL1P2.             40   0.075   
gb:PFA929356_1393323 Plasmodium falciparum strain 3D7, chromosom...    40   0.075   
gb:DDU42597_1377340 Dictyostelium discoideum histidine kinase A ...    40   0.075   
gb:AC115598_1205782 Dictyostelium discoideum chromosome 2 map 58...    40   0.075   
gb:AC115598_1205766 Dictyostelium discoideum chromosome 2 map 58...    40   0.075   
gb:PFMAL8P1_1192078 Plasmodium falciparum 3D7 chromosome 8, *** ...    40   0.075   
gb:AE014186_938072 Plasmodium falciparum 3D7 chromosome 11 compl...    40   0.075   
pir|S71629|S71629 sensory transduction histidine kinase dhkA - s...    40   0.075   Dictyostelium discoideum
pir|T18426|T18426 hypothetical protein C0330w - malaria parasite...    40   0.075   Plasmodium falciparum 3D7
sp|O94260|G3BP_SCHPO|G3BP_SCHPO Putative G3BP-like protein.>pir|T40805|T408...    40   0.075   Schizosaccharomyces pombe
gb:PFMAL3P2_1394431 Plasmodium falciparum MAL3P2, complete seque...    40   0.098   
gb:PFA929357_1393448 Plasmodium falciparum strain 3D7, chromosom...    40   0.098   
gb:CR382399_1374945 Plasmodium falciparum chromosome 6, complete...    40   0.098   
gb:AC117081_1207897 Dictyostelium discoideum chromosome 2 map 58...    40   0.098   
gb:AC117080_1207888 Dictyostelium discoideum chromosome 2 map co...    40   0.098   
gb:AC117072_1207704 Dictyostelium discoideum chromosome 2 map 38...    40   0.098   
gb:AC116977_1207001 Dictyostelium discoideum chromosome 2 map 55...    40   0.098   
gb:AC116963_1206850 Dictyostelium discoideum chromosome 2 map 46...    40   0.098   
gb:AC116305_1206140 Dictyostelium discoideum chromosome 2 map 10...    40   0.098   
gb:AC115607_1205908 Dictyostelium discoideum chromosome 2 map 45...    40   0.098   
gb:PFMAL13_1191672 Plasmodium falciparum 3D7 chromosome 13, *** ...    40   0.098   
gb:AE014187_938635 Plasmodium falciparum 3D7 chromosome 14 compl...    40   0.098   
gb:AE014187_938594 Plasmodium falciparum 3D7 chromosome 14 compl...    40   0.098   
gb:AE014185_937715 Plasmodium falciparum 3D7 chromosome 10 compl...    40   0.098   
gb:PFMAL3P7_1394591 Plasmodium falciparum MAL3P7, complete seque...    40   0.13    
gb:PFMAL3P5_1394519 Plasmodium falciparum MAL3P5, complete seque...    40   0.13    
gb:AF052006_1236728 Dictyostelium discoideum C-module-binding fa...    40   0.13    
gb:AF047005_1236364 Plasmodium falciparum asparagine-rich protei...    40   0.13    
gb:AC116305_1206174 Dictyostelium discoideum chromosome 2 map 10...    40   0.13    
gb:AC115680_1205976 Dictyostelium discoideum chromosome 2 map 49...    40   0.13    
gb:AC115598_1205763 Dictyostelium discoideum chromosome 2 map 58...    40   0.13    
gb:AC123513_1192416 Dictyostelium discoideum strain AX4 chromoso...    40   0.13    
gb:PFMAL8P1_1192052 Plasmodium falciparum 3D7 chromosome 8, *** ...    40   0.13    
gb:PFMAL13_1191412 Plasmodium falciparum 3D7 chromosome 13, *** ...    40   0.13    
gb:AE014187_939153 Plasmodium falciparum 3D7 chromosome 14 compl...    40   0.13    
pir|T10265|T10265 arabinogalactan-protein AGP2 - Persian tobacco...    40   0.13    Nicotiana alata [flowering tobacco]
gb:PFMEZSA1B_1394900 P.falciparum gp190 (MSA1, MSP1, PMMSA) for ...    39   0.17    
gb:PFMAL1P2_1394301 Plasmodium falciparum DNA from MAL1P2.             39   0.17    
gb:AF218248_1252062 Plasmodium falciparum major merozoite surfac...    39   0.17    
gb:AF062349_1237335 Plasmodium falciparum strain HN2 merozoite s...    39   0.17    
gb:AF062348_1237334 Plasmodium falciparum strain HN1 merozoite s...    39   0.17    
gb:AC117075_1207742 Dictyostelium discoideum chromosome 2 map 52...    39   0.17    
gb:AC116986_1207464 Dictyostelium discoideum chromosome 2 map 22...    39   0.17    
gb:AC116919_1206375 Dictyostelium discoideum chromosome 2 map co...    39   0.17    
gb:AB116600_1200353 Plasmodium falciparum msp1 gene for merozoit...    39   0.17    
gb:AB116599_1200352 Plasmodium falciparum msp1 gene for merozoit...    39   0.17    
gb:PFMAL8P1_1192227 Plasmodium falciparum 3D7 chromosome 8, *** ...    39   0.17    
gb:PFMAL13_1191377 Plasmodium falciparum 3D7 chromosome 13, *** ...    39   0.17    
gb:PFMAL13_1191282 Plasmodium falciparum 3D7 chromosome 13, *** ...    39   0.17    
gb:AE014188_968024 Plasmodium falciparum 3D7 chromosome 12, comp...    39   0.17    
gb:AE014187_938934 Plasmodium falciparum 3D7 chromosome 14 compl...    39   0.17    
gb:AE014186_938204 Plasmodium falciparum 3D7 chromosome 11 compl...    39   0.17    
gb:BX842642_822307 Mycoplasma mycoides subsp. mycoides SC genomi...    39   0.17    
pir|S50977|S50977 hypothetical protein YDL005c - yeast (Saccharo...    39   0.17    Saccharomyces cerevisiae [brewer's yeast]
pir|A90570|A90570 lipoprotein [imported] - Mycoplasma pulmonis (...    39   0.17    Mycoplasma pulmonis
pir|A26868|A26868 major merozoite surface antigen precursor - ma...    39   0.17    Plasmodium falciparum
sp|P40467|YIN0_YEAST|YIN0_YEAST Putative 108.8 kDa transcriptional regulato...    39   0.17    Saccharomyces cerevisiae [brewer's yeast]
sp|P08569|MSP1_PLAFM|MSP1_PLAFM Merozoite surface protein 1 precursor (Mero...    39   0.17    Plasmodium falciparum
sp|P13819|MSP1_PLAFF|MSP1_PLAFF Merozoite surface protein 1 precursor (Mero...    39   0.17    Plasmodium falciparum
sp|Q16992|LWA_ANTEL|LWA_ANTEL LWamide neuropeptides precursor [Contains: L...    21   0.19    Anthopleura elegantissima
gb:PFA929357_1393455 Plasmodium falciparum strain 3D7, chromosom...    39   0.22    
gb:PFA929351_1392950 Plasmodium falciparum strain 3D7, chromosom...    39   0.22    
gb:CR382399_1374948 Plasmodium falciparum chromosome 6, complete...    39   0.22    
gb:AC117072_1207647 Dictyostelium discoideum chromosome 2 map 38...    39   0.22    
gb:AC116984_1207315 Dictyostelium discoideum chromosome 2 map 25...    39   0.22    
gb:AC116977_1207016 Dictyostelium discoideum chromosome 2 map 55...    39   0.22    
gb:AC116977_1206941 Dictyostelium discoideum chromosome 2 map 55...    39   0.22    
gb:AC115598_1205758 Dictyostelium discoideum chromosome 2 map 58...    39   0.22    
gb:AC115592_1205743 Dictyostelium discoideum chromosome 2 map 1-...    39   0.22    
gb:AC114263_1205633 Dictyostelium discoideum chromosome 2 map 21...    39   0.22    
gb:PFMAL7P1_1191771 Plasmodium falciparum 3D7 chromosome 7, *** ...    39   0.22    
gb:AE014188_967840 Plasmodium falciparum 3D7 chromosome 12, comp...    39   0.22    
gb:AE014187_938973 Plasmodium falciparum 3D7 chromosome 14 compl...    39   0.22    
gb:AE014186_938076 Plasmodium falciparum 3D7 chromosome 11 compl...    39   0.22    
gb:AE014185_937631 Plasmodium falciparum 3D7 chromosome 10 compl...    39   0.22    
pir|T18489|T18489 hypothetical protein C0820w - malaria parasite...    39   0.22    Plasmodium falciparum 3D7
pir|T17414|T17414 TipC protein - slime mold (Dictyostelium disco...    39   0.22    Dictyostelium discoideum
pir|A42239|A42239 adenylate cyclase (EC 4.6.1.1) germination sta...    39   0.22    Dictyostelium discoideum
gb:AF275345_1782529 Lycopersicon esculentum putative permease ge...    39   0.28    
gb:PFAP190A_1394010 P.falciparum merozoite 190 kD precursor prot...    39   0.28    
gb:PFA929358_1393519 Plasmodium falciparum strain 3D7, chromosom...    39   0.28    
gb:PFA929352_1393017 Plasmodium falciparum strain 3D7, chromosom...    39   0.28    
gb:CR382401_1375118 Plasmodium falciparum chromosome 6, complete...    39   0.28    
gb:CR382400_1375004 Plasmodium falciparum chromosome 6, complete...    39   0.28    
gb:AY459293_1328230 Plasmodium falciparum histone acetyltransfer...    39   0.28    
gb:AF272150_1257594 Dictyostelium discoideum deliriumA (dlrA) ge...    39   0.28    
gb:AC116956_1206537 Dictyostelium discoideum chromosome 2 map 14...    39   0.28    
gb:AC115607_1205913 Dictyostelium discoideum chromosome 2 map 45...    39   0.28    
gb:AC115592_1205718 Dictyostelium discoideum chromosome 2 map 1-...    39   0.28    
gb:AC115584_1205689 Dictyostelium discoideum chromosome 2 map co...    39   0.28    
gb:AC115579_1205661 Dictyostelium discoideum chromosome 2 map 60...    39   0.28    
gb:PFMAL8P1_1192105 Plasmodium falciparum 3D7 chromosome 8, *** ...    39   0.28    
gb:PFMAL13_1191491 Plasmodium falciparum 3D7 chromosome 13, *** ...    39   0.28    
gb:AE014187_938961 Plasmodium falciparum 3D7 chromosome 14 compl...    39   0.28    
gb:AE014186_938380 Plasmodium falciparum 3D7 chromosome 11 compl...    39   0.28    
gb:AE014185_937623 Plasmodium falciparum 3D7 chromosome 10 compl...    39   0.28    
pir|S06286|S06286 major merozoite surface antigen precursor - ma...    39   0.28    Plasmodium falciparum
sp|P54674|P3K2_DICDI|P3K2_DICDI Phosphatidylinositol 3-kinase 2 (EC 2.7.1.1...    39   0.28    Dictyostelium discoideum
sp|P19598|MSP1_PLAF3|MSP1_PLAF3 Merozoite surface protein 1 precursor (Mero...    39   0.28    Plasmodium falciparum
sp|Q03101|CYAG_DICDI|CYAG_DICDI Adenylate cyclase, germination specific (EC...    39   0.28    Dictyostelium discoideum
gb:PFMSAMSA1_1394915 P. falciparum gene for major surface antige...    38   0.37    
gb:PFMAL4P2_1394752 Plasmodium falciparum MAL4P2.                      38   0.37    
gb:PFA929359_1393565 Plasmodium falciparum strain 3D7, chromosom...    38   0.37    
gb:DDU68754_1377407 Dictyostelium discoideum putative transcript...    38   0.37    
gb:AF036171_1234870 Dictyostelium discoideum homeobox-containing...    38   0.37    
gb:AC117081_1207967 Dictyostelium discoideum chromosome 2 map 58...    38   0.37    
gb:AC117081_1207924 Dictyostelium discoideum chromosome 2 map 58...    38   0.37    
gb:AC116986_1207459 Dictyostelium discoideum chromosome 2 map 22...    38   0.37    
gb:AC116984_1207322 Dictyostelium discoideum chromosome 2 map 25...    38   0.37    
gb:AC115684_1206046 Dictyostelium discoideum chromosome 2 map 31...    38   0.37    
gb:AC115598_1205808 Dictyostelium discoideum chromosome 2 map 58...    38   0.37    
gb:PFMAL8P1_1192193 Plasmodium falciparum 3D7 chromosome 8, *** ...    38   0.37    
gb:PFMAL8P1_1192056 Plasmodium falciparum 3D7 chromosome 8, *** ...    38   0.37    
gb:PFMAL7P1_1191905 Plasmodium falciparum 3D7 chromosome 7, *** ...    38   0.37    
gb:PFMAL7P1_1191872 Plasmodium falciparum 3D7 chromosome 7, *** ...    38   0.37    
gb:PFMAL7P1_1191787 Plasmodium falciparum 3D7 chromosome 7, *** ...    38   0.37    
gb:PFMAL13_1191244 Plasmodium falciparum 3D7 chromosome 13, *** ...    38   0.37    
gb:AE014186_938196 Plasmodium falciparum 3D7 chromosome 11 compl...    38   0.37    
gb:AE014185_937937 Plasmodium falciparum 3D7 chromosome 10 compl...    38   0.37    
pir|S60712|S60712 band-6-protein - human>gb:HSB6PR_2010842 H.sap...    38   0.37    Homo sapiens [man]
pir|A44865|S16752 major merozoite surface antigen MSA-1 - malari...    38   0.37    
gb:A08351_1447156 Partial synthetic nucleotide sequence of Ag512.      38   0.49    
gb:PFMAL3P7_1394567 Plasmodium falciparum MAL3P7, complete seque...    38   0.49    
gb:PFMAL1P2_1394372 Plasmodium falciparum DNA from MAL1P2.             38   0.49    
gb:PFA929355_1393256 Plasmodium falciparum strain 3D7, chromosom...    38   0.49    
gb:PFA28C6_1392173 Plasmodium falciparum mRNA for asparagine-ric...    38   0.49    
gb:CR382399_1374979 Plasmodium falciparum chromosome 6, complete...    38   0.49    
gb:CR382398_1374874 Plasmodium falciparum chromosome 6, complete...    38   0.49    
gb:AY324391_1319649 Plasmodium falciparum rhoptry associated mem...    38   0.49    
gb:AY162269_1305668 Dictyostelium discoideum cGMP-specific phosp...    38   0.49    
gb:AF111943_1242077 Dictyostelium discoideum AX4 development pro...    38   0.49    
gb:AF111942_1242076 Dictyostelium discoideum AX4 development pro...    38   0.49    
gb:AC116986_1207500 Dictyostelium discoideum chromosome 2 map 22...    38   0.49    
gb:AC116984_1207422 Dictyostelium discoideum chromosome 2 map 25...    38   0.49    
gb:AC116984_1207396 Dictyostelium discoideum chromosome 2 map 25...    38   0.49    
gb:AC116982_1207194 Dictyostelium discoideum chromosome 2 map 36...    38   0.49    
gb:AC116979_1207098 Dictyostelium discoideum chromosome 2 map 64...    38   0.49    
gb:AC116330_1206262 Dictyostelium discoideum chromosome 2 map 31...    38   0.49    
gb:AC115605_1205886 Dictyostelium discoideum chromosome 2 map 58...    38   0.49    
gb:AB116601_1200354 Plasmodium falciparum msp1 gene for merozoit...    38   0.49    
gb:AB116597_1200350 Plasmodium falciparum msp1 gene for merozoit...    38   0.49    
gb:AB116596_1200349 Plasmodium falciparum msp1 gene for merozoit...    38   0.49    
gb:PFMAL7P1_1191920 Plasmodium falciparum 3D7 chromosome 7, *** ...    38   0.49    
gb:PFMAL13_1191700 Plasmodium falciparum 3D7 chromosome 13, *** ...    38   0.49    
gb:PFMAL13_1191522 Plasmodium falciparum 3D7 chromosome 13, *** ...    38   0.49    
gb:AY383694_1178117 Rattus norvegicus LRRGT00039 mRNA, complete ...    38   0.49    
gb:AE014188_967930 Plasmodium falciparum 3D7 chromosome 12, comp...    38   0.49    
gb:AE014188_967836 Plasmodium falciparum 3D7 chromosome 12, comp...    38   0.49    
gb:AE014187_938713 Plasmodium falciparum 3D7 chromosome 14 compl...    38   0.49    
gb:AE014186_938297 Plasmodium falciparum 3D7 chromosome 11 compl...    38   0.49    
gb:AE014186_938242 Plasmodium falciparum 3D7 chromosome 11 compl...    38   0.49    
gb:AE014185_937790 Plasmodium falciparum 3D7 chromosome 10 compl...    38   0.49    
gb:AE014185_937609 Plasmodium falciparum 3D7 chromosome 10 compl...    38   0.49    
pir|S14470|S14470 asparagine-rich protein (clone 28C6) - Plasmod...    38   0.49    Plasmodium falciparum
sp|P18160|KYK1_DICDI|KYK1_DICDI Non-receptor tyrosine kinase spore lysis A ...    38   0.49    Dictyostelium discoideum
gb:PFMAL3P2_1394434 Plasmodium falciparum MAL3P2, complete seque...    37   0.63    
gb:PFA929353_1393139 Plasmodium falciparum strain 3D7, chromosom...    37   0.63    
gb:DMC96G10_1378486 Drosophila melanogaster cosmid clone 96G10.        37   0.63    
gb:DDU07817_1377281 Dictyostelium discoideum AX3 glutamine-aspar...    37   0.63    
gb:AY184993_1308391 Dictyostelium discoideum inositol 5-phosphat...    37   0.63    
gb:AC117081_1207911 Dictyostelium discoideum chromosome 2 map 58...    37   0.63    
gb:AC117076_1207860 Dictyostelium discoideum chromosome 2 map 33...    37   0.63    
gb:AC117076_1207859 Dictyostelium discoideum chromosome 2 map 33...    37   0.63    
gb:AC116986_1207535 Dictyostelium discoideum chromosome 2 map 22...    37   0.63    
gb:AC116979_1207137 Dictyostelium discoideum chromosome 2 map 64...    37   0.63    
gb:AC116977_1207005 Dictyostelium discoideum chromosome 2 map 55...    37   0.63    
gb:AC116305_1206100 Dictyostelium discoideum chromosome 2 map 10...    37   0.63    
gb:AC116100_1206093 Dictyostelium discoideum chromosome 2 map 61...    37   0.63    
gb:AC115594_1205752 Dictyostelium discoideum chromosome 2 map 40...    37   0.63    
gb:PFMAL7P1_1192013 Plasmodium falciparum 3D7 chromosome 7, *** ...    37   0.63    
gb:AE014188_968086 Plasmodium falciparum 3D7 chromosome 12, comp...    37   0.63    
gb:AE014188_967865 Plasmodium falciparum 3D7 chromosome 12, comp...    37   0.63    
gb:AE014187_938577 Plasmodium falciparum 3D7 chromosome 14 compl...    37   0.63    
gb:AE014187_938561 Plasmodium falciparum 3D7 chromosome 14 compl...    37   0.63    
gb:AE014186_938363 Plasmodium falciparum 3D7 chromosome 11 compl...    37   0.63    
gb:AE014186_938320 Plasmodium falciparum 3D7 chromosome 11 compl...    37   0.63    
gb:AE014186_938274 Plasmodium falciparum 3D7 chromosome 11 compl...    37   0.63    
pir|D71612|D71612 hypothetical protein PFB0540w - malaria parasi...    37   0.63    Plasmodium falciparum 3D7
gb:AX112153_1461381 Sequence 5 from Patent WO0127287.                  37   0.83    
gb:PFA929356_1393309 Plasmodium falciparum strain 3D7, chromosom...    37   0.83    
gb:CR382399_1374961 Plasmodium falciparum chromosome 6, complete...    37   0.83    
gb:AF482961_1275467 Dictyostelium discoideum ABC transporter Abc...    37   0.83    
gb:AF020407_1233341 Dictyostelium discoideum WimA (wimA) gene, p...    37   0.83    
gb:AC117176_1208020 Dictyostelium discoideum chromosome 2 map 50...    37   0.83    
gb:AC116984_1207362 Dictyostelium discoideum chromosome 2 map 25...    37   0.83    
gb:AC116963_1206896 Dictyostelium discoideum chromosome 2 map 46...    37   0.83    
gb:AC116957_1206699 Dictyostelium discoideum chromosome 2 map 16...    37   0.83    
gb:AC116305_1206202 Dictyostelium discoideum chromosome 2 map 10...    37   0.83    
gb:PFMAL8P1_1192297 Plasmodium falciparum 3D7 chromosome 8, *** ...    37   0.83    
gb:PFMAL7P1_1191959 Plasmodium falciparum 3D7 chromosome 7, *** ...    37   0.83    
gb:PFMAL13_1191644 Plasmodium falciparum 3D7 chromosome 13, *** ...    37   0.83    
gb:PFMAL13_1191553 Plasmodium falciparum 3D7 chromosome 13, *** ...    37   0.83    
gb:PFMAL13_1191214 Plasmodium falciparum 3D7 chromosome 13, *** ...    37   0.83    
gb:PFMAL13_1191200 Plasmodium falciparum 3D7 chromosome 13, *** ...    37   0.83    
gb:AE014298_1124154 Drosophila melanogaster chromosome X, comple...    37   0.83    
gb:AE014188_968208 Plasmodium falciparum 3D7 chromosome 12, comp...    37   0.83    
gb:AE014188_968201 Plasmodium falciparum 3D7 chromosome 12, comp...    37   0.83    
gb:AE014188_968148 Plasmodium falciparum 3D7 chromosome 12, comp...    37   0.83    
gb:AE014188_967880 Plasmodium falciparum 3D7 chromosome 12, comp...    37   0.83    
gb:AE014187_939035 Plasmodium falciparum 3D7 chromosome 14 compl...    37   0.83    
gb:AE014187_938793 Plasmodium falciparum 3D7 chromosome 14 compl...    37   0.83    
gb:AE014186_938438 Plasmodium falciparum 3D7 chromosome 11 compl...    37   0.83    
gb:AE014186_938143 Plasmodium falciparum 3D7 chromosome 11 compl...    37   0.83    
pir|T51007|T51007 hypothetical protein B7J19.60 [imported] - Neu...    37   0.83    Neurospora crassa
pir|S05355|S05355 hypothetical protein (clone AAC11) - slime mol...    37   0.83    Dictyostelium discoideum
pir|A45948|A45948 major merozoite surface antigen precursor - ma...    37   0.83    Plasmodium falciparum
sp|P50495|MSP1_PLAFP|MSP1_PLAFP Merozoite surface protein 1 precursor (Mero...    37   0.83    Plasmodium falciparum
sp|P04934|MSP1_PLAFC|MSP1_PLAFC Merozoite surface protein 1 precursor (Mero...    37   0.83    Plasmodium falciparum
sp|P14196|AAC2_DICDI|AAC2_DICDI AAC-rich mRNA clone AAC11 protein (Fragment...    37   0.83    Dictyostelium discoideum
gb:HSPLK3_2019612 H.sapiens gene encoding plakophilin 1.>gb:HSPL...    37   1.1     
gb:CR380947_1649050 Candida glabrata strain CBS138 chromosome A ...    37   1.1     
gb:PFMAL1P2_1394340 Plasmodium falciparum DNA from MAL1P2.             37   1.1     
gb:PFA929353_1393070 Plasmodium falciparum strain 3D7, chromosom...    37   1.1     
gb:CR382401_1375082 Plasmodium falciparum chromosome 6, complete...    37   1.1     
gb:AY152858_1304460 Dictyostelium discoideum diacylglycerol kina...    37   1.1     
gb:AF361475_1265564 Dictyostelium discoideum double histidine ki...    37   1.1     
gb:AC116986_1207546 Dictyostelium discoideum chromosome 2 map 22...    37   1.1     
gb:AC116551_1206360 Dictyostelium discoideum chromosome 2 map co...    37   1.1     
gb:AC116305_1206129 Dictyostelium discoideum chromosome 2 map 10...    37   1.1     
gb:AC114263_1205606 Dictyostelium discoideum chromosome 2 map 21...    37   1.1     
gb:PFMAL13_1191739 Plasmodium falciparum 3D7 chromosome 13, *** ...    37   1.1     
gb:PFMAL13_1191440 Plasmodium falciparum 3D7 chromosome 13, *** ...    37   1.1     
gb:AE014187_939174 Plasmodium falciparum 3D7 chromosome 14 compl...    37   1.1     
gb:AE014187_939173 Plasmodium falciparum 3D7 chromosome 14 compl...    37   1.1     
gb:AE014186_938423 Plasmodium falciparum 3D7 chromosome 11 compl...    37   1.1     
gb:AE014185_937885 Plasmodium falciparum 3D7 chromosome 10 compl...    37   1.1     
gb:AE014185_937656 Plasmodium falciparum 3D7 chromosome 10 compl...    37   1.1     
pir|A71607|A71607 Mtn3/RAG1IP-like protein PFB0760w - malaria pa...    37   1.1     
pir|T18472|T18472 hypothetical protein C0440c - malaria parasite...    37   1.1     
pir|T18429|T18429 hypothetical protein C0345w - malaria parasite...    37   1.1     
pir|T14004|T14004 trfA protein - slime mold (Dictyostelium disco...    37   1.1     
pir|S57376|S57376 hypothetical protein YOL093w - yeast (Saccharo...    37   1.1     
gb:PFMAL3P4_1394489 Plasmodium falciparum MAL3P4.                      36   1.4     
gb:PFA929359_1393545 Plasmodium falciparum strain 3D7, chromosom...    36   1.4     
gb:PFA245435_1392036 Plasmodium falciparum gc-alpha gene for gua...    36   1.4     
gb:AY098937_1298592 Plasmodium falciparum RNA-binding protein Pu...    36   1.4     
gb:AC116984_1207320 Dictyostelium discoideum chromosome 2 map 25...    36   1.4     
gb:AC116982_1207180 Dictyostelium discoideum chromosome 2 map 36...    36   1.4     
gb:AC116979_1207100 Dictyostelium discoideum chromosome 2 map 64...    36   1.4     
gb:AC116977_1206974 Dictyostelium discoideum chromosome 2 map 55...    36   1.4     
gb:AC116963_1206916 Dictyostelium discoideum chromosome 2 map 46...    36   1.4     
gb:AC116963_1206886 Dictyostelium discoideum chromosome 2 map 46...    36   1.4     
gb:AC116305_1206161 Dictyostelium discoideum chromosome 2 map 10...    36   1.4     
gb:AC115612_1205927 Dictyostelium discoideum chromosome 2 map 62...    36   1.4     
gb:AC115598_1205760 Dictyostelium discoideum chromosome 2 map 58...    36   1.4     
gb:PFMAL7P1_1191865 Plasmodium falciparum 3D7 chromosome 7, *** ...    36   1.4     
gb:PFMAL7P1_1191794 Plasmodium falciparum 3D7 chromosome 7, *** ...    36   1.4     
gb:PFMAL13_1191690 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.4     
gb:PFMAL13_1191573 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.4     
gb:PFMAL13_1191555 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.4     
gb:AE014188_968156 Plasmodium falciparum 3D7 chromosome 12, comp...    36   1.4     
gb:AE014188_967824 Plasmodium falciparum 3D7 chromosome 12, comp...    36   1.4     
gb:AE014187_939115 Plasmodium falciparum 3D7 chromosome 14 compl...    36   1.4     
gb:AE014187_939079 Plasmodium falciparum 3D7 chromosome 14 compl...    36   1.4     
gb:AE014187_939054 Plasmodium falciparum 3D7 chromosome 14 compl...    36   1.4     
gb:AE014187_938999 Plasmodium falciparum 3D7 chromosome 14 compl...    36   1.4     
gb:AE014187_938781 Plasmodium falciparum 3D7 chromosome 14 compl...    36   1.4     
gb:AE014186_938439 Plasmodium falciparum 3D7 chromosome 11 compl...    36   1.4     
gb:AE014186_938357 Plasmodium falciparum 3D7 chromosome 11 compl...    36   1.4     
gb:AE014186_938053 Plasmodium falciparum 3D7 chromosome 11 compl...    36   1.4     
pir|T18477|T18477 hypothetical protein C0485w - malaria parasite...    36   1.4     
pir|C71622|C71622 hypothetical protein PFB0145c - malaria parasi...    36   1.4     
gb:AB070028_1870899 Macaca fascicularis testis cDNA clone:QtsA-1...    36   1.8     
gb:CR382127_1659833 Yarrowia lipolytica chromosome A of strain C...    36   1.8     
gb:PFMAL4P4_1394842 Plasmodium falciparum MAL4P4.                      36   1.8     
gb:PFMAL4P2_1394749 Plasmodium falciparum MAL4P2.                      36   1.8     
gb:PFATP3_1394095 Plasmodium falciparum P-type ATPase 3 gene.          36   1.8     
gb:PFA929351_1392943 Plasmodium falciparum strain 3D7, chromosom...    36   1.8     
gb:CR382400_1375059 Plasmodium falciparum chromosome 6, complete...    36   1.8     
gb:AY392758_1325157 Apis cerana cerana major royal jelly protein...    36   1.8     
gb:AF362368_1265601 Dictyostelium discoideum histidine kinase Dh...    36   1.8     
gb:AF153362_1245688 Dictyostelium discoideum adenylyl cyclase (a...    36   1.8     
gb:AC117176_1208027 Dictyostelium discoideum chromosome 2 map 50...    36   1.8     
gb:AC117081_1207896 Dictyostelium discoideum chromosome 2 map 58...    36   1.8     
gb:AC116986_1207490 Dictyostelium discoideum chromosome 2 map 22...    36   1.8     
gb:AC116984_1207223 Dictyostelium discoideum chromosome 2 map 25...    36   1.8     
gb:AC116957_1206729 Dictyostelium discoideum chromosome 2 map 16...    36   1.8     
gb:AC116956_1206563 Dictyostelium discoideum chromosome 2 map 14...    36   1.8     
gb:AB116598_1200351 Plasmodium falciparum msp1 gene for merozoit...    36   1.8     
gb:PFMAL8P1_1192139 Plasmodium falciparum 3D7 chromosome 8, *** ...    36   1.8     
gb:PFMAL7P1_1191986 Plasmodium falciparum 3D7 chromosome 7, *** ...    36   1.8     
gb:PFMAL7P1_1191978 Plasmodium falciparum 3D7 chromosome 7, *** ...    36   1.8     
gb:PFMAL7P1_1191973 Plasmodium falciparum 3D7 chromosome 7, *** ...    36   1.8     
gb:PFMAL13_1191609 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.8     
gb:PFMAL13_1191515 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.8     
gb:PFMAL13_1191391 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.8     
gb:PFMAL13_1191349 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.8     
gb:PFMAL13_1191319 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.8     
gb:PFMAL13_1191300 Plasmodium falciparum 3D7 chromosome 13, *** ...    36   1.8     
gb:AE014188_967916 Plasmodium falciparum 3D7 chromosome 12, comp...    36   1.8     
gb:AE014187_938955 Plasmodium falciparum 3D7 chromosome 14 compl...    36   1.8     
gb:AE014187_938908 Plasmodium falciparum 3D7 chromosome 14 compl...    36   1.8     
gb:AE014186_938289 Plasmodium falciparum 3D7 chromosome 11 compl...    36   1.8     
gb:AE014186_938052 Plasmodium falciparum 3D7 chromosome 11 compl...    36   1.8     
gb:AE014185_937808 Plasmodium falciparum 3D7 chromosome 10 compl...    36   1.8     
gb:AE014185_937788 Plasmodium falciparum 3D7 chromosome 10 compl...    36   1.8     
gb:AE014185_937685 Plasmodium falciparum 3D7 chromosome 10 compl...    36   1.8     
gb:AE016819_1748713 Ashbya gossypii (= Eremothecium gossypii) AT...    35   2.4     
gb:PFMAL4P1_1394699 Plasmodium falciparum MAL4P1.                      35   2.4     
gb:PFMAL3P7_1394612 Plasmodium falciparum MAL3P7, complete seque...    35   2.4     
gb:PFA929353_1393074 Plasmodium falciparum strain 3D7, chromosom...    35   2.4     
gb:CR382401_1375104 Plasmodium falciparum chromosome 6, complete...    35   2.4     
gb:CR382400_1375067 Plasmodium falciparum chromosome 6, complete...    35   2.4     
gb:CR382399_1374991 Plasmodium falciparum chromosome 6, complete...    35   2.4     
gb:CR382398_1374906 Plasmodium falciparum chromosome 6, complete...    35   2.4     
gb:AF491298_1276302 Plasmodium falciparum strain K1 D13 (D13) ge...    35   2.4     
gb:AF491296_1276300 Plasmodium falciparum strain MAD20 D13 (D13)...    35   2.4     
gb:AC117081_1207904 Dictyostelium discoideum chromosome 2 map 58...    35   2.4     
gb:AC117075_1207731 Dictyostelium discoideum chromosome 2 map 52...    35   2.4     
gb:AC117072_1207695 Dictyostelium discoideum chromosome 2 map 38...    35   2.4     
gb:AC117072_1207654 Dictyostelium discoideum chromosome 2 map 38...    35   2.4     
gb:AC115680_1205975 Dictyostelium discoideum chromosome 2 map 49...    35   2.4     
gb:AC115599_1205828 Dictyostelium discoideum chromosome 2 map 42...    35   2.4     
gb:PFMAL8P1_1192050 Plasmodium falciparum 3D7 chromosome 8, *** ...    35   2.4     
gb:PFMAL7P1_1191907 Plasmodium falciparum 3D7 chromosome 7, *** ...    35   2.4     
gb:PFMAL13_1191569 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   2.4     
gb:PFMAL13_1191354 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   2.4     
gb:AE014188_968287 Plasmodium falciparum 3D7 chromosome 12, comp...    35   2.4     
gb:AE014188_968113 Plasmodium falciparum 3D7 chromosome 12, comp...    35   2.4     
gb:AE014188_967882 Plasmodium falciparum 3D7 chromosome 12, comp...    35   2.4     
gb:AE014188_967851 Plasmodium falciparum 3D7 chromosome 12, comp...    35   2.4     
gb:AE014187_939118 Plasmodium falciparum 3D7 chromosome 14 compl...    35   2.4     
gb:AE014187_938880 Plasmodium falciparum 3D7 chromosome 14 compl...    35   2.4     
gb:AE014187_938868 Plasmodium falciparum 3D7 chromosome 14 compl...    35   2.4     
gb:AE014185_937826 Plasmodium falciparum 3D7 chromosome 10 compl...    35   2.4     
gb:AE014185_937757 Plasmodium falciparum 3D7 chromosome 10 compl...    35   2.4     
gb:CP000024_876103 Streptococcus thermophilus CNRZ1066, complete...    35   2.4     
gb:CP000029_80698 Staphylococcus epidermidis RP62A, complete gen...    35   2.4     
pir|E71604|E71604 hypothetical protein PFB0870w - malaria parasi...    35   2.4     
pir|JC5808|JC5808 G protein-coupled receptor 1 - yeast (Saccharo...    35   2.4     
sp|Q17060|MRJ3_APIME|MRJ3_APIME Major royal jelly protein 3 precursor (MRJP...    35   2.4     
sp|Q12361|GPR1_YEAST|GPR1_YEAST G protein-coupled receptor GPR1.>pir|S67568...    35   2.4     
gb:AF319992_2487566 Oryzias latipes strain Carbio DMRT2 gene, pa...    35   3.2     
gb:AX875947_1476313 Sequence 10852 from Patent EP1074617.              35   3.2     
gb:PFMAL4P3_1394821 Plasmodium falciparum MAL4P3.                      35   3.2     
gb:PFA17C1_1392029 Plasmodium falciparum mRNA for asparagine-ric...    35   3.2     
gb:DDU66369_1377382 Dictyostelium discoideum ORFveg132 mRNA, par...    35   3.2     
gb:DDI581661_1376977 Dictyostelium discoideum partial dstB gene ...    35   3.2     
gb:CR382399_1374952 Plasmodium falciparum chromosome 6, complete...    35   3.2     
gb:AY082888_1296566 Apis dorsata major royal jelly protein 3-lik...    35   3.2     
gb:AF531170_1279658 Meloidogyne incognita putative esophageal gl...    35   3.2     
gb:AF466307_1273488 Dictyostelium discoideum ABC transporter Abc...    35   3.2     
gb:AF362374_1265607 Dictyostelium discoideum histidine kinase Dh...    35   3.2     
gb:AC117176_1208017 Dictyostelium discoideum chromosome 2 map 50...    35   3.2     
gb:AC117076_1207862 Dictyostelium discoideum chromosome 2 map 33...    35   3.2     
gb:AC117072_1207692 Dictyostelium discoideum chromosome 2 map 38...    35   3.2     
gb:AC117072_1207678 Dictyostelium discoideum chromosome 2 map 38...    35   3.2     
gb:AC117070_1207625 Dictyostelium discoideum chromosome 2 map 20...    35   3.2     
gb:AC116986_1207527 Dictyostelium discoideum chromosome 2 map 22...    35   3.2     
gb:AC116960_1206798 Dictyostelium discoideum chromosome 2 map co...    35   3.2     
gb:AC116305_1206102 Dictyostelium discoideum chromosome 2 map 10...    35   3.2     
gb:AC115680_1206000 Dictyostelium discoideum chromosome 2 map 49...    35   3.2     
gb:AC115612_1205963 Dictyostelium discoideum chromosome 2 map 62...    35   3.2     
gb:AC114261_1205586 Dictyostelium discoideum chromosome 2 map 12...    35   3.2     
gb:PFMAL7P1_1192011 Plasmodium falciparum 3D7 chromosome 7, *** ...    35   3.2     
gb:PFMAL7P1_1191859 Plasmodium falciparum 3D7 chromosome 7, *** ...    35   3.2     
gb:PFMAL13_1191616 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   3.2     
gb:PFMAL13_1191590 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   3.2     
gb:PFMAL13_1191462 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   3.2     
gb:AE014188_968284 Plasmodium falciparum 3D7 chromosome 12, comp...    35   3.2     
gb:AE014187_939188 Plasmodium falciparum 3D7 chromosome 14 compl...    35   3.2     
gb:AE014187_938810 Plasmodium falciparum 3D7 chromosome 14 compl...    35   3.2     
gb:AE014187_938809 Plasmodium falciparum 3D7 chromosome 14 compl...    35   3.2     
gb:AE014187_938664 Plasmodium falciparum 3D7 chromosome 14 compl...    35   3.2     
pir|T09073|T09073 splicing factor Sip1 - human>gb:AF030234_18776...    35   3.2     
pir|T18469|T18469 hypothetical protein C0455w - malaria parasite...    35   3.2     
pir|S14469|S14469 asparagine-rich protein (clone 17C1) - Plasmod...    35   3.2     
pir|A59236|A59236 embryonic muscle myosin heavy chain - sea squi...    35   3.2     
pir|D72214|D72214 phosphate butyryltransferase - Thermotoga mari...    35   3.2     
gb:CR380959_1653698 Candida glabrata strain CBS138 chromosome M ...    35   4.1     
gb:PFA929355_1393289 Plasmodium falciparum strain 3D7, chromosom...    35   4.1     
gb:PFA929355_1393261 Plasmodium falciparum strain 3D7, chromosom...    35   4.1     
gb:PFA929354_1393210 Plasmodium falciparum strain 3D7, chromosom...    35   4.1     
gb:PFA929353_1393101 Plasmodium falciparum strain 3D7, chromosom...    35   4.1     
gb:PFA929352_1393034 Plasmodium falciparum strain 3D7, chromosom...    35   4.1     
gb:CR382399_1374990 Plasmodium falciparum chromosome 6, complete...    35   4.1     
gb:CR382398_1374849 Plasmodium falciparum chromosome 6, complete...    35   4.1     
gb:AY159036_1305199 Dictyostelium discoideum LvsE (lvsE) gene, p...    35   4.1     
gb:AF118151_1242669 Dictyostelium discoideum SNF1/AMP-activated ...    35   4.1     
gb:AF019981_1233307 Dictyostelium discoideum HelE (helE) gene, p...    35   4.1     
gb:AC117075_1207764 Dictyostelium discoideum chromosome 2 map 52...    35   4.1     
gb:AC116989_1207576 Dictyostelium discoideum chromosome 2 map 45...    35   4.1     
gb:AC116984_1207332 Dictyostelium discoideum chromosome 2 map 25...    35   4.1     
gb:AC116979_1207138 Dictyostelium discoideum chromosome 2 map 64...    35   4.1     
gb:AC116979_1207130 Dictyostelium discoideum chromosome 2 map 64...    35   4.1     
gb:AC116977_1207015 Dictyostelium discoideum chromosome 2 map 55...    35   4.1     
gb:AC114258_1205572 Dictyostelium discoideum chromosome 2 map co...    35   4.1     
gb:AB018543_1193798 Dictyostelium discoideum mkpA gene, complete...    35   4.1     
gb:AC123513_1192419 Dictyostelium discoideum strain AX4 chromoso...    35   4.1     
gb:PFMAL8P1_1192269 Plasmodium falciparum 3D7 chromosome 8, *** ...    35   4.1     
gb:PFMAL8P1_1192166 Plasmodium falciparum 3D7 chromosome 8, *** ...    35   4.1     
gb:PFMAL8P1_1192136 Plasmodium falciparum 3D7 chromosome 8, *** ...    35   4.1     
gb:PFMAL13_1191692 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   4.1     
gb:PFMAL13_1191675 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   4.1     
gb:PFMAL13_1191500 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   4.1     
gb:PFMAL13_1191322 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   4.1     
gb:PFMAL13_1191190 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   4.1     
gb:PFMAL13_1191100 Plasmodium falciparum 3D7 chromosome 13, *** ...    35   4.1     
gb:AE014298_1126323 Drosophila melanogaster chromosome X, comple...    35   4.1     
gb:AE014188_968112 Plasmodium falciparum 3D7 chromosome 12, comp...    35   4.1     
gb:AE014188_968022 Plasmodium falciparum 3D7 chromosome 12, comp...    35   4.1     
gb:AE014188_967963 Plasmodium falciparum 3D7 chromosome 12, comp...    35   4.1     
gb:AE014188_967868 Plasmodium falciparum 3D7 chromosome 12, comp...    35   4.1     
gb:AE014187_938978 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938946 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938792 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938763 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938748 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938702 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938649 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938640 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014187_938538 Plasmodium falciparum 3D7 chromosome 14 compl...    35   4.1     
gb:AE014186_938101 Plasmodium falciparum 3D7 chromosome 11 compl...    35   4.1     
gb:AE014185_937795 Plasmodium falciparum 3D7 chromosome 10 compl...    35   4.1     
gb:AE014185_937710 Plasmodium falciparum 3D7 chromosome 10 compl...    35   4.1     
gb:CP000003_861653 Streptococcus pyogenes MGAS10394, complete ge...    35   4.1     
gb:BA000028_695492 Oceanobacillus iheyensis HTE831 DNA, complete...    35   4.1     
gb:AY599483_635316 Haemophilus influenzae peptidase E (pepE) and...    35   4.1     
gb:AE017267_422342 Bacillus cereus ATCC 10987, section 4 of 18 o...    35   4.1     
gb:AE010112_259440 Streptococcus pyogenes strain MGAS8232, secti...    35   4.1     
pir|D71606|D71606 hypothetical protein PFB0800c - malaria parasi...    35   4.1     
pir|T08605|T08605 hypothetical protein HelE - slime mold (Dictyo...    35   4.1     
sp|P36168|YK76_YEAST|YK76_YEAST Hypothetical 137.5 kDa protein in MPL1-PPC1...    35   4.1     
sp|O43952|TGP1_TETTH|TGP1_TETTH G-quartet DNA binding protein TGP1.>pir|T03...    35   4.1     
gb:CR382138_1670718 Debaryomyces hansenii chromosome F of strain...    34   5.4     
gb:CR380949_1649625 Candida glabrata strain CBS138 chromosome C ...    34   5.4     
gb:PFMAL4P3_1394832 Plasmodium falciparum MAL4P3.                      34   5.4     
gb:PFMAL4P3_1394789 Plasmodium falciparum MAL4P3.                      34   5.4     
gb:PFMAL3P7_1394601 Plasmodium falciparum MAL3P7, complete seque...    34   5.4     
gb:PFMAL3P7_1394590 Plasmodium falciparum MAL3P7, complete seque...    34   5.4     
gb:PFA929358_1393524 Plasmodium falciparum strain 3D7, chromosom...    34   5.4     
gb:PFA929353_1393126 Plasmodium falciparum strain 3D7, chromosom...    34   5.4     
gb:PFA929351_1392928 Plasmodium falciparum strain 3D7, chromosom...    34   5.4     
gb:DDMYBS_1377216 Dictyostelium discoideum mybB gene.                  34   5.4     
gb:AY170918_1306258 Dictyostelium discoideum pats1 gene, partial...    34   5.4     
gb:AF362375_1265608 Dictyostelium discoideum histidine kinase Dh...    34   5.4     
gb:AF251283_1255867 Plasmodium falciparum CCAAT-box DNA binding ...    34   5.4     
gb:AF220177_1252309 Drosophila melanogaster male fruitless type-...    34   5.4     
gb:AF220176_1252308 Drosophila melanogaster female fruitless typ...    34   5.4     
gb:AC117080_1207872 Dictyostelium discoideum chromosome 2 map co...    34   5.4     
gb:AC117076_1207852 Dictyostelium discoideum chromosome 2 map 33...    34   5.4     
gb:AC116982_1207167 Dictyostelium discoideum chromosome 2 map 36...    34   5.4     
gb:AC116977_1207027 Dictyostelium discoideum chromosome 2 map 55...    34   5.4     
gb:AC116977_1206986 Dictyostelium discoideum chromosome 2 map 55...    34   5.4     
gb:AC116977_1206952 Dictyostelium discoideum chromosome 2 map 55...    34   5.4     
gb:AC116960_1206793 Dictyostelium discoideum chromosome 2 map co...    34   5.4     
gb:AC116922_1206437 Dictyostelium discoideum chromosome 2 map 60...    34   5.4     
gb:AC116305_1206152 Dictyostelium discoideum chromosome 2 map 10...    34   5.4     


>gb:AY084504_1569593 Arabidopsis thaliana clone 10987 mRNA, complete
            sequence.
          Length = 251

 Score =  246 bits (628), Expect = 7e-64
 Identities = 140/272 (51%), Positives = 168/272 (61%)
 Frame = -2

Query: 1094 TKFSQLRLSPATTANVPFKTTTIRMGGGPRTYPGGVSKWQWKRMQMKKSKQLLKARLARE 915
            +K S L L P+ T   P K+T IRMGGGPRT+PGGVSKWQWKRMQ KK KQLLKARL RE
Sbjct: 28   SKLSLLSLKPSPTQ--PRKSTVIRMGGGPRTFPGGVSKWQWKRMQAKKQKQLLKARLCRE 85

Query: 914  RQIYEMRKRTELKAAISELERPWEMVEKAPTLFSVSADEQLKVLADRFQRPGGFDMWSEK 735
            RQIYEMRKR ELKAA++ELERPWE + K P LFSV ADEQ+KVLADRFQ+PGGFD+W+++
Sbjct: 86   RQIYEMRKRAELKAAVAELERPWEPIHKPPNLFSVCADEQVKVLADRFQKPGGFDLWTDR 145

Query: 734  DGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDT 555
            DGP+L +S  DLPSARFFPKGVVHS+KPYG++ + S   DD +E                
Sbjct: 146  DGPQLFESVDDLPSARFFPKGVVHSVKPYGRLSS-SSVVDDGDESE-------------- 190

Query: 554  VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS 375
            VK   + ++ R                    +V K     G RR              N 
Sbjct: 191  VKDEEIGKKLR------------------GRRVRKRGDDGGKRR------------TENR 220

Query: 374  ANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
             N  R +NG      S S V+DM+LQ+DG YE
Sbjct: 221  GNGGRLRNG----GSSSSQVYDMTLQNDGRYE 248



>pir|G84798|G84798 hypothetical protein At2g37920 [imported] -
            Arabidopsis thaliana>gb:AC007661_1536104 Arabidopsis
            thaliana chromosome II section 205 of 255 of the complete
            sequence. Sequence from clones F13M22, T8P21, F16M14.
          Length = 387

 Score =  246 bits (628), Expect = 7e-64
 Identities = 140/272 (51%), Positives = 168/272 (61%)
 Frame = -2

Query: 1094 TKFSQLRLSPATTANVPFKTTTIRMGGGPRTYPGGVSKWQWKRMQMKKSKQLLKARLARE 915
            +K S L L P+ T   P K+T IRMGGGPRT+PGGVSKWQWKRMQ KK KQLLKARL RE
Sbjct: 164  SKLSLLSLKPSPTQ--PRKSTVIRMGGGPRTFPGGVSKWQWKRMQAKKQKQLLKARLCRE 221

Query: 914  RQIYEMRKRTELKAAISELERPWEMVEKAPTLFSVSADEQLKVLADRFQRPGGFDMWSEK 735
            RQIYEMRKR ELKAA++ELERPWE + K P LFSV ADEQ+KVLADRFQ+PGGFD+W+++
Sbjct: 222  RQIYEMRKRAELKAAVAELERPWEPIHKPPNLFSVCADEQVKVLADRFQKPGGFDLWTDR 281

Query: 734  DGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDT 555
            DGP+L +S  DLPSARFFPKGVVHS+KPYG++ + S   DD +E                
Sbjct: 282  DGPQLFESVDDLPSARFFPKGVVHSVKPYGRLSS-SSVVDDGDESE-------------- 326

Query: 554  VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS 375
            VK   + ++ R                    +V K     G RR              N 
Sbjct: 327  VKDEEIGKKLR------------------GRRVRKRGDDGGKRR------------TENR 356

Query: 374  ANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
             N  R +NG      S S V+DM+LQ+DG YE
Sbjct: 357  GNGGRLRNG----GSSSSQVYDMTLQNDGRYE 384



>gb:AY093194_1575148 Arabidopsis thaliana unknown protein (At2g37920)
            mRNA, complete cds.>gb:AY128823_1580903 Arabidopsis
            thaliana unknown protein (At2g37920) mRNA, complete cds.
          Length = 202

 Score =  232 bits (591), Expect = 1e-59
 Identities = 129/248 (52%), Positives = 154/248 (62%)
 Frame = -2

Query: 1022 MGGGPRTYPGGVSKWQWKRMQMKKSKQLLKARLARERQIYEMRKRTELKAAISELERPWE 843
            MGGGPRT+PGGVSKWQWKRMQ KK KQLLKARL RERQIYEMRKR ELKAA++ELERPWE
Sbjct: 1    MGGGPRTFPGGVSKWQWKRMQAKKQKQLLKARLCRERQIYEMRKRAELKAAVAELERPWE 60

Query: 842  MVEKAPTLFSVSADEQLKVLADRFQRPGGFDMWSEKDGPELLKSEADLPSARFFPKGVVH 663
             + K P LFSV ADEQ+KVLADRFQ+PGGFD+W+++DGP+L +S  DLPSARFFPKGVVH
Sbjct: 61   PIHKPPNLFSVCADEQVKVLADRFQKPGGFDLWTDRDGPQLFESVDDLPSARFFPKGVVH 120

Query: 662  SIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGM 483
            S+KPYG++ + S   DD +E                VK   + ++ R             
Sbjct: 121  SVKPYGRLSS-SSVVDDGDESE--------------VKDEEIGKKLR------------- 152

Query: 482  PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
                   +V K     G RR              N  N  R +NG      S S V+DM+
Sbjct: 153  -----GRRVRKRGDDGGKRR------------TENRGNGGRLRNG----GSSSSQVYDMT 191

Query: 302  LQSDGSYE 279
            LQ+DG YE
Sbjct: 192  LQNDGRYE 199



>gb:AP004144_1838207 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1712_E04.>gb:AP004865_1846221 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0020C11.
          Length = 630

 Score =  184 bits (466), Expect = 4e-45
 Identities = 88/139 (63%), Positives = 107/139 (76%), Gaps = 9/139 (6%)
 Frame = -2

Query: 1028 IRMGGGPRTYPGGVSKWQWKRMQMKKSKQLLKARLARERQIYEMRKRTELKAAISELERP 849
            IRMGGGPRT+PGGVSKWQWKRMQ +K+KQLLKARLARERQ+YEMRKR EL+ A + LERP
Sbjct: 48   IRMGGGPRTFPGGVSKWQWKRMQARKAKQLLKARLARERQLYEMRKRAELRDAAAHLERP 107

Query: 848  WE--------MVEKAPTLFSVSADEQLKVLADRFQRPGGFDMWSEKDGPELLKS-EADLP 696
            W+            AP L SV+AD+Q+K LADRF RPGG D+W+++DGP +  + +    
Sbjct: 108  WDPDASDSAAAAAAAPNLLSVAADDQMKALADRFHRPGGVDLWNDRDGPRVFAAPDTGRA 167

Query: 695  SARFFPKGVVHSIKPYGKV 639
            SARFFPKG VHS++PYG V
Sbjct: 168  SARFFPKGSVHSVQPYGLV 186



>pir|C96658|C96658 probable RNA helicase F9N12.13 [imported] -
            Arabidopsis thaliana>gb:AE005173_893993 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC022355_1538932 Arabidopsis thaliana
            chromosome 1 BAC F9N12 genomic sequence, complete
            sequence.
          Length = 798

 Score = 95.1 bits (235), Expect = 3e-18
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 1/116 (0%)
 Frame = -2

Query: 1070 SPATTANVPFKTTTIRMGGGPRTYPGGVSKWQWKRMQMKKSKQLLKARLARERQIYEMRK 891
            S + T ++  + ++  MGGGPRT+PGG++KWQWKRM  KK+++     L +E+Q+YE R 
Sbjct: 10   SGSITGSLWNRISSRNMGGGPRTFPGGLNKWQWKRMHEKKAREKENKLLDQEKQLYEARI 69

Query: 890  RTELKAAISELERPWEMVEKAPTLFS-VSADEQLKVLADRFQRPGGFDMWSEKDGP 726
            RTE++A +       E   K+      +S  E +K LADRF + G  D W+E DGP
Sbjct: 70   RTEIRAKMWGNPDSGEKTAKSKQSHGPMSPKEHIKTLADRFMKAGAEDFWNENDGP 125



>pir|E84488|E84488 probable RNA helicase [imported] - Arabidopsis
            thaliana>gb:AC004483_1531776 Arabidopsis thaliana
            chromosome 2 clone T12J2 map mi421, complete sequence.
          Length = 845

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 45/100 (45%), Positives = 63/100 (63%), Gaps = 1/100 (1%)
 Frame = -2

Query: 1022 MGGGPRTYPGGVSKWQWKRMQMKKSKQLLKARLARERQIYEMRKRTELKAAISELERPWE 843
            MGGGPRT+PGG++KWQWKRM  KK+++     L +E+Q+YE R RTE++A +       E
Sbjct: 76   MGGGPRTFPGGLNKWQWKRMHEKKAREKENKLLDQEKQLYEARIRTEIRAKMWGHPDSGE 135

Query: 842  MVEKAPTLFS-VSADEQLKVLADRFQRPGGFDMWSEKDGP 726
               K       +S  E +K LADRF + G  D+W++ DGP
Sbjct: 136  KTAKLKQSHGPMSPKEHIKTLADRFMKAGADDLWNDNDGP 175



>gb:AP004776_1844881 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0452F04.
          Length = 811

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 43/102 (42%), Positives = 61/102 (59%), Gaps = 3/102 (2%)
 Frame = -2

Query: 1022 MGGGPRTYPGGVSKWQWKRMQMKKSKQLLKARLARERQIYEMRKRTELKAA---ISELER 852
            MGGGPRT+PGG+SKWQ KRM  K ++   +  L  E+Q+Y  R R+E++A+    +    
Sbjct: 1    MGGGPRTFPGGLSKWQHKRMHEKLARHKERGLLRHEKQLYLARLRSEIRASRLPAAGASP 60

Query: 851  PWEMVEKAPTLFSVSADEQLKVLADRFQRPGGFDMWSEKDGP 726
            P +     PT    S+   ++ LADRF  PG  D+W+E DGP
Sbjct: 61   PDD--GDGPT----SSRAHIRALADRFLLPGAEDLWNEDDGP 96



>gb:AE014187_938840 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014822_1227916 Plasmodium falciparum 3D7
            chromosome 14 section 7 of 13 of the complete sequence.
          Length = 1076

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 25/105 (23%), Positives = 48/105 (45%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            ++S G D + ++N++  +NK+     T   N++N    N  HS   NS     NN N+  
Sbjct: 696  SMSSGNDGKAKNNKSNNKNKNGTNTSTNNNNNVNNSNHNNKHSNNSNSNSNSKNNNNNNN 755

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N +  N N    ++  V +    + +  K ++N++ +
Sbjct: 756  NNNNRISINNQMSNNNKRMSNTQYVLNNQSNKNKTLKNRHNNNNN 800



 Score = 39.3 bits (90), Expect = 0.17
 Identities = 35/128 (27%), Positives = 45/128 (35%), Gaps = 5/128 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSL-NRRERNVTHSGEQNSK----GMPYNN 471
           N + G ++ N +N     N SSF   +   NS  N    N  +S   NS         NN
Sbjct: 292 NTTQGNNNSNNNNNNNNNNSSSFNNSSSFNNSSSNNSSSNNNNSSNYNSSCSNNNSSSNN 351

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
            N     NN    N+  YN N     S   N  N     N     N+ K +    S + D
Sbjct: 352 NNSSTSSNNNGNNNKNNYNNNYNNSLSTNENFTN-----NLVNPINYKKVSSKKRSYKKD 406

Query: 290 GSYEFQTE 267
            S    TE
Sbjct: 407 FSNNTLTE 414



>gb:AE014186_938139 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014838_1228873 Plasmodium falciparum 3D7
            chromosome 11 section 3 of 8 of the complete sequence.
          Length = 1283

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 38/146 (26%), Positives = 60/146 (41%), Gaps = 17/146 (11%)
 Frame = -2

Query: 713  SEADLPS----ARFFPKGVVHS--IKPY----GKVENISDGFDDENEDNRTLGRNKSSFE 564
            +E D+PS    A F+ +   HS  +KPY    G + NI       N       +N +   
Sbjct: 697  NECDIPSEEKQANFYSRKPNHSYTMKPYKICIGTLNNI---ITQSNIPINNTNQNINGSP 753

Query: 563  WDTVKTNSLNRRERNVTHSGEQNSKGMPYN-------NKNDKVMKNNFRKGNRRKYNTNL 405
             +T  TN+ N  E N  +    N++    N       N N+    NN    N  + N N 
Sbjct: 754  INTTTTNNNNNNENNNNNENNNNNENNNNNENNNNNENNNNNENNNNNENNNNNENNNNN 813

Query: 404  ERLSSDKVNSANEFRRQNGKTKYNHS 327
            E  ++++ N+ NE    N    +NH+
Sbjct: 814  ENNNNNENNNNNENNNNNNHHNHNHN 839



>gb:AC115684_1206034 Dictyostelium discoideum chromosome 2 map
           3108975-3191114 strain AX4, complete sequence.
          Length = 1723

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 26/104 (25%), Positives = 42/104 (40%), Gaps = 1/104 (0%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSF-EWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           +N S  F+++N +N     N ++   +D   +N+ N    N THS   N+     NN N 
Sbjct: 113 QNNSSNFNNQNNNNSNNNNNNNNINSYDYNNSNNNNYNNNNNTHSNNSNNNN---NNNNS 169

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
               NN    N    N N    +++  N+ N     N     N+
Sbjct: 170 NYWNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNNNNNNN 213



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 25/119 (21%), Positives = 45/119 (37%), Gaps = 1/119 (0%)
 Frame = -2

Query: 653 PYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYN 474
           P+   + + D  ++ N +N +   N +S       +N  N    +       N     YN
Sbjct: 248 PFNGNQMVMDNNNNNNNNNNSNVFNSNS------NSNVFNSNSGSFLQINNNNGSFSSYN 301

Query: 473 NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK-SAVFDMSL 300
           N N+    NN    N    N N    +++  N+ N     N     N+++ S  +D +L
Sbjct: 302 NNNNNNNNNNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNNQFSQSYDSTL 360



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 24/110 (21%), Positives = 40/110 (36%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           + N ++     N  SF        S +    N  ++   NS     NN N+    NN   
Sbjct: 272 NSNSNSNVFNSNSGSFLQINNNNGSFSSYNNNNNNNNNNNSNS---NNNNNNNNNNNNNN 328

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
            N    N N    ++   N+ N+F +    T  N+  S++    +Q   S
Sbjct: 329 NNNNNNNNNNNNNNNSNNNNNNQFSQSYDSTLGNNRFSSMMGQPIQQQQS 378



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 22/95 (23%), Positives = 32/95 (33%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           S+ F+  +     +  N  SF       N+ N    N  ++   N+     NN N+    
Sbjct: 277 SNVFNSNSGSFLQINNNNGSFSSYNNNNNNNNNNNSNSNNNNNNNNNNNNNNNNNNNNNN 336

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGK 345
           NN    N    N N    S D     N F    G+
Sbjct: 337 NNNNNNNSNNNNNNQFSQSYDSTLGNNRFSSMMGQ 371



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 18/98 (18%), Positives = 40/98 (40%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           + N +N     N+ S  +    ++     + N ++   QN+     NN N+ +   ++  
Sbjct: 84  NNNNNNNQHMNNQYSNSFHNNNSSGFMAFQNNSSNFNNQNNNNSNNNNNNNNINSYDYNN 143

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N   YN N    ++   N++N     N    +N++ +
Sbjct: 144 SNNNNYNNN----NNTHSNNSNNNNNNNNSNYWNNNNN 177



>gb:AF482386_1275396 Dictyostelium discoideum ABC transporter AbcG7
           (abcG7) gene, complete cds.
          Length = 815

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 25/101 (24%), Positives = 44/101 (43%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI +  D+ N DN ++G N           N+++    N+ ++   N   +  N  N+  
Sbjct: 33  NIDNNIDNNNIDNNSIGNN----------NNNIDNNNNNIANNNINNINNIDNNIDNNNN 82

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           + NN  K N   YN N++  +++  N+ N     N    YN
Sbjct: 83  IDNNNNKNNSNNYN-NIDNNNNNNNNNNNNNNNNNNIDNYN 122



>gb:PFA929355_1393269 Plasmodium falciparum strain 3D7, chromosome 9;
            segment 1/5.
          Length = 1770

 Score = 43.9 bits (102), Expect = 0.007
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 1/100 (1%)
 Frame = -2

Query: 620  FDDENEDNRTLGRNKSSFEWDTVK-TNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNN 444
            +++EN DN  +  N +  +   +K +NS N   RN   +   N+     NN N+    NN
Sbjct: 818  YNNENVDNSKMFINCNKSQRSNIKKSNSTNSTRRNYNRNNNNNNNKNNNNNNNNNNNNNN 877

Query: 443  FRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
                N R  N N    +++  N+ N     N     N++K
Sbjct: 878  NNNNNSRNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNNNK 917



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 26/110 (23%), Positives = 43/110 (39%), Gaps = 1/110 (0%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            Y +  N ++  ++ N +N     N ++        NS N    N  ++   N+     NN
Sbjct: 853  YNRNNNNNNNKNNNNNNNNNNNNNNNN------NNNSRNNNNNNNNNNNNNNNNNNNNNN 906

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSDKVN-SANEFRRQNGKTKYNHSK 324
             N+    NN +  N    N N      DK N + N  +++N K   N  K
Sbjct: 907  NNNNNHNNNNKDDNTSDNNNNNINKEEDKKNKTTNNKKKENEKDDENKCK 956



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 31/136 (22%), Positives = 56/136 (41%), Gaps = 10/136 (7%)
 Frame = -2

Query: 641  VENISDGFDDENEDNR-TLGRNKSSFEWDTVKTNSL----NRRER-NVTHSGEQNSKGMP 480
            V+N  +   +EN DN   + RN + +  + V  + +    N+ +R N+  S   NS    
Sbjct: 793  VDNNENVDSNENVDNNENMDRNDNMYNNENVDNSKMFINCNKSQRSNIKKSNSTNSTRRN 852

Query: 479  YN----NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVF 312
            YN    N N+K   NN    N    N N    +++  N+ N     N     N++ +   
Sbjct: 853  YNRNNNNNNNKNNNNNNNNNNNNNNNNNNNSRNNNNNNNNNNNNNNNNNNNNNNNNNNNH 912

Query: 311  DMSLQSDGSYEFQTEN 264
            + + + D + +    N
Sbjct: 913  NNNNKDDNTSDNNNNN 928



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 23/113 (20%), Positives = 38/113 (33%)
 Frame = -2

Query: 662  SIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGM 483
            +IK      +    ++  N +N     N ++        N+ N    N       N+   
Sbjct: 839  NIKKSNSTNSTRRNYNRNNNNNNNKNNNNNN------NNNNNNNNNNNNNSRNNNNNNNN 892

Query: 482  PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
              NN N+    NN    N    N   +  S +  N+ N+   +  KT  N  K
Sbjct: 893  NNNNNNNNNNNNNNNNNNNHNNNNKDDNTSDNNNNNINKEEDKKNKTTNNKKK 945



>gb:PFMAL13_1191234 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1601

 Score = 43.9 bits (102), Expect = 0.007
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 4/110 (3%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           ENIS+G   EN     + +N SS E    K N +    + V    E N  G  Y +KND+
Sbjct: 138 ENISNGDIHEN-----IQKNMSSGELKEHKVNHM----KIVDKHNESNMYGDAYGSKNDE 188

Query: 458 VMKNN--FRKGNRRKYNTNLE-RLSSDKVN-SANEFRRQNGKTKYNHSKS 321
           + KNN    K N   Y  N E   ++D++N + NE  + N +T  N+ ++
Sbjct: 189 MNKNNNEMYKNNNEMYKNNDEMNKNNDEMNKNNNEMNKNNDETNKNNDET 238



>gb:PFA10B_1392017 P.falciparum 10b antigen gene, partial cds.
          Length = 374

 Score = 43.1 bits (100), Expect = 0.012
 Identities = 30/123 (24%), Positives = 55/123 (44%), Gaps = 4/123 (3%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTH--SGEQNSKGMPYNNKN 465
           EN+  G   +N +N+      ++ + +  K N+ N    N+      + NS+ +  N +N
Sbjct: 203 ENMKQG-KTKNSNNKNNNNKNNNNKNNNNKNNNNNNNNNNLESITKNKNNSQYISTNVEN 261

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN--GKTKYNHSKSAVFDMSLQSD 291
           + + KN  +KG   K  T  +R + ++ N  N F   N  G  +Y  +K   F  S  + 
Sbjct: 262 ENLNKNE-QKGKMNKMKTKTQRFNKEEQNETNNFTNNNKKGSNRYQQNKKGQFKNSNMNY 320

Query: 290 GSY 282
            S+
Sbjct: 321 NSW 323



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 19/55 (34%), Positives = 26/55 (47%)
 Frame = -2

Query: 539 LNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS 375
           L   E N+     +NS     NNKN+    NN +  N    N NLE ++ +K NS
Sbjct: 198 LPNEEENMKQGKTKNSNNKNNNNKNNNNKNNNNKNNNNNNNNNNLESITKNKNNS 252



>gb:AF051898_1236723 Dictyostelium discoideum coronin binding
           protein (DB10) mRNA, complete cds.
          Length = 560

 Score = 43.1 bits (100), Expect = 0.012
 Identities = 25/105 (23%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++G ++ N  N     N ++        NS N   RN+T+    N    P NN N   
Sbjct: 330 NNNNGINNRNNSNNNSNNNSNN--------NSNNSNNRNITNGSNANKSNSPNNNLNTNN 381

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              N    N    N N    +S+  N+ N     N  +  N++ +
Sbjct: 382 DNKNNNSNNNNNSNNNSNNGNSNNNNNNNIINNNNSNSNSNNNSN 426



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 24/106 (22%), Positives = 41/106 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++G  + N +N  +  N S+       +NS N    N  ++  +NS     N  ND  
Sbjct: 397 NSNNGNSNNNNNNNIINNNNSN-------SNSNNNSNNNSNNNSNRNSPNHNNNGDNDNN 449

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
             NN    N    N N    +++  N+ N           N+S ++
Sbjct: 450 TNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNYADNSNNNSSNS 495



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 23/124 (18%), Positives = 47/124 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N +   +  N  N    RN  +   +    N+ N    N  ++   N+     NN N+  
Sbjct: 418 NSNSNNNSNNNSNNNSNRNSPNHNNNGDNDNNTNNNTNNNNNNNNNNNNNNNNNNNNNNN 477

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
             NN    +    N++    ++   N+ N+ + +N   +     +  F    Q +GS + 
Sbjct: 478 NNNNNNYADNSNNNSSNSNNNNSNSNNNNDNKNENSDNQSVLRSNEKFTDENQKNGSDDQ 537

Query: 275 QTEN 264
           Q ++
Sbjct: 538 QNQS 541



>gb:AC116986_1207460 Dictyostelium discoideum chromosome 2 map
           2234041-2567370 strain AX4, complete sequence.
          Length = 507

 Score = 43.1 bits (100), Expect = 0.012
 Identities = 25/105 (23%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++G ++ N  N     N ++        NS N   RN+T+    N    P NN N   
Sbjct: 277 NNNNGINNRNNSNNNSNNNSNN--------NSNNSNNRNITNGSNANKSNSPNNNLNTNN 328

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              N    N    N N    +S+  N+ N     N  +  N++ +
Sbjct: 329 DNKNNNSNNNNNSNNNSNNGNSNNNNNNNIINNNNSNSNSNNNSN 373



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 24/106 (22%), Positives = 41/106 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++G  + N +N  +  N S+       +NS N    N  ++  +NS     N  ND  
Sbjct: 344 NSNNGNSNNNNNNNIINNNNSN-------SNSNNNSNNNSNNNSNRNSPNHNNNGDNDNN 396

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
             NN    N    N N    +++  N+ N           N+S ++
Sbjct: 397 TNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNYADNSNNNSSNS 442



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 23/124 (18%), Positives = 47/124 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N +   +  N  N    RN  +   +    N+ N    N  ++   N+     NN N+  
Sbjct: 365 NSNSNNNSNNNSNNNSNRNSPNHNNNGDNDNNTNNNTNNNNNNNNNNNNNNNNNNNNNNN 424

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
             NN    +    N++    ++   N+ N+ + +N   +     +  F    Q +GS + 
Sbjct: 425 NNNNNNYADNSNNNSSNSNNNNSNSNNNNDNKNENSDNQSVLRSNEKFTDENQKNGSDDQ 484

Query: 275 QTEN 264
           Q ++
Sbjct: 485 QNQS 488



>gb:AC115607_1205917 Dictyostelium discoideum chromosome 2 map
           4559693-4624405 strain AX4, complete sequence.
          Length = 962

 Score = 43.1 bits (100), Expect = 0.012
 Identities = 26/108 (24%), Positives = 46/108 (42%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N +D +++ N +N     N ++F  +    N+ N    N  ++ + N+    YNN N   
Sbjct: 437 NSNDSYNNNNNNNNNF--NNNNFNNNNNNNNNNNNNNNNNNNNNKNNNNSNSYNNNN--- 491

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVF 312
             NN+   N   +N N    +S   N+ N +   N    YN + +  F
Sbjct: 492 --NNYNNNNNNFHNNN---NNSAHNNNNNNYNNNNNNNYYNSNNNNNF 534



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 28/130 (21%), Positives = 50/130 (38%), Gaps = 1/130 (0%)
 Frame = -2

Query: 650 YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERN-VTHSGEQNSKGMPYN 474
           Y    N ++  ++ N +N +   N ++   +    N+ N   RN + +S   NS     N
Sbjct: 367 YNNYNNYNNNNNNNNNNNNSNNSNSNNNNNNNNNNNNNNNNNRNNIINSNINNSNN---N 423

Query: 473 NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQS 294
           N ND    NN    +   YN N    ++   N+ N     N     N++ +   + +  +
Sbjct: 424 NYNDNGYNNNSNINSNDSYNNNNNNNNNFNNNNFNNNNNNNNNNNNNNNNNNNNNKNNNN 483

Query: 293 DGSYEFQTEN 264
             SY     N
Sbjct: 484 SNSYNNNNNN 493



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 24/123 (19%), Positives = 52/123 (42%), Gaps = 3/123 (2%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNK---SSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           NI++  ++ N  N     N    +SF  +T K N+      N++   + N+     NN N
Sbjct: 304 NINNNNNNNNNSNNNNWNNNYCNNSFADETNKNNTYGMEYINISEENQYNNNNNN-NNSN 362

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
           +    NN+   N    N N    S++  ++ N     N     N++++ + + ++ +  +
Sbjct: 363 NNNNYNNYNNYNNNNNNNNNNNNSNNSNSNNNNNNNNNNNNNNNNNRNNIINSNINNSNN 422

Query: 284 YEF 276
             +
Sbjct: 423 NNY 425



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 27/115 (23%), Positives = 43/115 (37%), Gaps = 3/115 (2%)
 Frame = -2

Query: 668 VHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSK 489
           ++S   Y    N ++ F++ N +N     N ++        N+ N   +N  +S   N+ 
Sbjct: 436 INSNDSYNNNNNNNNNFNNNNFNNNNNNNNNNNNN-----NNNNNNNNKNNNNSNSYNNN 490

Query: 488 GMPYNNKNDKVMKNN---FRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
              YNN N+    NN       N   YN N    +    N+ N F   N     N
Sbjct: 491 NNNYNNNNNNFHNNNNNSAHNNNNNNYNNN-NNNNYYNSNNNNNFHNNNNNNNNN 544



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 24/105 (22%), Positives = 43/105 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++  ++   DN     N +    D+   N+ N    N  +    N+     NN N+  
Sbjct: 416 NINNSNNNNYNDNG-YNNNSNINSNDSYNNNNNNNNNFNNNNFNNNNNNNNNNNNNNNNN 474

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N   YN N    +++  N+ N F   N  + +N++ +
Sbjct: 475 NNNNKNNNNSNSYNNN----NNNYNNNNNNFHNNNNNSAHNNNNN 515



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 24/103 (23%), Positives = 43/103 (41%)
 Frame = -2

Query: 677 KGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ 498
           +G ++S++ Y    NI+D   +   +N     N ++F  D    N+ N    N+ ++   
Sbjct: 224 EGHINSVQTYSG-NNINDKNQNNTNNNNNNMSNNNNFHDD----NNCNVNYNNIRNNSNN 278

Query: 497 NSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
           N+     NN N+    NN    N    N N    ++   N+ N
Sbjct: 279 NNNNNTNNNNNNNNNNNNNNNNNNNNINNNNNNNNNSNNNNWN 321



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 26/96 (27%), Positives = 37/96 (38%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           N +N +   N ++   +    N  N    N  H+   N+     NN  +    NN   GN
Sbjct: 503 NNNNNSAHNNNNNNYNNNNNNNYYNSNNNNNFHNNNNNN-----NNNGNNFNNNNNNNGN 557

Query: 428 RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                TN+   S D VN  N +   NG   YN + S
Sbjct: 558 NGNMFTNVN--SIDNVN-RNNYNNYNGNNNYNGNNS 590



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 21/101 (20%), Positives = 40/101 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     NK++   ++   N+ N    N  ++   N+    +NN N+  
Sbjct: 460 NNNNNNNNNNNNNNNNNNNKNNNNSNSYNNNNNNYNNNN--NNFHNNNNNSAHNNNNNNY 517

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
             NN         N N    +++  N+ N F   N     N
Sbjct: 518 NNNNNNNYYNSNNNNNFHNNNNNNNNNGNNFNNNNNNNGNN 558



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 22/82 (26%), Positives = 33/82 (40%)
 Frame = -2

Query: 539 LNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFR 360
           LN R RN  ++   N+     NN N+    NN    N    N N    +S+  N+     
Sbjct: 7   LNNRNRNRNNNNNNNNNNNNNNNNNNN---NNNNNNNNNNNNNNNNNNNSNNGNANESAS 63

Query: 359 RQNGKTKYNHSKSAVFDMSLQS 294
             NG  +   + S+ F   +QS
Sbjct: 64  LNNGSEEIRSNPSSNFSSPIQS 85



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 25/117 (21%), Positives = 45/117 (38%), Gaps = 7/117 (5%)
 Frame = -2

Query: 650 YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
           Y  + N S+  ++ N +N     N ++   +    N++N    N  +S   N      NN
Sbjct: 269 YNNIRNNSNNNNNNNTNNNNNNNNNNNNN-NNNNNNNINNNNNNNNNSNNNNWNNNYCNN 327

Query: 470 K-NDKVMKNN------FRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              D+  KNN             +YN N    +S+  N+ N +   N     N++ +
Sbjct: 328 SFADETNKNNTYGMEYINISEENQYNNNNNNNNSNNNNNYNNYNNYNNNNNNNNNNN 384



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 23/103 (22%), Positives = 43/103 (41%), Gaps = 8/103 (7%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFE----WDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           NIS+     N +N     N +++     ++    N+ N    N ++S   N+     NN 
Sbjct: 345 NISEENQYNNNNNNNNSNNNNNYNNYNNYNNNNNNNNNNNNSNNSNSNNNNNNNNNNNNN 404

Query: 467 NDK----VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
           N+     ++ +N    N   YN N    +S+ +NS + +   N
Sbjct: 405 NNNNRNNIINSNINNSNNNNYNDNGYNNNSN-INSNDSYNNNN 446



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 21/100 (21%), Positives = 38/100 (38%), Gaps = 2/100 (2%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           +EN+ N     N S+   +    N+ N    N  ++   N+     NN N+    NN   
Sbjct: 348 EENQYNNNNNNNNSNNNNNYNNYNNYNNNNNNNNNNNNSNNSNSNNNNNNNNNNNNNNNN 407

Query: 434 GNRRKYNTNLERLSSDKV--NSANEFRRQNGKTKYNHSKS 321
                 N+N+   +++    N  N     N    YN++ +
Sbjct: 408 NRNNIINSNINNSNNNNYNDNGYNNNSNINSNDSYNNNNN 447



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 25/123 (20%), Positives = 42/123 (34%), Gaps = 1/123 (0%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSF-EWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
           ++ F DE   N T G    +  E +    N+ N    N  +    N+     NN N+   
Sbjct: 326 NNSFADETNKNNTYGMEYINISEENQYNNNNNNNNSNNNNNYNNYNNYNNNNNNNNNNNN 385

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQ 273
            NN    N    N N    +++  N+       N      +      + ++ S+ SY   
Sbjct: 386 SNNSNSNNNNNNNNNNNNNNNNNRNNIINSNINNSNNNNYNDNGYNNNSNINSNDSYNNN 445

Query: 272 TEN 264
             N
Sbjct: 446 NNN 448



>gb:AE014185_937789 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014832_1228523 Plasmodium falciparum 3D7
            chromosome 10 section 4 of 7 of the complete sequence.
          Length = 2290

 Score = 43.1 bits (100), Expect = 0.012
 Identities = 25/122 (20%), Positives = 53/122 (43%), Gaps = 8/122 (6%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            Y    N ++  ++EN++N     NK++        N+ N++  N  ++   N+     NN
Sbjct: 1880 YSNNNNNNENKNNENKNNENNNNNKNN--------NNENKKNNNKKNNNNNNNNNNNNNN 1931

Query: 470  KNDKVMKNN--------FRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
            KN+ +  NN          K N +K   N++    +   + N  ++QN K +  ++   +
Sbjct: 1932 KNNNINNNNNNNNNPQVHNKKNEKKSGCNIKTKEQNNNKNTNNMKKQNLKNEIRNNYQMI 1991

Query: 314  FD 309
             +
Sbjct: 1992 IE 1993



 Score = 42.7 bits (99), Expect = 0.015
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 10/118 (8%)
 Frame = -2

Query: 605  EDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSG--------EQNSKGMPYNNKNDKVMK 450
            E+N   G+ K+S   +    N+ N+   N  ++         + NS+ +  N +N+ + K
Sbjct: 1025 EENMKQGKTKNSNNKNNNNKNNKNKNNNNNNNNNNLESITKNKNNSQYISTNVENENLNK 1084

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN--GKTKYNHSKSAVFDMSLQSDGSY 282
            N  +KG   K  T  +R + ++ N  N F   N  G  +Y  +K   F  S  +  S+
Sbjct: 1085 NE-QKGKMNKMKTKTQRFNKEEQNETNNFTNNNKKGSNRYQQNKKGQFKNSNMNYNSW 1141



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 21/78 (26%), Positives = 33/78 (42%), Gaps = 4/78 (5%)
 Frame = -2

Query: 548  TNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK----GNRRKYNTNLERLSSDKV 381
            T  L + ++N     E  +K    NN N+   KNN  K     N  K N N  + +++K 
Sbjct: 1858 TTLLRKGKKNFKFIDETKNKNKYSNNNNNNENKNNENKNNENNNNNKNNNNENKKNNNKK 1917

Query: 380  NSANEFRRQNGKTKYNHS 327
            N+ N     N     N++
Sbjct: 1918 NNNNNNNNNNNNNNKNNN 1935



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 19/80 (23%), Positives = 31/80 (38%)
 Frame = -2

Query: 590  LGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNT 411
            L + K +F++     N       N  +  + N      NN N+K   N  +K N +K N 
Sbjct: 1861 LRKGKKNFKFIDETKNKNKYSNNNNNNENKNNENKNNENNNNNKNNNNENKKNNNKKNNN 1920

Query: 410  NLERLSSDKVNSANEFRRQN 351
            N    +++  N  N     N
Sbjct: 1921 NNNNNNNNNNNKNNNINNNN 1940



>gb:PFA929359_1393532 Plasmodium falciparum strain 3D7, chromosome
           9; segment 5/5.
          Length = 703

 Score = 42.7 bits (99), Expect = 0.015
 Identities = 30/144 (20%), Positives = 68/144 (47%), Gaps = 7/144 (4%)
 Frame = -2

Query: 656 KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQN--SKGM 483
           K  G   ++ +G  ++ E+N  +  NK+  E + V   + N+ E N+   G +N   + +
Sbjct: 415 KNNGDENSVMEGNKNKEEENIVMEENKNKEEENIVMEENKNKEEENIVMEGNKNKEEENI 474

Query: 482 PYNNKNDKVMKNNFRKGNRRKYNTNL---ERLSSDKVNSANEFRRQNGK--TKYNHSKSA 318
                 +K  +N   +GN+ K   N+   E  + ++ N   E   ++ K   K+N+    
Sbjct: 475 VMEENKNKEEENIVMEGNKNKEEENIVMEENKNKEEENIVMEENNEHNKEPLKHNNHCEK 534

Query: 317 VFDMSLQSDGSYEFQTEN*ACKLS 246
           + ++S Q   + +++ +N + ++S
Sbjct: 535 INNVSEQMYDNKKYEIDNSSVQIS 558



>gb:PFMAL8P1_1192309 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1868

 Score = 42.7 bits (99), Expect = 0.015
 Identities = 28/113 (24%), Positives = 45/113 (39%), Gaps = 5/113 (4%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            K+ NI D  DD N  N        +F  D + T S N++   + H           NNK 
Sbjct: 1575 KIVNIKDNKDDHNNKNCATSEMTKTFNLDLLNTTSSNQKNE-IQH----------INNKG 1623

Query: 464  DKVMKNNFRKGNRRKYNTNLER-----LSSDKVNSANEFRRQNGKTKYNHSKS 321
            DK + N F +  +   N N+E      +  + +N+ N     N     N++ +
Sbjct: 1624 DKHITNVFMRKTKSNNNINMENADMLLIDEETINNNNNNNNNNNNNNNNNNNN 1676



>gb:PFA929353_1393087 Plasmodium falciparum strain 3D7, chromosome
           5, segment 3/4.
          Length = 1123

 Score = 42.4 bits (98), Expect = 0.020
 Identities = 32/113 (28%), Positives = 56/113 (49%), Gaps = 1/113 (0%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           +N  D  DD N+DN     N +    D    +  N  E+    S ++N K + +N KND 
Sbjct: 69  DNNDDNDDDNNDDNNNDVNNNNVNNNDVNNDDVNNDGEKRNNISYDKNKKNL-FNEKNDN 127

Query: 458 VM-KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
           ++  + ++K N+    T  +  SS+K+ S ++  +QN KTK+  S    ++ S
Sbjct: 128 IVHSSKYKKDNQ----TQEDDTSSNKIQSKDK-PKQNEKTKFKTSIKLYYNNS 175



>gb:AY232271_1311380 Dictyostelium discoideum putative protein Roco9
            (roco9) gene, complete cds.
          Length = 3365

 Score = 42.4 bits (98), Expect = 0.020
 Identities = 22/124 (17%), Positives = 49/124 (39%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            +I +  ++ N +N  +  N ++   +    N+ N    N   +   N+     NN N+ +
Sbjct: 2220 SIDNNVENTNNNNNIINNNNNNNNNNNNNNNNNNSYNSNSNSNSNNNNNNNSNNNNNNNI 2279

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
              NN    N    N N    +++  N++N     N  +  N + +   + ++ ++ S   
Sbjct: 2280 NNNNINNNNNNNNNNNNNNNNNNNNNNSNNNSNNNSNSNSNSNSNNSNNNNINNNNSNNN 2339

Query: 275  QTEN 264
               N
Sbjct: 2340 NNNN 2343



 Score = 40.4 bits (93), Expect = 0.075
 Identities = 23/105 (21%), Positives = 42/105 (40%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++  ++ N +N +   N +S   +    NS N    N+ ++   N+     NN N+  
Sbjct: 2240 NNNNNNNNNNNNNNSYNSNSNSNSNNNNNNNSNNNNNNNINNNNINNNNNNNNNNNNNNN 2299

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N +    +S+  NS N     N     N++ +
Sbjct: 2300 NNNNNNNSNNNSNNNSNSNSNSNSNNSNNNNINNNNSNNNNNNNN 2344



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 19/105 (18%), Positives = 41/105 (39%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N S   +  +  N     N ++   + +  N++N    N  ++   N+     NN N+  
Sbjct: 2252 NNSYNSNSNSNSNNNNNNNSNNNNNNNINNNNINNNNNNNNNNNNNNNNNNNNNNSNNNS 2311

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              N+    N    N+N   ++++  N+ N     N     N++ +
Sbjct: 2312 NNNSNSNSNSNSNNSNNNNINNNNSNNNNNNNNNNNNNNNNNNNN 2356



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 23/105 (21%), Positives = 39/105 (37%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++  ++ N +N     N ++       +NS N    N+ ++   N+     NN N+  
Sbjct: 2292 NNNNNNNNNNNNNNNSNNNSNNNSNSNSNSNSNNSNNNNINNNNSNNNNNNNNNNNNNNN 2351

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N N    + +  N  N     N  +  N S S
Sbjct: 2352 NNNNNNNNNNNNNNDNDNNNNDNNNNLNNSNLNNNNGSNINISSS 2396



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 20/101 (19%), Positives = 39/101 (38%)
 Frame = -2

Query: 629  SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            ++  ++ N +N     N ++   +    N+ N    + ++S   NS     NN N     
Sbjct: 2281 NNNINNNNNNNNNNNNNNNNNNNNNNSNNNSNNNSNSNSNSNSNNSNNNNINNNNSNNNN 2340

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
            NN    N    N N    +++  N+ N+    +     N+S
Sbjct: 2341 NNNNNNNNNNNNNNNNNNNNNNNNNDNDNNNNDNNNNLNNS 2381



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 22/107 (20%), Positives = 40/107 (37%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            + N ++  ++ N +N     N +S       +NS +    N +++   N+     NN N+
Sbjct: 2284 INNNNNNNNNNNNNNNNNNNNNNSNNNSNNNSNSNSNSNSNNSNNNNINNNNSNNNNNNN 2343

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                NN    N    N N     +D  N+ N     N     N+  +
Sbjct: 2344 NNNNNNNNNNNNNNNNNNNNNNDNDNNNNDNNNNLNNSNLNNNNGSN 2390



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 19/105 (18%), Positives = 42/105 (40%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++ ++  +  N     N +S   +    N++N    N  ++   N+     NN N+  
Sbjct: 2250 NNNNSYNSNSNSNSNNNNNNNS---NNNNNNNINNNNINNNNNNNNNNNNNNNNNNNNNN 2306

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    +    N+N    +++ +N+ N     N     N++ +
Sbjct: 2307 SNNNSNNNSNSNSNSNSNNSNNNNINNNNSNNNNNNNNNNNNNNN 2351



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 23/112 (20%), Positives = 44/112 (39%), Gaps = 1/112 (0%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRER-NVTHSGEQNSKGMPYNNKNDK 459
            NI++  ++ N +N     N ++   +    N+ N     N  +S   N      NN N+ 
Sbjct: 2283 NINNNNNNNNNNNNNNNNNNNNNNSNNNSNNNSNSNSNSNSNNSNNNNINNNNSNNNNNN 2342

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
               NN    N    N N    ++D  N+ N+       +  N++  +  ++S
Sbjct: 2343 NNNNNNNNNNNNNNNNNNNNNNNDNDNNNNDNNNNLNNSNLNNNNGSNINIS 2394



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 20/89 (22%), Positives = 36/89 (40%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N S+   + N ++ +   N ++   +    N+ N    N  ++   N+     NN ND  
Sbjct: 2309 NNSNNNSNSNSNSNSNNSNNNNINNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDND 2368

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
              NN    N    N N    S+  ++S+N
Sbjct: 2369 NNNNDNNNNLNNSNLNNNNGSNINISSSN 2397



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 21/110 (19%), Positives = 38/110 (34%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            Y    N +   ++ N  N     N ++   +    N+ N    N  ++   NS     NN
Sbjct: 2255 YNSNSNSNSNNNNNNNSNNNNNNNINNNNINNNNNNNNNNNNNNNNNNNNNNSNNNSNNN 2314

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N     N+    N    N N    +++  N+ N     N     N++ +
Sbjct: 2315 SNSNSNSNSNNSNNNNINNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNN 2364



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 21/115 (18%), Positives = 45/115 (39%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI++   + N +N     N ++        N+ N    N  ++   NS     N+ N+ +
Sbjct: 2278 NINNNNINNNNNNNNNNNNNNN------NNNNNNNSNNNSNNNSNSNSNSNSNNSNNNNI 2331

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
              NN    N    N N    +++  N+ N     +     N + + + + +L ++
Sbjct: 2332 NNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNDNNNNDNNNNLNNSNLNNN 2386



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 20/102 (19%), Positives = 39/102 (38%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            ++ N ++ +   N ++   +   +N+ N    N  ++   N+     NN N+    NN  
Sbjct: 2313 NNSNSNSNSNSNNSNNNNINNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNDNNNN 2372

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVF 312
              N    N+NL   +   +N ++      G  K       VF
Sbjct: 2373 DNNNNLNNSNLNNNNGSNINISSSNNILGGMPKLREEIKNVF 2414



>gb:AC117081_1207906 Dictyostelium discoideum chromosome 2 map
           5862124-6045772 strain AX4, complete sequence.
          Length = 659

 Score = 42.4 bits (98), Expect = 0.020
 Identities = 23/114 (20%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = -2

Query: 671 VVHSIK-PYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQN 495
           ++HS   P   +  I++  +  N +N     N ++F  +    N++N    N  ++   N
Sbjct: 45  IIHSTSSPVNYLSQINNSNNSNNSNNSNNSNNSNNFN-NNSNNNNINNNNINNNYNANNN 103

Query: 494 SKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           +  +  +N N+ +  NN    N    N N    +++  N+ N +   N   + N
Sbjct: 104 NNNINNSNSNNNINNNNNNINNNNNNNNNNNNNNNNNNNNNNNYNNINNNQQNN 157



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 25/111 (22%), Positives = 46/111 (41%), Gaps = 8/111 (7%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++ ++  N +N     N +         N++N    N+ ++   N+     NN N+  
Sbjct: 93  NINNNYNANNNNNNINNSNSN---------NNINNNNNNINNNNNNNNNNNNNNNNNNN- 142

Query: 455 MKNNFRKGNRRKYNTNLER-----LSSDKVN---SANEFRRQNGKTKYNHS 327
             NN+   N  + N  L++      SSD ++   ++      N   KYN S
Sbjct: 143 NNNNYNNINNNQQNNQLQQQKINNTSSDNISNLITSLSNNINNSNNKYNGS 193



>gb:PFMAL8P1_1192079 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1172

 Score = 42.4 bits (98), Expect = 0.020
 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 6/113 (5%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            +N  D  D+ N+DN    +N ++   D  K N+ N    N  ++   N+     NN N+K
Sbjct: 721  DNNDDNNDNNNDDNNDNNKNNNN---DNNKNNNNNNNNNNNNNNNNNNNNNNNNNNDNNK 777

Query: 458  VMKN---NFRKGNRRKYNTNLERLSSDKVN---SANEFRRQNGKTKYNHSKSA 318
               +   N+   N+   N N+++    K+N   + N+  +  G  ++  SKSA
Sbjct: 778  QNIDNICNYNISNKNPQNENVKKKYPQKINKIVNPNQSTQLYGIIEFYDSKSA 830



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 27/120 (22%), Positives = 49/120 (40%), Gaps = 2/120 (1%)
 Frame = -2

Query: 629  SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            +D  DD N++N            D    N  N  + N  ++   N+     NN N+    
Sbjct: 720  NDNNDDNNDNNND----------DNNDNNKNNNNDNNKNNNNNNNNNNNNNNNNNNNNNN 769

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVF--DMSLQSDGSYEF 276
            NN    N++    N++ + +  +++ N  + +N K KY    + +   + S Q  G  EF
Sbjct: 770  NNNNDNNKQ----NIDNICNYNISNKNP-QNENVKKKYPQKINKIVNPNQSTQLYGIIEF 824



>gb:PFMAL13_1191660 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1792

 Score = 42.4 bits (98), Expect = 0.020
 Identities = 27/113 (23%), Positives = 47/113 (41%), Gaps = 13/113 (11%)
 Frame = -2

Query: 668  VHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERN---------- 519
            + S K   K +NI+D  +D N DN     N ++ + +    N  N    N          
Sbjct: 861  IKSSKKDKKKDNINDNNNDNNNDNNNDNNNDNNNDNNNDNNNDNNNNNNNNNNNNNNNNN 920

Query: 518  ---VTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
                 H+  +N++G   N +  K     +RK ++   + N E++  D +NS N
Sbjct: 921  NNHNNHNDNKNNQGDSKNEQEKKKKTRQYRKKSKITNDDNNEKIKQDNINSNN 973



 Score = 40.4 bits (93), Expect = 0.075
 Identities = 24/107 (22%), Positives = 47/107 (43%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            +ENI+ G     +  +TL  N  + + D +K++  ++++ N+  +   N+     +N ND
Sbjct: 833  IENITKGKKKGRKKKQTLENNGDNIKED-IKSSKKDKKKDNINDNNNDNNNDNNNDNNND 891

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                NN    N    N N    +++  N+ N     + K     SK+
Sbjct: 892  NNNDNNNDNNNDNNNNNNNNNNNNNNNNNNNHNNHNDNKNNQGDSKN 938



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 27/121 (22%), Positives = 48/121 (39%), Gaps = 16/121 (13%)
 Frame = -2

Query: 641  VENISDGFDD----------------ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTH 510
            + NI+ GF++                +N +N T G+ K   +  T++ N  N +E ++  
Sbjct: 805  INNINSGFNNIIKNMSIDDNTIRSIMDNIENITKGKKKGRKKKQTLENNGDNIKE-DIKS 863

Query: 509  SGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
            S +   K    +N ND    NN    N    + N +  + +  N+ N     N     NH
Sbjct: 864  SKKDKKKDNINDNNNDNNNDNNNDNNNDNNNDNNNDNNNDNNNNNNNNNNNNNNNNNNNH 923

Query: 329  S 327
            +
Sbjct: 924  N 924



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 21/102 (20%), Positives = 40/102 (39%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            K + + +  D+  ED ++  ++K     D +  N+ +    N   +   N+     +N N
Sbjct: 846  KKQTLENNGDNIKEDIKSSKKDKKK---DNINDNNNDNNNDNNNDNNNDNNNDNNNDNNN 902

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
            D    NN    N    N N     +D  N+  + + +  K K
Sbjct: 903  DNNNNNNNNNNNNNNNNNNNHNNHNDNKNNQGDSKNEQEKKK 944



>gb:AC117267_1208054 Dictyostelium discoideum chromosome 2 map
           5836255-5862024 strain AX4, complete sequence.
          Length = 361

 Score = 42.0 bits (97), Expect = 0.026
 Identities = 21/84 (25%), Positives = 36/84 (42%)
 Frame = -2

Query: 554 VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS 375
           V  N+ N    N  ++   N+     NN N+    NN    N    N N   ++ +K N+
Sbjct: 90  VNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFNINQNKTNN 149

Query: 374 ANEFRRQNGKTKYNHSKSAVFDMS 303
            N+ +      K+N++ +  FD S
Sbjct: 150 QNQNQNHLNCNKFNNNNNYYFDFS 173



>gb:AC117075_1207755 Dictyostelium discoideum chromosome 2 map
           5201047-5455781 strain AX4, complete sequence.
          Length = 2388

 Score = 42.0 bits (97), Expect = 0.026
 Identities = 25/100 (25%), Positives = 36/100 (36%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           S   D E  +N T   N +S    T  T + N    N  ++   NS     NN N+    
Sbjct: 312 SSSIDFEEMNNLTNSNNSNSTATTTTTTTTNNNNNNNTNNNNNNNSNNNNNNNNNNNNTN 371

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
           NN    N    N N    +++  N+ N     N     N+
Sbjct: 372 NNTNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNISNN 411



 Score = 39.3 bits (90), Expect = 0.17
 Identities = 23/97 (23%), Positives = 36/97 (37%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           D  E N     N S+    T  T + N    N T++   N+     NN N+    NN   
Sbjct: 316 DFEEMNNLTNSNNSNSTATTTTTTTTNNNNNNNTNNNNNNNSNNNNNNNNNNNNTNNNTN 375

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
            N    N N    +++  N+ N     N     +++K
Sbjct: 376 NNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNISNNK 412



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 23/99 (23%), Positives = 38/99 (38%), Gaps = 5/99 (5%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           + N +N T   N ++   +    N+ N    N  ++   N+     NN N+    NN   
Sbjct: 342 NNNNNNNTNNNNNNNSNNNNNNNNNNNNTNNNTNNNNNNNNNN---NNNNNNNNNNNNNN 398

Query: 434 GNRRKYNTNLERLSSDKVNSANEFR-----RQNGKTKYN 333
            N    N N+     +K+N+ N  +       N K K N
Sbjct: 399 NNNSNNNNNISNNKINKINNNNNNKELIDNNNNNKDKEN 437



>gb:AC116979_1207104 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 828

 Score = 42.0 bits (97), Expect = 0.026
 Identities = 28/118 (23%), Positives = 49/118 (41%)
 Frame = -2

Query: 653 PYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYN 474
           P+ K++NI++  +  N++    G N ++   +    N+ N    NV  S   N+     N
Sbjct: 181 PHIKIDNINNNSNHNNQN----GNNNNNNNNNNNNNNNNNNNNNNVDDSKTNNNN----N 232

Query: 473 NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSL 300
           N N+    NN    N    N N    +++  N+ N     N     +  KS + +M L
Sbjct: 233 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSLDEGKSKLKNMCL 290



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 24/103 (23%), Positives = 44/103 (42%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           ++ F DE+ +N       S+    +   NS+N    N  ++   N+     NN N+ V  
Sbjct: 124 NNNFTDESPNNY------SNCVIASTPLNSINNNNNNNNNNNNNNNN----NNNNNFVYS 173

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           +N        YN N+  +  D +N+ +    QNG    N++ +
Sbjct: 174 HN--------YNNNIPHIKIDNINNNSNHNNQNGNNNNNNNNN 208



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 23/99 (23%), Positives = 36/99 (36%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI +   + N DN     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 734  NIGNNNINNNNDNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN----NNNNNNN 789

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
              NN    N   YN N   ++ D   + N     N   K
Sbjct: 790  NNNNNNNNNNINYNNNNNNIAIDNNINYNNINFINNSKK 828



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 19/80 (23%), Positives = 32/80 (40%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           N +N  +G N  +   D    N++N    N  ++   N+     NN N+    NN    N
Sbjct: 729 NNNNNNIGNNNINNNND----NNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 784

Query: 428 RRKYNTNLERLSSDKVNSAN 369
               N N    +++ +N  N
Sbjct: 785 NNNNNNNNNNNNNNNINYNN 804



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 20/117 (17%), Positives = 45/117 (38%), Gaps = 6/117 (5%)
 Frame = -2

Query: 653 PYGKVENISDGFDDENEDNRTLGRNKSSFEWDT------VKTNSLNRRERNVTHSGEQNS 492
           P   + N ++  ++ N +N     N   +  +       +K +++N    +   +G  N+
Sbjct: 144 PLNSINNNNNNNNNNNNNNNNNNNNNFVYSHNYNNNIPHIKIDNINNNSNHNNQNGNNNN 203

Query: 491 KGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                NN N+    NN    + +  N N    +++  N+ N     N     N++ +
Sbjct: 204 NNNNNNNNNNNNNNNNNNVDDSKTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 260



>gb:AC115612_1205926 Dictyostelium discoideum chromosome 2 map
           6245135-6357017 strain AX4, complete sequence.
          Length = 598

 Score = 42.0 bits (97), Expect = 0.026
 Identities = 23/93 (24%), Positives = 34/93 (36%)
 Frame = -2

Query: 599 NRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRK 420
           N   G N ++    T   N+ N    N   +   NS     NN N+    NN   GN   
Sbjct: 466 NHINGNNTNTTTTTTTNNNNNNNSNNNSNSNSNSNSISNNSNNSNNNNSNNNSSNGNNNN 525

Query: 419 YNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N N    +++  N+ N     N     N+S +
Sbjct: 526 NNNNNNNNNNNSSNNMNNMNNSNNMNSMNNSNN 558



>gb:AY325173_1177842 Rattus norvegicus Aa2-050 mRNA, complete cds.
          Length = 628

 Score = 42.0 bits (97), Expect = 0.026
 Identities = 22/106 (20%), Positives = 46/106 (43%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           +N ++  ++ N ++ +   N SS    +   ++ N    N  +S   ++     NN N+K
Sbjct: 480 KNSNNNSNNNNSNSNSNNSNNSSNNSSSSNNSNSNNNSNNSNNSNNSSNNSSSSNNSNNK 539

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N++    +S+  N++N     N  +  N+S +
Sbjct: 540 NNSNNNNSNNNNNSNSSSSNNNSNSNNNSNSSSSNNNSSSNNNSNN 585



 Score = 41.2 bits (95), Expect = 0.044
 Identities = 26/106 (24%), Positives = 42/106 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S+     N ++     N SS    +  +NS N    N +++   NS     NN N   
Sbjct: 416 NNSNNSSSNNSNSNNSNSNNSSSNSTSNNSNSNNSNSNN-SNNNNNNSNNSNSNNSNSNS 474

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
             +N +  N    N N    S++  NS+N     N     N+S ++
Sbjct: 475 NNSNNKNSNNNSNNNNSNSNSNNSNNSSNNSSSSNNSNSNNNSNNS 520



 Score = 40.8 bits (94), Expect = 0.057
 Identities = 25/124 (20%), Positives = 50/124 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++   + + +N     N +S   ++   NS N+   N +++   NS     NN ++  
Sbjct: 446 NSNNSNSNNSNNNNNNSNNSNSNNSNSNSNNSNNKNSNNNSNNNNSNSNSNNSNNSSNNS 505

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
             +N    N    N+N    SS+  +S+N    +N     N + +   + S  ++ S   
Sbjct: 506 SSSNNSNSNNNSNNSNNSNNSSNNSSSSNNSNNKNNSNNNNSNNNNNSNSSSSNNNSNSN 565

Query: 275 QTEN 264
              N
Sbjct: 566 NNSN 569



 Score = 40.4 bits (93), Expect = 0.075
 Identities = 26/124 (20%), Positives = 51/124 (41%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N +S    +  +NS N    N + +   N+     +N N+  
Sbjct: 397 NNNNNSNNNNSNNNNSNNNNNSNNSSSNNSNSNNSNSNNSSSNSTSNNSNSNNSNSNNSN 456

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
             NN    N    N+N    +S+  NS N     N  +  N+S ++  + S  ++ +   
Sbjct: 457 NNNN-NSNNSNSNNSNSNSNNSNNKNSNNNSNNNNSNSNSNNSNNSSNNSSSSNNSNSNN 515

Query: 275 QTEN 264
            + N
Sbjct: 516 NSNN 519



 Score = 39.7 bits (91), Expect = 0.13
 Identities = 28/122 (22%), Positives = 52/122 (42%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           S+  +  N  + +   N +S   ++  +N+ N    N ++S   NS     NNKN     
Sbjct: 428 SNNSNSNNSSSNSTSNNSNSNNSNSNNSNNNNNNSNN-SNSNNSNSNSNNSNNKNSNNNS 486

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQT 270
           NN    N    N+N    SS+  +S+N     N     N+S ++  + S  ++ + +  +
Sbjct: 487 NN----NNSNSNSNNSNNSSNNSSSSNNSNSNNNSNNSNNSNNSSNNSSSSNNSNNKNNS 542

Query: 269 EN 264
            N
Sbjct: 543 NN 544



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 23/99 (23%), Positives = 40/99 (40%), Gaps = 1/99 (1%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           + N +N     N +S   ++   N+ N    N ++S   NS     N+ ++    NN   
Sbjct: 393 NSNSNNNNNSNNNNSNNNNSNNNNNSNNSSSNNSNSNNSNSNNSSSNSTSNNSNSNNSNS 452

Query: 434 GNRRKYNTNLERLSSDKVNS-ANEFRRQNGKTKYNHSKS 321
            N    N N    +S+  NS +N    +N     N++ S
Sbjct: 453 NNSNNNNNNSNNSNSNNSNSNSNNSNNKNSNNNSNNNNS 491



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 22/103 (21%), Positives = 41/103 (39%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           S+  +  N  N +   N S+   ++  +N+ N    N + S   N+K    NN ++    
Sbjct: 493 SNSNNSNNSSNNSSSSNNSNSNNNSNNSNNSNNSSNNSSSSNNSNNKNNSNNNNSNNNNN 552

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           +N    N    + N    SS   NS++     N     ++S +
Sbjct: 553 SNSSSSNNNSNSNNNSNSSSSNNNSSSNNNSNNNSNNNSNSNN 595



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 23/94 (24%), Positives = 34/94 (36%)
 Frame = -2

Query: 599 NRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRK 420
           N     N +S   ++   NS N    N + S   NS     NN +     NN    N   
Sbjct: 393 NSNSNNNNNSNNNNSNNNNSNNNNNSNNSSSNNSNSNNSNSNNSSSNSTSNNSNSNNSNS 452

Query: 419 YNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
            N+N    +S+  NS N     N     N + ++
Sbjct: 453 NNSNNNNNNSNNSNSNNSNSNSNNSNNKNSNNNS 486



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 23/105 (21%), Positives = 39/105 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S+  +  N  N     + S+   ++   +S +    +  +S   N+     NN +   
Sbjct: 475 NNSNNKNSNNNSNNNNSNSNSNNSNNSSNNSSSSNNSNSNNNSNNSNNSNNSSNNSSSSN 534

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    SS   N++N     N  +  N+S S
Sbjct: 535 NSNNKNNSNNNNSNNNNNSNSSSSNNNSNSNNNSNSSSSNNNSSS 579



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 26/129 (20%), Positives = 46/129 (35%), Gaps = 5/129 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNK-----SSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
           N ++   + +  N     NK     S+       +N+ N    N + S   NS     N+
Sbjct: 461 NSNNSNSNNSNSNSNNSNNKNSNNNSNNNNSNSNSNNSNNSSNNSSSSNNSNSNNNSNNS 520

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
            N     NN    N      N    +S+  N++N     N     N+S S+  + +  S+
Sbjct: 521 NNSNNSSNNSSSSNNSNNKNNSNNNNSNNNNNSNSSSSNNNSNSNNNSNSSSSNNNSSSN 580

Query: 290 GSYEFQTEN 264
            +    + N
Sbjct: 581 NNSNNNSNN 589



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 22/102 (21%), Positives = 37/102 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S+     N  N     N S+   ++   +S +    N  +S   NS     NN N   
Sbjct: 500 NSSNNSSSSNNSNSNNNSNNSNNSNNSSNNSSSSNNSNNKNNSNNNNSNNN--NNSNSSS 557

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             NN    N    +++    SS+  ++ N     N    ++H
Sbjct: 558 SNNNSNSNNNSNSSSSNNNSSSNNNSNNNSNNNSNSNNHHHH 599



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 22/105 (20%), Positives = 39/105 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S      N ++     N S+   +    ++ N    N  +S  +NS     NN N   
Sbjct: 435 NSSSNSTSNNSNSNNSNSNNSNNNNNNSNNSNSNNSNSNSNNSNNKNSNNNS-NNNNSNS 493

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    +    ++N    +++  NS N     N  +  N+S +
Sbjct: 494 NSNNSNNSSNNSSSSNNSNSNNNSNNSNNSNNSSNNSSSSNNSNN 538



>gb:AC116977_1207007 Dictyostelium discoideum chromosome 2 map
            5515173-5817331 strain AX4, complete sequence.
          Length = 1123

 Score = 41.6 bits (96), Expect = 0.034
 Identities = 24/131 (18%), Positives = 50/131 (38%), Gaps = 2/131 (1%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            Y    N ++  ++ N +N     N ++   ++   N+ N    N+ ++   ++  M  NN
Sbjct: 847  YNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNNNNNNNNNNINNNNSNSNNNMNSNN 906

Query: 470  KNDKV--MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQ 297
             N+ +  + NN    N    N N    +++  N+ N     N     N++  +       
Sbjct: 907  NNNNINNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNNCNNNNNGGSNIHSLNN 966

Query: 296  SDGSYEFQTEN 264
            S  S  +   N
Sbjct: 967  SSNSVNYNNNN 977



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 22/105 (20%), Positives = 41/105 (39%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI++   + N +N     N ++   +    N+ N    N  +S   N+     NN N+ +
Sbjct: 834  NITNNNYNNNNNNYNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNNNN--NNNNNNI 891

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N N   +++   N+ N     N     N++ +
Sbjct: 892  NNNNSNSNNNMNSNNNNNNINNINNNNNNNNNNNNNNNNNNNNNN 936



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 23/101 (22%), Positives = 37/101 (36%), Gaps = 3/101 (2%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            ++ +  N  +  N ++   + +  N+ N    N  ++   N+     NN N     NN  
Sbjct: 893  NNNSNSNNNMNSNNNNNNINNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNNCN 952

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQN---GKTKYNHSK 324
              N    N +    SS+ VN  N     N    K K N  K
Sbjct: 953  NNNNGGSNIHSLNNSSNSVNYNNNNNNNNNNINKDKKNKKK 993



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/87 (25%), Positives = 34/87 (39%)
 Frame = -2

Query: 581  NKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLE 402
            N  S  W  +  N +N    N+T++   N+     NN N+    NN    N    N N  
Sbjct: 816  NNQSDYWSAI--NPINSSGTNITNNNYNNNNNNYNNNNNNNNNNNNNNNNNNNNNNNN-- 871

Query: 401  RLSSDKVNSANEFRRQNGKTKYNHSKS 321
              +++  NS N     N     N++ S
Sbjct: 872  --NNNNSNSNNNNNNNNNNNNINNNNS 896



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 23/95 (24%), Positives = 40/95 (42%)
 Frame = -2

Query: 560 DTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV 381
           D  KTN+   ++ N ++S + +S     NN N+    NN    N    N N    +++  
Sbjct: 634 DDSKTNTNKDKDNNNSNSNKDSSN----NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 689

Query: 380 NSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
           N+ N     N     N+++       L + GS +F
Sbjct: 690 NNNNNNNNNNNNNNINNNEDL-----LPNPGSSKF 719



>gb:AC116305_1206214 Dictyostelium discoideum chromosome 2 map
           1005175-1418323 strain AX4, complete sequence.
          Length = 942

 Score = 41.6 bits (96), Expect = 0.034
 Identities = 23/104 (22%), Positives = 41/104 (39%)
 Frame = -2

Query: 632 ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
           ++ G ++ N +N     N ++        N+ N    N  H+   N+     NN N+   
Sbjct: 295 LNGGNNNHNNNNNNNNNNNNN--------NNNNNNNNNNNHNNHNNNNNNNNNNNNNNNN 346

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            NN    N    N N    +++  N+ N     N    YNH+++
Sbjct: 347 NNNNNNNNNNNNNNNNNNNNNNNNNNINNNNINNNNHNYNHNQN 390



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 22/105 (20%), Positives = 48/105 (45%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S+ +++ N ++     N +++ ++    N+      N  H  ++      +NN N+  
Sbjct: 699 NNSNNYNNGNSNSNNNRNNNNNYNYNNYINNNNYNNNNNRQHCDDEEEDEQYFNNNNNNN 758

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N R  +++ ++  SD  N+ N+    NG   YN++ +
Sbjct: 759 NNNN----NNRISDSSDDQYFSDDTNNNND-NYNNGNNNYNNNNN 798



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 24/105 (22%), Positives = 41/105 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 313 NNNNNNNNNNNNNNHNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 372

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           + NN    N   YN N     +   N+ N+   QN     N S S
Sbjct: 373 INNNNINNNNHNYNHNQNHNHNHNYNNNNQ-NNQNNNNDDNFSPS 416



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 4/103 (3%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK----VMK 450
            DDE ED +    N ++   +    N ++    +   S + N+    YNN N+        
Sbjct: 742  DDEEEDEQYFNNNNNNN--NNNNNNRISDSSDDQYFSDDTNNNNDNYNNGNNNYNNNNNN 799

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            NNF       YN N    +++  N+ N +   NG   +N++ +
Sbjct: 800  NNFNNNYMNNYNNN---YNNNNYNNNNSYNNSNGNNNFNNNNN 839



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 32/126 (25%), Positives = 43/126 (34%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           ++N S G     E      +N  +F     K N+++   +NV H    N+     NN N+
Sbjct: 584 LKNSSSGLTPILESLNVKQQNNINF----FKNNNMDNNNKNVPHLSLSNNNNNNNNNNNN 639

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSY 282
               NN    N R  N N         N  N     N     N  K+  F  S  SD   
Sbjct: 640 NNNNNNNNNNNNRNRNNN---------NIYNNNNNNNNNNSNNRGKN--FSDSGSSDSDS 688

Query: 281 EFQTEN 264
           E    N
Sbjct: 689 ELNRHN 694



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 20/96 (20%), Positives = 37/96 (38%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           + N +N     N ++   +    N  N    N  ++   N+     NN N+    NN   
Sbjct: 303 NNNNNNNNNNNNNNNNNNNNNNNNHNNHNNNNNNNNNNNNNNNNNNNNNNNN--NNNNNN 360

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
            N    N N   ++++ +N+ N     N    +NH+
Sbjct: 361 NNNNNNNNNNNNINNNNINNNNHNYNHNQNHNHNHN 396



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/108 (20%), Positives = 43/108 (39%), Gaps = 3/108 (2%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N +N +  R K+  +  +  ++S   R  N  ++   N      N+ N++   NN+ 
Sbjct: 663 NNNNNNNNSNNRGKNFSDSGSSDSDSELNRHNNNNNNNSNNYNNGNSNSNNNRNNNNNYN 722

Query: 437 KGN---RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
             N      YN N  R   D      ++   N     N++ + + D S
Sbjct: 723 YNNYINNNNYNNNNNRQHCDDEEEDEQYFNNNNNNNNNNNNNRISDSS 770



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 3/104 (2%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSF--EWDTVKTNSLNRRERNVTHSGEQNSKG-MPYNNKN 465
           N ++  ++ N +N    RN ++     +    N+ N R +N + SG  +S   +  +N N
Sbjct: 637 NNNNNNNNNNNNNNNRNRNNNNIYNNNNNNNNNNSNNRGKNFSDSGSSDSDSELNRHNNN 696

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           +    NN+  GN    N+N  R +++  N  N     N     N
Sbjct: 697 NNNNSNNYNNGNS---NSNNNRNNNNNYNYNNYINNNNYNNNNN 737



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 21/111 (18%), Positives = 41/111 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N +    +    N+ N    N  ++   N+     NN N+  
Sbjct: 306 NNNNNNNNNNNNNNNNNNNNNHNNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 365

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
             NN    N    N N    + ++ ++ N     N +   N++    F  S
Sbjct: 366 NNNNNNNINNNNINNNNHNYNHNQNHNHNHNYNNNNQNNQNNNNDDNFSPS 416



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 26/113 (23%), Positives = 39/113 (34%), Gaps = 5/113 (4%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K +N  + F + N DN     NK+         N+ N    N  ++   N+     N  N
Sbjct: 601 KQQNNINFFKNNNMDNN----NKNVPHLSLSNNNNNNNNNNNNNNNNNNNNNNNNRNRNN 656

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK-----YNHSKS 321
           + +  NN    N    N       S   +S +E  R N         YN+  S
Sbjct: 657 NNIYNNNNNNNNNNSNNRGKNFSDSGSSDSDSELNRHNNNNNNNSNNYNNGNS 709



>gb:AE014186_938336 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014841_1229070 Plasmodium falciparum 3D7
           chromosome 11 section 6 of 8 of the complete sequence.
          Length = 679

 Score = 41.6 bits (96), Expect = 0.034
 Identities = 25/108 (23%), Positives = 43/108 (39%), Gaps = 1/108 (0%)
 Frame = -2

Query: 647 GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN- 471
           GKV N ++  D++N DN              V  N+  ++ R++ H  +        NN 
Sbjct: 162 GKVNNTNENVDEDNNDN--------------VDDNNTKKKHRHIKHKSQGTLSNDGSNNM 207

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
            N+ V  NN    N    N N   ++++ VN+ N           N++
Sbjct: 208 NNNNVNNNNVNNNNVNNNNVNNNNVNNNNVNNNNMINNNMNNNNMNNN 255



>gb:PFA929353_1393098 Plasmodium falciparum strain 3D7, chromosome
           5, segment 3/4.
          Length = 2488

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 1/106 (0%)
 Frame = -2

Query: 656 KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRE-RNVTHSGEQNSKGMP 480
           K  GK +N  +  + EN+DN+    NK +      K N  N+    N       N+KG  
Sbjct: 415 KEKGKKKNKDNKNNTENKDNKDNKDNKDNKNNTENKDNKDNKNNIDNKNDKENNNNKGNK 474

Query: 479 YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKT 342
            NN N   ++NN  KGN  K N N +  + +K N  N+ + ++  T
Sbjct: 475 ENNNNKGNIENNNNKGN--KENNNNKANTDNKNNKDNKEKDKSNIT 518



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 28/111 (25%), Positives = 50/111 (45%), Gaps = 4/111 (3%)
 Frame = -2

Query: 647 GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           G +EN ++  + EN +N+    NK++ +      +++   E+N +   +  +K    N K
Sbjct: 481 GNIENNNNKGNKENNNNKANTDNKNNKDNKEKDKSNITIIEKNASKGKKTKNKKTSQNKK 540

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVN----SANEFRRQNGKTKYNHS 327
           ND +  N        K   N+  +S   +N    S  E   QN K +YN+S
Sbjct: 541 ND-ICDN--------KEIININYISEQNINENHYSLKEKNMQNKKDEYNYS 582



>gb:AY220914_1310462 Dictyostelium discoideum ComB (comB) gene,
           complete cds.
          Length = 2107

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 23/118 (19%), Positives = 46/118 (38%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N +N     N ++   +    N+ N    N +++   N+  +  NN N+    NN  
Sbjct: 444 NNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNNTNSINNNNNNNNNNNNNNN 503

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
             N    N N   +S++  N+ N     N     N++ +     S  +  +    T+N
Sbjct: 504 NNNNNNNNNNNSSISNNNNNNNNNNNNNNNNNNNNNNNNNNSSSSNNNINNNNINTDN 561



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 21/109 (19%), Positives = 44/109 (40%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + N ++  ++ N +N     N ++    ++  N+ N    N  ++   N+     NN N+
Sbjct: 488 INNNNNNNNNNNNNNNNNNNNNNNNNNSSISNNNNNNNNNNNNNNNNNNNNN---NNNNN 544

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
               NN    N    + N    +++ +N+ N     N K   N S  ++
Sbjct: 545 SSSSNNNINNNNINTDNNSSNNNNNNMNNNNNNNSGNNKNDKNDSNGSI 593



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 18/105 (17%), Positives = 44/105 (41%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +  ++  N ++   +    N+ N    N  +S   N+     NN N+  
Sbjct: 473 NNNNNSNNNNNNTNSINNNNNNNNNNNNNNNNNNNNNNNNNNSSISNNNNNNNNNNNNNN 532

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    +++   ++++ +N+ N     N     N++ +
Sbjct: 533 NNNNNNNNNNNNSSSSNNNINNNNINTDNNSSNNNNNNMNNNNNN 577



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 21/106 (19%), Positives = 41/106 (38%), Gaps = 1/106 (0%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTL-GRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           NI++  +  N +N  +   N  +   ++    + N    N+ ++   N+     NN N+ 
Sbjct: 400 NINNNNNTNNTNNNNIINNNNININENSTSGINSNNSGNNINNNNNSNNNNNNNNNNNNN 459

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N N    +++  NS N     N     N++ +
Sbjct: 460 NNNNNNNNNNNNNNNNNNSNNNNNNTNSINNNNNNNNNNNNNNNNN 505



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 24/107 (22%), Positives = 43/107 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI +  +    +N T G N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 414 NIINNNNININENSTSGINSNNSGNNINNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNN- 472

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
             NN    N    NTN    +++  N+ N     N     N++ S++
Sbjct: 473 --NNNNNSNNNNNNTNSINNNNNNNNNNNNNNNNNNNNNNNNNNSSI 517



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/103 (21%), Positives = 39/103 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N  +   +    N+ N    N  ++   NS     NN N+  
Sbjct: 468 NNNNNNNNNNSNNNNNNTNSINNNNNNNNNNNNNNNNNNNNNNNNNNSSISNNNNNNNNN 527

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             NN    N    N N    S++ +N+ N     N     N++
Sbjct: 528 NNNNNNNNNNNNNNNNNSSSSNNNINNNNINTDNNSSNNNNNN 570



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 23/109 (21%), Positives = 42/109 (38%), Gaps = 4/109 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +++  N+ N    N  ++   N+     NN N  +
Sbjct: 461 NNNNNNNNNNNNNNNNNSNNNNNNTNSINNNNNNNNNNNNNNNNNNNNNN---NNNNSSI 517

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVN----SANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N    S N     N  T  N S +
Sbjct: 518 SNNNNNNNNNNNNNNNNNNNNNNNNNNSSSSNNNINNNNINTDNNSSNN 566



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/118 (17%), Positives = 42/118 (35%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N +N     N ++   +    N+ N    N       N+     NN N+    NN  
Sbjct: 452 NNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNNTNSINNNNNNNNNNNNNNNNNNNNNNN 511

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
             N    N N    +++  N+ N     N     + S + + + ++ +D +      N
Sbjct: 512 NNNSSISNNNNNNNNNNNNNNNNNNNNNNNNNNSSSSNNNINNNNINTDNNSSNNNNN 569



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 22/113 (19%), Positives = 39/113 (34%), Gaps = 7/113 (6%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           EN + G +  N  N     N S+   +    N+ N    N  ++   N+     NN N+ 
Sbjct: 425 ENSTSGINSNNSGNNINNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNN 484

Query: 458 -------VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                     NN    N    N N    ++  +++ N     N     N++ +
Sbjct: 485 TNSINNNNNNNNNNNNNNNNNNNNNNNNNNSSISNNNNNNNNNNNNNNNNNNN 537



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 21/117 (17%), Positives = 44/117 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     +N N+  
Sbjct: 465 NNNNNNNNNNNNNSNNNNNNTNSINNNNNNNNNNNNNNNNNNNNNNNNNNSSISNNNNNN 524

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
             NN    N    N N    SS   N+ N           N++ + + + +  + G+
Sbjct: 525 NNNNNNNNNNNNNNNNNNNNSSSSNNNINNNNINTDNNSSNNNNNNMNNNNNNNSGN 581



>gb:AF375997_1266712 Dictyostelium discoideum glycosyltransferase
           GnT51 (gntA) gene, complete cds.
          Length = 423

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 7/103 (6%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNS-------LNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           N D R+  R  +S E   ++ NS        N+   N+  + + N+     NN N+    
Sbjct: 250 NRDYRSTFRENNSLEIQKLEENSKKRWLILFNQNNNNINDNDDNNNNNNNNNNNNNNNNN 309

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           NN    N    N N    SS   N+ N     N  +  N++ +
Sbjct: 310 NNNNNNNNNNNNNNSSSSSSSSHNNNNNNNNNNNSSSTNNNNN 352



>gb:AC116979_1207090 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 980

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 34/155 (21%), Positives = 54/155 (34%)
 Frame = -2

Query: 728 PELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVK 549
           P++  S++D  S             P G + + +D     NE+N     N +S   +   
Sbjct: 505 PDIFSSDSDYKSQSSSYDSPTVPSSPMGSIYDENDFDTKINENNNNNNNNNNSNNNNNNN 564

Query: 548 TNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
            N+ N    N  ++   ++     NN N     NN    N    N N    S+       
Sbjct: 565 NNNNNNNNNNNNNNNNNSNNNNNNNNNNTNNNNNNNNNNNSNSNNNNSNSNSNISPQKKP 624

Query: 368 EFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
            F   N  T  N +  A   ++ QS   Y F + N
Sbjct: 625 TFEELNYITYLNMASRA--SLNSQSSSYYSFNSFN 657



>gb:AC116960_1206800 Dictyostelium discoideum chromosome 2 map
           complement(1004496-821614) strain AX4, complete
           sequence.
          Length = 423

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 25/103 (24%), Positives = 40/103 (38%), Gaps = 7/103 (6%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNS-------LNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           N D R+  R  +S E   ++ NS        N+   N+  + + N+     NN N+    
Sbjct: 250 NRDYRSTFRENNSLEIQKLEENSKKRLLILFNQNNNNINDNDDNNNNNNNNNNNNNNNNN 309

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           NN    N    N N    SS   N+ N     N  +  N++ +
Sbjct: 310 NNNNNNNNNNNNNNSSSSSSSSNNNNNNNNNNNNSSSTNNNNN 352



>gb:AC116956_1206511 Dictyostelium discoideum chromosome 2 map
           1418423-1684967 strain AX4, complete sequence.
          Length = 767

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 19/99 (19%), Positives = 42/99 (42%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N +N     N ++   +    N+ N    N  ++   N+     NN N    +NN  
Sbjct: 631 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNQNNNN 690

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N    NTN+   +++ +N+ N       + + N++++
Sbjct: 691 NQNNNNNNTNINNHNNNNINNQNNINNTQNENQNNNNQN 729



 Score = 41.2 bits (95), Expect = 0.044
 Identities = 23/118 (19%), Positives = 48/118 (40%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N++N     N ++   +    N+ N    N  ++   N+     NN N+    NN  
Sbjct: 609 NNNNQNNNNQNNNNNNQNNNQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 668

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
             N    N N    ++++ N+ N+    N     NH+ + + + +  ++   E Q  N
Sbjct: 669 NNNNNNNNNNNNNQNNNQNNNNNQNNNNNNTNINNHNNNNINNQNNINNTQNENQNNN 726



 Score = 39.3 bits (90), Expect = 0.17
 Identities = 21/94 (22%), Positives = 40/94 (42%)
 Frame = -2

Query: 602 DNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRR 423
           +NR L  N+++   +    N+ N  + N  ++   N+     NN N+    NN    N  
Sbjct: 600 NNRILPNNQNNNNQNNNNQNNNNNNQNNNQNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 659

Query: 422 KYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N N    +++  N+ N    QN     N++++
Sbjct: 660 NNNNNNNNNNNNNNNNNNNNNNQNNNQNNNNNQN 693



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 20/102 (19%), Positives = 40/102 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     N  N+  
Sbjct: 632 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNQNNNNN 691

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             NN    N   +N N     ++  N+ NE +  N +   N+
Sbjct: 692 QNNNNNNTNINNHNNNNINNQNNINNTQNENQNNNNQNDGNN 733



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 19/95 (20%), Positives = 38/95 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N   +  QN+     NN N+  
Sbjct: 641 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNQNNNNNQNNNNNNTN 700

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
           + N+       + N N  +  +   N+ N+   QN
Sbjct: 701 INNHNNNNINNQNNINNTQNENQNNNNQNDGNNQN 735



>gb:AC116551_1206341 Dictyostelium discoideum chromosome 2 map
           complement(581327-427576) strain AX4, complete sequence.
          Length = 868

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 24/110 (21%), Positives = 44/110 (40%)
 Frame = -2

Query: 650 YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
           Y    N ++  ++ N +N     N ++   +  K N+ N+   N  +    N+     NN
Sbjct: 99  YNIFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNKNKNNNNNNNYNNNNNNNNNNNN 158

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N+    NN    N R  N N    +++  N  NE  + N     N++ +
Sbjct: 159 NNNNNNNNNNNNNNNRINNINNNINNNNNNNRINEDNKNNNNNNNNNNNN 208



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 20/95 (21%), Positives = 38/95 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++  +  +  N+ N    N  ++   N+     NN N+K 
Sbjct: 74  NNNNNNNNNNNNNNNNNNNNNNNNFYNIFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKN 133

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
              N    N   YN N    +++  N+ N     N
Sbjct: 134 NNKNKNNNNNNNYNNNNNNNNNNNNNNNNNNNNNN 168



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 21/105 (20%), Positives = 42/105 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N  N    N  ++   N+     NN N+  
Sbjct: 67  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFYNIFNNNNNNNNNNNNNNNNNNNNNNNN 126

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN +  N+ K N N    +++  N+ N     N     N++ +
Sbjct: 127 NNNNNKNNNKNKNNNNNNNYNNNNNNNNNNNNNNNNNNNNNNNNN 171



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 20/105 (19%), Positives = 42/105 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N+ ++   N+     NN N+  
Sbjct: 62  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFYNIFNNNNNNNNNNNNNNNNNNN 121

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N +  N N    +++  N+ N     N     N++ +
Sbjct: 122 NNNNNNNNNNKNNNKNKNNNNNNNYNNNNNNNNNNNNNNNNNNNN 166



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 21/117 (17%), Positives = 43/117 (36%)
 Frame = -2

Query: 671 VVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNS 492
           ++     +G   N ++  ++ N +N     N ++   +    N+ N    N  ++   N 
Sbjct: 42  IIRKSNNFGNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFYNI 101

Query: 491 KGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                NN N+    NN    N    N N  + ++   N+ N     N     N++ +
Sbjct: 102 FNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNKNKNNNNNNNYNNNNNNNNNNNN 158



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 22/100 (22%), Positives = 39/100 (39%), Gaps = 5/100 (5%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N + +       N+ N    N  ++   N+     NNKN+  
Sbjct: 77  NNNNNNNNNNNNNNNNNNNNNFYNIFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNK 136

Query: 455 MKNN-----FRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
            KNN     +   N    N N    +++  N+ N   R N
Sbjct: 137 NKNNNNNNNYNNNNNNNNNNNNNNNNNNNNNNNNNNNRIN 176



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 24/121 (19%), Positives = 44/121 (36%), Gaps = 2/121 (1%)
 Frame = -2

Query: 620 FDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNF 441
           F    E    + R  ++F       N+ N    N  ++   N+     NN N+    NN 
Sbjct: 32  FYSNREGQEVIIRKSNNFGNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 91

Query: 440 RKGNRRKYN--TNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTE 267
              N   YN   N    +++  N+ N     N     N++K+   + +  ++ +Y     
Sbjct: 92  NNNNNNFYNIFNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNKNKNNNNNNNYNNNNN 151

Query: 266 N 264
           N
Sbjct: 152 N 152



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 20/105 (19%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+      N  ++   N+     NN N+  
Sbjct: 66  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNFYNIFNNNNNNNNNNNNNNNNNNNNNNN 125

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN  K N +  N N     ++  N+ N     N     N++ +
Sbjct: 126 NNNNNNKNNNKNKNNNNNNNYNNNNNNNNNNNNNNNNNNNNNNNN 170



>gb:AC116305_1206145 Dictyostelium discoideum chromosome 2 map
            1005175-1418323 strain AX4, complete sequence.
          Length = 1206

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 31/124 (25%), Positives = 53/124 (42%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            E  + G ++E+  N +  +  ++       +N  +  E +   S  Q S     NN ++ 
Sbjct: 694  ETSNQGSNNESSHNESSSQGSNNESAHNESSNQGSNNESSHNESSSQGSNNESSNNDSNN 753

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
               NN    N    N +   LSS+  +S NE   Q    + +HS+S+  + S QS  S E
Sbjct: 754  QNSNN-EPSNNESSNQSSNNLSSNNESSNNESSNQGSNNESSHSESSNNESSNQSLNS-E 811

Query: 278  FQTE 267
            +  E
Sbjct: 812  YNNE 815



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 26/110 (23%), Positives = 45/110 (40%), Gaps = 4/110 (3%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            E+ S G ++E+  N +  +  ++       ++  +  E +   S  QNS   P NN++  
Sbjct: 708  ESSSQGSNNESAHNESSNQGSNNESSHNESSSQGSNNESSNNDSNNQNSNNEPSNNESSN 767

Query: 458  VMKNNF----RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               NN        N    N      SS   +S NE   Q+  ++YN+  S
Sbjct: 768  QSSNNLSSNNESSNNESSNQGSNNESSHSESSNNESSNQSLNSEYNNEPS 817



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 25/125 (20%), Positives = 56/125 (44%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            E+ S G ++E+ +N +  ++ S++  +   +N+ +  + +   S  Q S     NN++  
Sbjct: 854  ESSSHGSNNESSNNESSSQDSSNYSSNNGSSNNESSSQGSNNESSNQGSNNESSNNESSS 913

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
               NN    +    N +    SS+  +S NE       +K ++++S+  + S Q   +  
Sbjct: 914  QGSNN-ESSHNEPSNQSSNNESSNNESSNNESSNNESSSKGSNNESSNNESSNQGSNNES 972

Query: 278  FQTEN 264
               E+
Sbjct: 973  SNNES 977



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 23/123 (18%), Positives = 58/123 (47%), Gaps = 5/123 (4%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            E+ S G ++E+ +N +  +N ++   +   ++  +  E +   S  Q S     NN+++ 
Sbjct: 1054 ESSSQGSNNESSNNESSNQNSNNESSNNESSSKGSNNESSNNESSSQGSNNESSNNESNN 1113

Query: 458  VMKNN---FRKGNRRKYNTNLERLSSDKVNSANEFRR--QNGKTKYNHSKSAVFDMSLQS 294
               NN    ++ +    + + E  S D+V+++    +  ++ ++     +S+ F+ S  S
Sbjct: 1114 QNSNNESSHKEESESNSHQSSETESKDQVSNSGSMNQSSESSESSSLSEQSSAFESSSSS 1173

Query: 293  DGS 285
             G+
Sbjct: 1174 SGN 1176



>gb:AC115612_1205953 Dictyostelium discoideum chromosome 2 map
           6245135-6357017 strain AX4, complete sequence.
          Length = 1173

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 25/122 (20%), Positives = 54/122 (44%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + N ++  ++ N +N +   N ++     +K N+ N    N  ++   N+     NN N+
Sbjct: 68  MNNNNNNNNNNNNNNNSNNNNNNNNSGYNIKNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 127

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSY 282
              KNN  K N    N N    +++  N+ N     + +  ++++     +  ++S  S+
Sbjct: 128 NNNKNNNNKNNNSDNNNNNNNNNNNNNNNINSLNIISSEGFFDNN-----ECFIESSLSF 182

Query: 281 EF 276
           EF
Sbjct: 183 EF 184



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 21/100 (21%), Positives = 44/100 (44%), Gaps = 1/100 (1%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNV-THSGEQNSKGMPYNNKNDKVM 453
           ++  ++ N +N  +  N ++   + +  N++N    N+ +++   N+ G   NN N   +
Sbjct: 461 NNSINNNNINNNNI--NNNNINNNNINNNNINSNGNNINSNNNNNNNNGNNNNNMNSNNI 518

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
            NN    N    N N+   +++ +NS       N   K N
Sbjct: 519 NNNNINNNSINNNNNINNNNNNNINSNGNNINNNNNNKNN 558



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 22/115 (19%), Positives = 45/115 (39%), Gaps = 2/115 (1%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           ++ +++ N +N     N ++   +    N  N    N  +    N      NN N  +  
Sbjct: 414 NNNYNNNNNNNNNNNNNNNNNNNNNYNNNDNNNNNMNSNNMNSNNINNNSINNNN--INN 471

Query: 449 NNFRKGNRRKYNTNLERLSSD--KVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
           NN    N    N N   ++S+   +NS N     NG    N + + + + ++ ++
Sbjct: 472 NNINNNNINNNNINNNNINSNGNNINSNNNNNNNNGNNNNNMNSNNINNNNINNN 526



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/113 (18%), Positives = 46/113 (40%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N     +  N ++   +    NS N    N +    +N+     NN N+    NN  
Sbjct: 59  NNNNNSGNNMNNNNNNNNNNNNNNNSNNNNNNNNSGYNIKNNNNNNNNNNNNNNNNNNNN 118

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
             N    N N  + +++K N+++     N     N++     ++ + S+G ++
Sbjct: 119 NNNNNNNNNNNNKNNNNKNNNSDNNNNNNNNNNNNNNNINSLNI-ISSEGFFD 170



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 24/107 (22%), Positives = 40/107 (37%), Gaps = 2/107 (1%)
 Frame = -2

Query: 641 VENISDGFDD--ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           V N++   +    N+  + +  N +S        N+ N    N   +   N+    YN K
Sbjct: 39  VNNVNSNINSLQSNKIEKCINNNNNSGNNMNNNNNNNNNNNNNNNSNNNNNNNNSGYNIK 98

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
           N+    NN    N    N N     ++  N+ N    +N   K N+S
Sbjct: 99  NNNNNNNNNNNNNNNNNNNN-----NNNNNNNNNNNNKNNNNKNNNS 140



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 22/99 (22%), Positives = 40/99 (40%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           ++  ++ N +N  +  N  +        N++N    N  ++G  N+  M  NN N+  + 
Sbjct: 466 NNNINNNNINNNNINNNNINNNNINSNGNNINSNNNNNNNNGNNNNN-MNSNNINNNNIN 524

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           NN    N    N N   ++S+  N  N    +N     N
Sbjct: 525 NNSINNNNNINNNNNNNINSNGNNINNNNNNKNNVNNVN 563



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 21/101 (20%), Positives = 35/101 (34%), Gaps = 5/101 (4%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN-----DKVMKNN 444
           N DN     N ++   + +  NS+N    N  +    N      NN N     + +  NN
Sbjct: 441 NNDNNNNNMNSNNMNSNNINNNSINNNNINNNNINNNNINNNNINNNNINSNGNNINSNN 500

Query: 443 FRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               N    N N+   + +  N  N     N     N++ +
Sbjct: 501 NNNNNNGNNNNNMNSNNINNNNINNNSINNNNNINNNNNNN 541



>gb:AC115598_1205790 Dictyostelium discoideum chromosome 2 map
           581427-735498 strain AX4, complete sequence.
          Length = 1693

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 24/94 (25%), Positives = 41/94 (43%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           E  D++T   N  S E      NS N  + +  ++   N+     NN N+    NN    
Sbjct: 688 EETDSKTDNCNDISMEDANSNNNSNNNNDNDNENNNNNNNNNNNNNNNNNNNNNNNNNNN 747

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
           N    N N    +++K  + NE  +Q+ K++ N+
Sbjct: 748 NNNNNNNNNNNNNNEKSENENEQSKQDTKSESNN 781



 Score = 40.0 bits (92), Expect = 0.098
 Identities = 25/100 (25%), Positives = 39/100 (39%), Gaps = 1/100 (1%)
 Frame = -2

Query: 644 KVENISD-GFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           K +N +D   +D N +N +   N +    D    N+ N    N  ++   N+     NN 
Sbjct: 693 KTDNCNDISMEDANSNNNSNNNNDN----DNENNNNNNNNNNNNNNNNNNNNNNNNNNNN 748

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNG 348
           N+    NN    N +  N N +     K  S N   + NG
Sbjct: 749 NNNNNNNNNNNNNEKSENENEQSKQDTKSESNNGTNKMNG 788



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 20/87 (22%), Positives = 36/87 (41%), Gaps = 2/87 (2%)
 Frame = -2

Query: 635  NISDGFDDENEDNR--TLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            NI +  +  N +N    +G N ++   +    N+ N    N  ++   N+    YNN N+
Sbjct: 1456 NIGNNININNNNNNFNNIGNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNYNNYNNNNN 1515

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKV 381
                NN+   N    N N+   S+  +
Sbjct: 1516 NNNNNNYNNNNNNNSNNNINNNSNTAI 1542



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 21/92 (22%), Positives = 38/92 (41%), Gaps = 5/92 (5%)
 Frame = -2

Query: 635  NISDGFDDENED---NRTLGRNKSSFE--WDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            NI + F++   +   N  +  N ++F    + +  N+ N    N  ++   N+     NN
Sbjct: 1445 NIDNNFNNNFNNIGNNININNNNNNFNNIGNNINNNNNNNNNNNNNNNNNNNNNNNNNNN 1504

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS 375
             N     NN    N   YN N    S++ +N+
Sbjct: 1505 NNYNNYNNNNNNNNNNNYNNNNNNNSNNNINN 1536



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 21/80 (26%), Positives = 31/80 (38%)
 Frame = -2

Query: 605  EDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNR 426
            E+   L  +KS    D    N+ N    N  ++   N+     NN N+    NN    N 
Sbjct: 1052 EEPMVLENDKSETNVDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1111

Query: 425  RKYNTNLERLSSDKVNSANE 366
               N N    +S+  NS N+
Sbjct: 1112 NNNNNNNNNSNSNSNNSNNK 1131



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 19/77 (24%), Positives = 32/77 (41%)
 Frame = -2

Query: 545  NSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANE 366
            N+ N    N+ ++   N+     NN N+    NN    N   YN N    +++  N+ N 
Sbjct: 1468 NNFNNIGNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNYNNYNNNNNNNNNNNYNNNNN 1527

Query: 365  FRRQNGKTKYNHSKSAV 315
                N     N+S +A+
Sbjct: 1528 NNSNNNIN--NNSNTAI 1542



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 24/96 (25%), Positives = 36/96 (37%)
 Frame = -2

Query: 566  EWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSD 387
            E D  +TN  N    N  ++   N+     NN N+    NN    N    N N     ++
Sbjct: 1058 ENDKSETNVDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN-----NN 1112

Query: 386  KVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
              N+ N     N     N +  A  DM+++  G  E
Sbjct: 1113 NNNNNNNNSNSNSNNSNNKNPIASGDMAIEVMGEKE 1148



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 25/115 (21%), Positives = 44/115 (38%), Gaps = 7/115 (6%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFE-------WDTVKTNSLNRRERNVTHSGEQNSKGM 483
            VE+I+   DD N  N T  ++   FE         T       R+E  +    +++   +
Sbjct: 1009 VESIAK--DDSNNINSTTIQDNEEFEIVIAPPSTTTTPPQISQRQEEPMVLENDKSETNV 1066

Query: 482  PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
              NN N+    NN    N    N N    +++  N+ N     N     N++ ++
Sbjct: 1067 DNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNS 1121



>gb:AE014187_938716 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014820_1227792 Plasmodium falciparum 3D7
           chromosome 14 section 5 of 13 of the complete sequence.
          Length = 1320

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 22/106 (20%), Positives = 45/106 (42%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           +NI+D ++++N DN     N ++   +    ++ N  + N   +   N+  +  N  N+ 
Sbjct: 293 DNINDNYNNDNHDNNNNNNNNNNNNDNMNDNHNNNNDDNNNDDNNNDNNNNINNNINNNN 352

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N N +  ++D  N+ N     N     N++ +
Sbjct: 353 NNINNNINNNNNNNNNNNDNNNNDNNNNNNNNNNNNNNNNNNNNNN 398



 Score = 40.0 bits (92), Expect = 0.098
 Identities = 22/106 (20%), Positives = 44/106 (41%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           +N++D  ++ N+DN     N  +   +    N++N    N+ ++   N+     NN N+ 
Sbjct: 318 DNMNDNHNNNNDDNNNDDNNNDN---NNNINNNINNNNNNINNNINNNNNNNNNNNDNNN 374

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 375 NDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNDNNNNNN 420



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 24/101 (23%), Positives = 37/101 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  D+ N DN     N ++   +    N+ N    N  +    N+     NN ND  
Sbjct: 365 NNNNNNDNNNNDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNDNNNNNNNDNN 424

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
             NN    N    N N    ++D V++ N     N     N
Sbjct: 425 NNNNDNNNNNNDNNNN----NNDNVDNNNNNNNNNNNVDNN 461



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 21/103 (20%), Positives = 40/103 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N  +  D+ N  N  +  N ++   + +  N+ N    N  ++ + N+     NN N+  
Sbjct: 333 NDDNNNDNNNNINNNINNNNNNIN-NNINNNNNNNNNNNDNNNNDNNNNNNNNNNNNNNN 391

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             NN    N    N +    ++D  N+ N     N     N++
Sbjct: 392 NNNNNNNNNNNNNNNDNNNNNNDNNNNNNNDNNNNNNDNNNNN 434



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 24/103 (23%), Positives = 38/103 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N  +  DD N DN     N  +   + +  N  N    N  ++   N+     NN N+  
Sbjct: 328 NDDNNNDDNNNDNNNNINNNINNNNNNINNNINNNNNNNNNNNDNNNNDN---NNNNNNN 384

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             NN    N    N N    ++D  N+ N+    N     N++
Sbjct: 385 NNNNNNNNNNNNNNNNNNNNNNDNNNNNNDNNNNNNNDNNNNN 427



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 20/94 (21%), Positives = 36/94 (38%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           N +N  +  N ++   +    N  N  + N  ++   N+     NN N+    NN    N
Sbjct: 349 NNNNNNINNNINNNNNNNNNNNDNNNNDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDN 408

Query: 428 RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
               N N    ++D  N+ N+    N     N++
Sbjct: 409 NNNNNDNNNNNNNDNNNNNNDNNNNNNDNNNNNN 442



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 22/105 (20%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN ND  
Sbjct: 354 NINNNINNNNNNNNNNNDNNNNDNNNNNNNNNNNNNNNNNNNNNNNNNN----NNNNDNN 409

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N  N     N     N++ +
Sbjct: 410 NNNNDNNNNNNNDNNNNNNDNNNNNNDNNNNNNDNVDNNNNNNNN 454



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/99 (21%), Positives = 35/99 (35%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           D+ N+DN     N  +   +    N  N    N  ++   N      NN N+    NN  
Sbjct: 330 DNNNDDNNNDNNNNINNNINNNNNNINNNINNNNNNNNNNNDNNNNDNNNNNNNNNNNNN 389

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N    N N    +++  N+ N     N     N++ +
Sbjct: 390 NNNNNNNNNNNNNNNNNDNNNNNNDNNNNNNNDNNNNNN 428



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 21/106 (19%), Positives = 42/106 (39%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           +N +D  +++N +N     N ++   +    N+ N    N  ++   N+     NN N+ 
Sbjct: 330 DNNNDDNNNDNNNNINNNINNNNNNINNNINNNNNNNNNNNDNNNNDNNNNNNNNNNNNN 389

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 390 NNNNNNNNNNNNNNNNNDNNNNNNDNNNNNNNDNNNNNNDNNNNNN 435



>gb:AE014186_938028 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014836_1228762 Plasmodium falciparum 3D7
           chromosome 11 section 1 of 8 of the complete sequence.
          Length = 1620

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 3/112 (2%)
 Frame = -2

Query: 659 IKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSG-EQNSKGM 483
           + PYG         ++ N++N+    NK++   D  K N  +   +N  +S   +N+K  
Sbjct: 350 MSPYGSTSQFCSMHNNNNKNNKYSDHNKNNKYSDHNKNNKYSDHNKNNKYSDHNKNNKYR 409

Query: 482 PYN-NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRR-QNGKTKYN 333
            +N NK     KN +R  N+ KY  + +   SD  N  N +    N K   N
Sbjct: 410 DHNKNKYRDHNKNKYRDHNKNKYRDHNKNKYSDHNNDNNYYNNYYNNKNNNN 461



>gb:AF429950_1270200 Plasmodium falciparum PDZ domain protein mRNA,
           complete cds.
          Length = 691

 Score = 40.8 bits (94), Expect = 0.057
 Identities = 45/203 (22%), Positives = 76/203 (37%), Gaps = 2/203 (0%)
 Frame = -2

Query: 971 KRMQMKKSKQLLKARLARERQIYEMRKRTELKAAISELERPWEMVEKAPTLFSVSADEQL 792
           K +  KK+K  L  R  +E+ I E           S    P++ +EK  T F        
Sbjct: 64  KLLNRKKNKHTLFYRSKKEKDIQE-----------SGYLYPFDHLEKKKTKFPPDP---- 108

Query: 791 KVLADRFQRPGGFDMWSEK-DGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFD 615
             +    ++    D++ +K +  +L+  E D  + ++F K   +      K EN  D  D
Sbjct: 109 -YIPSEDEKESSIDIFHDKINDDDLMIYEDDDDAKKYFGKTTFNKPNIIQKDENSEDDQD 167

Query: 614 DE-NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           D+ N+ N     N ++   D    NS +    N   +   NS   P NN  D    N+  
Sbjct: 168 DDLNDQNDDPINNPTNNLTDNPTNNSTDNPTNNSIDNPTNNSIDNPTNNSIDNPTNNSID 227

Query: 437 KGNRRKYNTNLERLSSDKVNSAN 369
                  +      + + +NS N
Sbjct: 228 NPTNNSIDNPTNNSTDNPINSPN 250



>gb:AC116921_1206420 Dictyostelium discoideum chromosome 2 map
           4624505-4657775 strain AX4, complete sequence.
          Length = 901

 Score = 40.8 bits (94), Expect = 0.057
 Identities = 23/90 (25%), Positives = 35/90 (38%)
 Frame = -2

Query: 647 GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           G   N SD   D++  N     N +SF  D+   N+ N    N   +   NS     NN 
Sbjct: 414 GSNNNFSDSDSDKDNYNNNNNTNNNSFNSDSDNYNNSNNNNSNSNSNSNSNSNSNSNNNN 473

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVN 378
           N+    NN    N    + N  + +++  N
Sbjct: 474 NNNNNSNNNNNNNNNNNSNNSNKSNNNFSN 503



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 25/105 (23%), Positives = 44/105 (41%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N   G N +  + D+ K N  N    N T++   NS    YNN N+  
Sbjct: 398 NNNNNNNNSNNNNNKSGSNNNFSDSDSDKDNYNN---NNNTNNNSFNSDSDNYNNSNNNN 454

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             +N    +    N+N    +++  N+ N     N     N S +
Sbjct: 455 SNSNSNSNSNSNSNSNNNNNNNNNSNNNNNNNNNNNSNNSNKSNN 499



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 29/120 (24%), Positives = 49/120 (40%), Gaps = 1/120 (0%)
 Frame = -2

Query: 674 GVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQN 495
           G    +K Y    N S+  ++ +  +R    N +S   D    N+ N    N  ++   N
Sbjct: 168 GNERKMKGYDYGNNNSN--NNYSSSSRDYNSNNNSSPRDYNNNNNNNNNNNNNNNNNSNN 225

Query: 494 SKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK-YNHSKSA 318
           +    YNN  D    N     + R  N+N  R SS +     +F   N   + YN+S+++
Sbjct: 226 NSPRDYNNSRDYNNNNTNNNSSPRDSNSNNNRNSSSR-----DFSNNNSSPRDYNNSRNS 280



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 25/113 (22%), Positives = 43/113 (38%), Gaps = 4/113 (3%)
 Frame = -2

Query: 662 SIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWD----TVKTNSLNRRERNVTHSGEQN 495
           S+K      +I +G DD+  ++        S+E+D       TN        + +    N
Sbjct: 576 SMKSIINTRDIGEGDDDDEINSVPFKCTLCSYEYDEENNNENTNGFIDEADKIYNRSNNN 635

Query: 494 SKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY 336
           +     NN N+    NN    N    N N    +S+  N+ N + ++  K  Y
Sbjct: 636 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNNNNNFYDKKYFKNNY 688



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 25/123 (20%), Positives = 49/123 (39%), Gaps = 6/123 (4%)
 Frame = -2

Query: 671 VVHSIKPYGKVENISD--GFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ 498
           +V+ + P   + ++++    DD N +N     N           N+ N    N  +S   
Sbjct: 361 IVNKLPPVQSLVDLTEIEMIDDNNNNNNNNNNN-----------NNNNNNNNNNNNSNNN 409

Query: 497 NSKGMPYNN----KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
           N+K    NN     +DK   NN    N   +N++ +  ++   N++N     N  +  N 
Sbjct: 410 NNKSGSNNNFSDSDSDKDNYNNNNNTNNNSFNSDSDNYNNSNNNNSNSNSNSNSNSNSNS 469

Query: 329 SKS 321
           + +
Sbjct: 470 NNN 472



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 27/122 (22%), Positives = 47/122 (38%), Gaps = 6/122 (4%)
 Frame = -2

Query: 668 VHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSK 489
           V S+    ++E I D  ++ N +N     N ++   +    N+ N+   N   S   + K
Sbjct: 368 VQSLVDLTEIEMIDDN-NNNNNNNNNNNNNNNNNNNNNNSNNNNNKSGSNNNFSDSDSDK 426

Query: 488 GMPYNNKND------KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
              YNN N+          +N+   N    N+N    S+   NS N     N     N++
Sbjct: 427 D-NYNNNNNTNNNSFNSDSDNYNNSNNNNSNSNSNSNSNSNSNSNNNNNNNNNSNNNNNN 485

Query: 326 KS 321
            +
Sbjct: 486 NN 487



>gb:AC116305_1206155 Dictyostelium discoideum chromosome 2 map
           1005175-1418323 strain AX4, complete sequence.
          Length = 1259

 Score = 40.8 bits (94), Expect = 0.057
 Identities = 28/95 (29%), Positives = 45/95 (47%)
 Frame = -2

Query: 659 IKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
           IKP  +  N S+  ++ N D+  L  N ++   D  K N  N    N  +S + N+    
Sbjct: 7   IKPKQQQNNFSN--NNNNNDSTQLNNNNNNNNNDKKKQNISNNNNNNNNNSTQLNNNNNN 64

Query: 479 YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS 375
            NN N+    NN    N +K NT    ++++K+NS
Sbjct: 65  NNNNNNN---NNNNNNNNKKQNT----INNNKINS 92



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 21/90 (23%), Positives = 33/90 (36%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           EN  N T     ++   +   TN+ N    N  ++   N+     NN N+    NN    
Sbjct: 533 ENNINNT--NTHANITTNNTSTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 590

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKT 342
           N    N N    +  K+   N  ++ N  T
Sbjct: 591 NNNNNNNNNSNSNKKKIKGKNN-KKSNDST 619



>gb:AC115684_1206035 Dictyostelium discoideum chromosome 2 map
           3108975-3191114 strain AX4, complete sequence.
          Length = 1364

 Score = 40.8 bits (94), Expect = 0.057
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 9/126 (7%)
 Frame = -2

Query: 626 DGFDDENEDNRTLGRNKSSFEWDTVKTNS------LNRRERNVTHSGEQNSKGMPYNNKN 465
           D  +   EDN   G N  + E++ + T+S      +NRR+R   ++   N++ +  NN N
Sbjct: 497 DDEEQNEEDNDEEGTNIPTSEYEDLDTSSASVISNINRRDRFKNNNINNNNQFVNSNNNN 556

Query: 464 DK---VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQS 294
           +K      NN   G+ R  N N    +++  N+ N     N     N++ + + + S  +
Sbjct: 557 NKYNTTNSNNSIVGSSRYINNN---NNNNNNNNNNNNNNNNNNNNNNNNNNYILNRSYST 613

Query: 293 DGSYEF 276
           +  Y F
Sbjct: 614 NKIYNF 619



>gb:AC115612_1205955 Dictyostelium discoideum chromosome 2 map
           6245135-6357017 strain AX4, complete sequence.
          Length = 302

 Score = 40.8 bits (94), Expect = 0.057
 Identities = 28/131 (21%), Positives = 49/131 (37%), Gaps = 7/131 (5%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++ + D N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 64  NNNNNYRDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNNNNNNNN 123

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQ-------NGKTKYNHSKSAVFDMSLQ 297
             NN    N    + N    ++D  N+ NE + +       N K   N  K    +  L+
Sbjct: 124 NNNNNNNNNNNNNDNNNNNNNNDNNNNNNENKNKYKNNYNNNNKNNNNQGKVETLNGFLR 183

Query: 296 SDGSYEFQTEN 264
             G    Q +N
Sbjct: 184 EHGLTSQQLKN 194



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 25/112 (22%), Positives = 45/112 (40%)
 Frame = -2

Query: 656 KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPY 477
           K   K+ N S+G +  N +N+    NK+++  +    N+ N    N   +   N+     
Sbjct: 24  KGNNKINNKSNGNNSINNNNKN-NNNKNNYNNNYRNNNNNNNNNNNYRDNNNNNN----- 77

Query: 476 NNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           NN N+    NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 78  NNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNNNNNNNNNNNNNN 129



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 21/99 (21%), Positives = 40/99 (40%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           D+E++ N    +  +     +   NS+N   +N  +    N+     NN N+    NN+R
Sbjct: 13  DEESDKNDKNNKGNNKINNKSNGNNSINNNNKNNNNKNNYNNNYRNNNNNNNN--NNNYR 70

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N    N N    +++  N+ N     N     N++ +
Sbjct: 71  DNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNN 109



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 24/107 (22%), Positives = 40/107 (37%), Gaps = 4/107 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N  +  ++ N +N     N ++   +    N+ N    N  ++   N+     NN ND  
Sbjct: 55  NYRNNNNNNNNNNNYRDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNN 114

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN----GKTKYNHS 327
             NN    N    N N    ++D  N+ N     N     K KY ++
Sbjct: 115 NNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNNNENKNKYKNN 161



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 21/115 (18%), Positives = 44/115 (38%)
 Frame = -2

Query: 665 HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
           +SI    K  N  + +++   +N     N +++  +    N+ N    N  ++   N+  
Sbjct: 37  NSINNNNKNNNNKNNYNNNYRNNNNNNNNNNNYRDNNNNNNNNNNNNNNNNNNNNNNNNN 96

Query: 485 MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN ++    NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 97  NNNNNNDNNNNNNNNDNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNN 151



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 25/105 (23%), Positives = 45/105 (42%), Gaps = 2/105 (1%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN--DKV 456
           SD  D  N+ N  +  NKS+   +++  N+ N   +N  ++  +N+     NN N  D  
Sbjct: 16  SDKNDKNNKGNNKIN-NKSNGN-NSINNNNKNNNNKNNYNNNYRNNNNNNNNNNNYRDNN 73

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N+ N+    N     N++ +
Sbjct: 74  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNNN 118



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 20/98 (20%), Positives = 36/98 (36%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+    NN  
Sbjct: 60  NNNNNNNNNYRDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNNNN 119

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
             N    N N    +++  N+ N     N     N +K
Sbjct: 120 NNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNNNENKNK 157



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 19/102 (18%), Positives = 36/102 (35%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++ + + N +N      + +   +    N+ N    N  ++   N+     NN N+  
Sbjct: 51  NYNNNYRNNNNNNNNNNNYRDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNN 110

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             NN    N    N N    +++  N  N     N     N+
Sbjct: 111 NDNNNNNNNNNNNNNNNNNNNNNNNNDNNNNNNNNDNNNNNN 152



>gb:AE014186_938202 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014839_1228936 Plasmodium falciparum 3D7
           chromosome 11 section 4 of 8 of the complete sequence.
          Length = 1617

 Score = 40.8 bits (94), Expect = 0.057
 Identities = 41/183 (22%), Positives = 70/183 (38%), Gaps = 37/183 (20%)
 Frame = -2

Query: 725 ELLKSEADLPSARFFPKGVVHSIKPYGKVENISDG-FDDENEDNRTLGRNKSSFEW-DTV 552
           E+LK+        ++ K   H  K  GK+  + D  +D+EN+D      N S   +   +
Sbjct: 4   EILKNNYKGNGENYYNKNKKHQKKNKGKINVLDDDEYDNENDDKNVDSANNSELCYLYEI 63

Query: 551 KTNSLNRRERN-VTHSGEQNSKGMPYNNK------------------------------- 468
             N  N+ E N +  S + N KG+ Y NK                               
Sbjct: 64  YKNGFNKEENNGIILSHKNNKKGLIYKNKINALYDNSKEMLHYRNQENEENDIFEEDIYE 123

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKT---KYNHSKSAVFDMSLQ 297
           ND    NNF +    +Y T     ++++ N  N + R N K     +N +K  +++    
Sbjct: 124 NDNFDDNNFVEEENVEYKT-YNSFTNEEANMLNNYSRVNIKNILDSHNINKRELYNKHNN 182

Query: 296 SDG 288
           ++G
Sbjct: 183 NNG 185



>gb:PFMAL4P3_1394838 Plasmodium falciparum MAL4P3.
          Length = 3370

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 39/173 (22%), Positives = 69/173 (39%)
 Frame = -2

Query: 797  QLKVLADRFQRPGGFDMWSEKDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGF 618
            +L  ++    R   F++ ++KD  E  K + D             +++   +  + +  +
Sbjct: 1942 ELDTVSSVLPREASFNLNNKKDNRERKKEKKDKEKEDVIIIKDTKNMEEENEYISFNVCY 2001

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            DD   + + L +N+SS   + V   +      N   +G  N  G    N N+ +  NN  
Sbjct: 2002 DDSVNNIKELIKNRSSHHKNGVDMYNGKLIISNNNINGNNNINGNNNINGNNNINGNNNI 2061

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
             GN    N N    SS+K NS N +   N   K NH+ + + +        YE
Sbjct: 2062 NGNNNNSNNN-NNSSSNKSNSNNIYSHSN---KINHNNNTLVNNVKNKTHMYE 2110



>gb:PFMAL1P2_1394314 Plasmodium falciparum DNA from MAL1P2.
          Length = 3063

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 29/109 (26%), Positives = 43/109 (39%), Gaps = 2/109 (1%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            Y K    +D  +D N DN     N    + +    N+ N    N+ +    N+     NN
Sbjct: 2011 YKKFGKNNDNDNDNNNDNNNDNNNNIDDDNNNENNNNNNDDNNNINNDDNNNNNNDDNNN 2070

Query: 470  KNDK--VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             NDK   M NNF  GN    N+N    S+   N+ +     +    Y+H
Sbjct: 2071 NNDKSNSMNNNF--GNYHNNNSN----SNSHYNNYHHNNNYHHNNNYHH 2113



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 41/166 (24%), Positives = 67/166 (40%), Gaps = 18/166 (10%)
 Frame = -2

Query: 668  VHSIKPYGKVENISDG-FDDENEDNRTLGRNKSSFEWDTVKTNSLNR-RERNVTHSGEQN 495
            V S K YG    ISD  F+  N +N     N + F     ++N +N+   + + H+   +
Sbjct: 2398 VVSYKSYGNKSGISDKYFNKHNNENNYKYSNNNYFN----QSNDMNKITNKYMNHNYSND 2453

Query: 494  SKGMPYNNKNDKVMK---------NNFRKGNRRKY------NTNLER-LSSDKVNSANEF 363
            +    YNN NDK            NN    NR KY      + N  +  + DK+N+ N  
Sbjct: 2454 NFKDNYNNSNDKKKNLHYFKKNKMNNTFNSNRNKYGIENYDDVNYPKDYNEDKMNNNNNN 2513

Query: 362  RRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN*ACKLSFRWLKML 225
             +   +  Y+      +      +G Y+F  EN   ++  R  K +
Sbjct: 2514 NKNRDRHNYHTGDRNNYYYHNHKNG-YDFGVENIPSQIKRRHRKYM 2558



>gb:PFA929356_1393323 Plasmodium falciparum strain 3D7, chromosome 9;
            segment 2/5.
          Length = 3069

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 27/109 (24%), Positives = 51/109 (46%), Gaps = 1/109 (0%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            Y K  N  +   + N++N T   NK++F+ +    N++N  + +  ++ + N+K    N+
Sbjct: 1303 YEKNNNTENNNKNNNKNNNTENNNKNNFD-NNNNNNNINNYDNHNINNCDNNNKNNYDNH 1361

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY-NHS 327
              +   KNNF   N    N N+    +  +N+ +     N K  Y NH+
Sbjct: 1362 NINNCDKNNFDNNN----NNNINNYDNHNINNCD----NNNKNNYDNHN 1402



>gb:DDU42597_1377340 Dictyostelium discoideum histidine kinase A
           (dhkA) mRNA, complete cds.
          Length = 2150

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 23/99 (23%), Positives = 39/99 (39%)
 Frame = -2

Query: 584 RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
           RNK   + +   +N+ N    N  ++   NS     NN N+    NN    N    N N 
Sbjct: 646 RNKDDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNN 705

Query: 404 ERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
              +++  N+ N     N    Y++  + +   + QS G
Sbjct: 706 NNNNNNNNNNNNNNNNNNNNNNYHNGATMMMSHNHQSIG 744



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 22/94 (23%), Positives = 33/94 (35%)
 Frame = -2

Query: 584 RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
           R ++  + D    NS N    N  ++   N+     NN N     NN    N    N N 
Sbjct: 644 RRRNKDDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNN 703

Query: 404 ERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
              +++  N+ N     N     N+   A   MS
Sbjct: 704 NNNNNNNNNNNNNNNNNNNNNNNNYHNGATMMMS 737



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/89 (23%), Positives = 33/89 (37%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           +DEN+ N     + +S   +    NS N    N  ++   N+     NN N+    NN  
Sbjct: 651 NDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNN 710

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQN 351
             N    N N    +++  N A      N
Sbjct: 711 NNNNNNNNNNNNNNNNNYHNGATMMMSHN 739



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 3/98 (3%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           D+N++N     N +S   +    N+ N    N  +S   N+     NN N+    NN   
Sbjct: 649 DDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNN 708

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKT---KYNH 330
            N    N N      +  N+ N     NG T    +NH
Sbjct: 709 NNNNNNNNN------NNNNNNNNNNYHNGATMMMSHNH 740



>gb:AC115598_1205782 Dictyostelium discoideum chromosome 2 map
           581427-735498 strain AX4, complete sequence.
          Length = 691

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 23/101 (22%), Positives = 39/101 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N+++  ++ N +N     N ++   +    N+ N    N  ++   NS  +  NN N   
Sbjct: 202 NVNNNNNNNNNNNNNNNNNNNNNNNNNNINNNNNNNNNNNNNNNNNNSNNININNNNHNN 261

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
             NN    N    N N    +   +N+ N     NG   YN
Sbjct: 262 NNNNNNNNNNSSNNNNNNNSNGININNNN---NNNGNNNYN 299



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 21/105 (20%), Positives = 41/105 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   + +  N  N    N  ++   N+     NN N+  
Sbjct: 172 NNNNSSNNNNINNNVNNNNNNNNNNNNINNNVNNNNNNNNNNNNNNNNNNN--NNNNNNN 229

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           + NN    N    N N    ++  +N+ N     N     N+S +
Sbjct: 230 INNNNNNNNNNNNNNNNNNSNNININNNNHNNNNNNNNNNNNSSN 274



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 21/107 (19%), Positives = 41/107 (38%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           V N ++  ++ N  N  +  N ++   +    N+ N    N  +    N+     NN N+
Sbjct: 186 VNNNNNNNNNNNNINNNVNNNNNNNNNNNNNNNNNNNNNNNNNNINNNNNNNNNNNNNNN 245

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               NN    N    N N    +++  ++ N     NG    N++ +
Sbjct: 246 NNNSNNININNNNHNNNNNNNNNNNNSSNNNNNNNSNGININNNNNN 292



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 19/109 (17%), Positives = 41/109 (37%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + N  +  ++ N +N  +  N ++        N+ N    N  ++   N+     NN N+
Sbjct: 182 INNNVNNNNNNNNNNNNINNNVNN------NNNNNNNNNNNNNNNNNNNNNNNNINNNNN 235

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
               NN    N    N N+   + +  N+ N     +     N++ + +
Sbjct: 236 NNNNNNNNNNNNNSNNININNNNHNNNNNNNNNNNNSSNNNNNNNSNGI 284



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 21/105 (20%), Positives = 41/105 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S+  +  N  N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 175 NSSNNNNINNNVNNNNNNNNNNNNINNNVNNNNNNNNNNNNNNNNNNNNNNNNNNINNNN 234

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N+N   ++++  N+ N     N  +  N++ +
Sbjct: 235 NNNNNNNNNNNNNNSNNININNNNHNNNNNNNNNNNNSSNNNNNN 279



>gb:AC115598_1205766 Dictyostelium discoideum chromosome 2 map
            581427-735498 strain AX4, complete sequence.
          Length = 1422

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 26/117 (22%), Positives = 48/117 (41%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            + NI++  ++ N +N     N ++ +      N  N +  N  ++G  ++ G+  NN N+
Sbjct: 1212 INNINNNSNNNNNNN-----NSNNHQNSNNNNNGNNHQNNNNNNNGNNSNNGIINNNNNN 1266

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
                NN    N    N N      +  N+ N     N     N +K+   D+S+  D
Sbjct: 1267 NNNNNNNNNNNNNNNNNN------NNNNNNNNNNNNNNNNINNKNKNYASDVSMNID 1317



 Score = 40.4 bits (93), Expect = 0.075
 Identities = 26/142 (18%), Positives = 55/142 (38%)
 Frame = -2

Query: 698 PSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERN 519
           P+     +  V++      + N+S   +  N +N     N ++   +    N+ N    N
Sbjct: 343 PANHLNHQACVNNTNTMNNMNNMSINNNGNNNNNNNNNNNSNNNNNNNSNNNNNNNSNNN 402

Query: 518 VTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
             ++   N+     NN N+    NN    N    N N    +++  N+ N     N    
Sbjct: 403 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 462

Query: 338 YNHSKSAVFDMSLQSDGSYEFQ 273
            N++ +   + +  ++G+ E+Q
Sbjct: 463 INNNNN---NNNKNNNGNGEYQ 481



 Score = 40.0 bits (92), Expect = 0.098
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 3/106 (2%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPY---NNKN 465
            N ++  ++ N +N  +  N ++   ++   N  N    N  HS  +N K   +   NN N
Sbjct: 1145 NNNNNNNNNNNNNNNINNNNNNNNNNSNYNNYSNNNHSNNNHSSSKNFKNSHHNNINNNN 1204

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
            +  + NN    N    N N    S++  NS N     N +   N++
Sbjct: 1205 NNNINNNINNINNNSNNNNNNNNSNNHQNSNNNNNGNNHQNNNNNN 1250



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 25/113 (22%), Positives = 45/113 (39%), Gaps = 8/113 (7%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYN-------NKNDK 459
            +  N +N ++  N ++   +    N+ N    N+ ++  QN+     N       N N+ 
Sbjct: 1083 NSNNNNNNSINNNNNNNNNNNNNNNNNNNNNNNIINNNIQNNSNSNSNSNSNININNNNN 1142

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSAN-EFRRQNGKTKYNHSKSAVFDMS 303
               NN    N    N N+   +++  N++N      N  +  NHS S  F  S
Sbjct: 1143 NNNNNNNNNNNNNNNNNINNNNNNNNNNSNYNNYSNNNHSNNNHSSSKNFKNS 1195



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 25/109 (22%), Positives = 43/109 (39%), Gaps = 4/109 (3%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNS----KGMPYNNK 468
            N ++G ++ N +N       S+        N+ N    N  +S + N+    K    N  
Sbjct: 994  NGNNGNNNNNSNNNGNNNGNSNGNSGGNYNNNNNNNNSNNNNSNKSNNSNHDKNSNINYD 1053

Query: 467  NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            ND    NN +  NRR+ N N   + ++  NS N           N++ +
Sbjct: 1054 NDYSGMNNLKSSNRRRANNNSNNIQNNNNNSNNNNNNSINNNNNNNNNN 1102



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 21/96 (21%), Positives = 39/96 (40%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            N  N     N +S   +    NS+N    N  ++   N+     NN N+ ++ NN +  +
Sbjct: 1072 NNSNNIQNNNNNS---NNNNNNSINNNNNNNNNNNNNNNNN---NNNNNNIINNNIQNNS 1125

Query: 428  RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                N+N    S+  +N+ N     N     N++ +
Sbjct: 1126 NSNSNSN----SNININNNNNNNNNNNNNNNNNNNN 1157



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 25/112 (22%), Positives = 45/112 (40%), Gaps = 5/112 (4%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTN-----SLNRRERNVTHSGEQNSKGMPYNN 471
            N +   ++ N+ N +     S+  +D   +      S NRR  N   +  QN+     NN
Sbjct: 1028 NNNSNNNNSNKSNNSNHDKNSNINYDNDYSGMNNLKSSNRRRANNNSNNIQNNNNNSNNN 1087

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
             N+ +  NN    N    N N    +++ +N+      QN     ++S S +
Sbjct: 1088 NNNSINNNNNNNNNNNNNNNNNNNNNNNIINN----NIQNNSNSNSNSNSNI 1135



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 3/108 (2%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQN-SKGMPYNNKNDK 459
            N ++  ++ N +N     N SS   +    N+ N    N  ++G  N + G  YNN N+ 
Sbjct: 969  NNNNNNNNNNNNNNNNNNNNSSNNNNGNNGNNNNNSNNNGNNNGNSNGNSGGNYNNNNNN 1028

Query: 458  --VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                 NN  K N   ++ N      +  +  N  +  N +   N+S +
Sbjct: 1029 NNSNNNNSNKSNNSNHDKNSNINYDNDYSGMNNLKSSNRRRANNNSNN 1076



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 19/99 (19%), Positives = 41/99 (41%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            ++ + +N +  +N  +   + +  N+ N    N+ +    ++     NN N+    NN  
Sbjct: 1179 NNHSNNNHSSSKNFKNSHHNNINNNNNNNINNNINNINNNSNNNNNNNNSNNHQNSNNNN 1238

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             GN  + N N    +++  NS N     N     N++ +
Sbjct: 1239 NGNNHQNNNN----NNNGNNSNNGIINNNNNNNNNNNNN 1273



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 23/99 (23%), Positives = 36/99 (36%), Gaps = 3/99 (3%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            N DN   G N           N+ N  + N  +S   N+  +  NN N+    NN    N
Sbjct: 1051 NYDNDYSGMNNLKSSNRRRANNNSNNIQNNNNNSNNNNNNSINNNNNNNNNNNNNNNNNN 1110

Query: 428  RRK---YNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
                   N N++  S+   NS +     N     N++ +
Sbjct: 1111 NNNNNIINNNIQNNSNSNSNSNSNININNNNNNNNNNNN 1149



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 22/94 (23%), Positives = 37/94 (39%)
 Frame = -2

Query: 632  ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
            IS  F++ N +N     N ++        N+ N    N  ++G  N+      N N    
Sbjct: 962  ISHSFNNNNNNNNNNNNNNNN------NNNNNNSSNNNNGNNGNNNNNSNNNGNNNGNSN 1015

Query: 452  KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
             N+    N    N N    +S+K N++N  +  N
Sbjct: 1016 GNSGGNYNNNNNNNNSNNNNSNKSNNSNHDKNSN 1049



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 30/142 (21%), Positives = 55/142 (38%), Gaps = 25/142 (17%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++G + +N +N   G N ++     +  N+ N    N  ++   N+     NN N+  
Sbjct: 1236 NNNNGNNHQNNNNNNNGNNSNN----GIINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1291

Query: 455  MKNNFRKGNRRKYNTN-----------LERLSSDKVNSAN------------EFRRQNGK 345
              NN    N    N N           +E ++S  + + N            E   Q  +
Sbjct: 1292 NNNNNNNNNINNKNKNYASDVSMNIDIIEEINSQTIKNINNNTEINENSEIEEINSQPTQ 1351

Query: 344  TKYNHSKSAVF--DMSLQSDGS 285
             + NH+++ +   + S QSD S
Sbjct: 1352 EQINHNEAMLISEEQSHQSDNS 1373



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 21/107 (19%), Positives = 45/107 (42%), Gaps = 4/107 (3%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI++  ++ N +N     N ++   + +  N+ N    N  ++   N+     N+ + K 
Sbjct: 1136 NINNNNNNNNNNNNNNNNNNNN---NNINNNN-NNNNNNSNYNNYSNNNHSNNNHSSSKN 1191

Query: 455  MK----NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             K    NN    N    N N+  ++++  N+ N     N +   N++
Sbjct: 1192 FKNSHHNNINNNNNNNINNNINNINNNSNNNNNNNNSNNHQNSNNNN 1238



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 19/79 (24%), Positives = 31/79 (39%), Gaps = 1/79 (1%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRER-NVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           N +N +   N S+   D    NS N     N   +   N+     NN N+    NN    
Sbjct: 205 NNNNNSNSNNNSNSYKDQPHVNSTNNNTNTNTNTTNNNNNNNNSNNNNNNNNNNNNNNNN 264

Query: 431 NRRKYNTNLERLSSDKVNS 375
           N    N ++   +S+ +N+
Sbjct: 265 NNNNNNNSINNNNSNSINN 283



>gb:PFMAL8P1_1192078 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 8591

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 22/108 (20%), Positives = 40/108 (37%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            K + +S+ F    + N    +     ++    T + N R+ N  +    N+     NN N
Sbjct: 4650 KKKKVSEQFQLHQKGNTKKIKKNDDSDYSNADTFTFNNRDNNNDNDNNNNNNNNNNNNNN 4709

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            D    N+    N    N N    +++  N+ N     N     NH+ +
Sbjct: 4710 DDDNNNHNNNNNHNNNNNNNHNNNNNNHNNNNNNNNNNNHNNNNHNNN 4757



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 24/115 (20%), Positives = 44/115 (38%), Gaps = 9/115 (7%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            +++N++N     N ++   D    N  N    N  ++   N+    +NN N+    NN  
Sbjct: 4691 NNDNDNNNNNNNNNNNNNNDDDNNNHNNNNNHNNNNNNNHNNNNNNHNNNNNNNNNNNHN 4750

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK---------YNHSKSAVFDMSL 300
              N    N N    + +  N+ N    ++G  +         YN  +  +F  SL
Sbjct: 4751 NNNHNNNNNNNNNNNHNNNNNNNNNNNEDGNGENDDNNKTFYYNREQLIMFRHSL 4805



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 22/102 (21%), Positives = 41/102 (40%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N  +  D++N +N     N ++ + D    N+ N    N  ++   N+     NN N+  
Sbjct: 4687 NRDNNNDNDNNNNNNNNNNNNNNDDDNNNHNNNNNHNNNNNNNHNNNNNNHNNNNNNNNN 4746

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
              +N    N    N N    +++  N+ N     NG+   N+
Sbjct: 4747 NNHNNNNHNNNNNNNNNNNHNNNNNNNNNNNEDGNGENDDNN 4788



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 26/122 (21%), Positives = 43/122 (35%)
 Frame = -2

Query: 629  SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            +D  D  N D  T     ++ + D    N+ N    N       ++    +NN N+    
Sbjct: 4672 NDDSDYSNADTFTFNNRDNNNDNDNNNNNNNNNNNNNNDDDNNNHNNNNNHNNNNNNNHN 4731

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQT 270
            NN    N    N N     ++  N+ N     N     NH+ +   + +   DG+ E   
Sbjct: 4732 NNNNNHNNNNNNNN-----NNNHNNNNHNNNNNNNNNNNHNNNNNNNNNNNEDGNGENDD 4786

Query: 269  EN 264
             N
Sbjct: 4787 NN 4788



>gb:AE014186_938072 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014837_1228806 Plasmodium falciparum 3D7
           chromosome 11 section 2 of 8 of the complete sequence.
          Length = 891

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 32/146 (21%), Positives = 63/146 (43%), Gaps = 4/146 (2%)
 Frame = -2

Query: 716 KSEADLPSARFFPKGVVHSIKPYGKVENISDG--FDDENEDNRTLGRNKSSFEWDTVKTN 543
           K + D+ S       ++     Y  ++N S+   F D + +N       S+ E+D   +N
Sbjct: 567 KVDNDIMSPNDNDNDIISQNDNYDDIDNTSESSTFTDSSLNN------VSTNEYDNFSSN 620

Query: 542 SLNRRERNVTHSGEQNSKGM--PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
           S++  E N+ +   ++ +      NNKNDK  KN   K  ++ +  N      D  N  N
Sbjct: 621 SISSSEDNILNVSNKSEQKQLKDDNNKNDKYEKNISSKNIKQSHKMNKYDNIYDNKNDNN 680

Query: 368 EFRRQNGKTKYNHSKSAVFDMSLQSD 291
           ++   N  +  N + +   D +++ +
Sbjct: 681 KYNYSNNSSNININNNYYTDDNMKEN 706



>pir|S71629|S71629 sensory transduction histidine kinase dhkA -
           slime mold  (Dictyostelium discoideum)
          Length = 2150

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 23/99 (23%), Positives = 39/99 (39%)
 Frame = -2

Query: 584 RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
           RNK   + +   +N+ N    N  ++   NS     NN N+    NN    N    N N 
Sbjct: 646 RNKDDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNN 705

Query: 404 ERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
              +++  N+ N     N    Y++  + +   + QS G
Sbjct: 706 NNNNNNNNNNNNNNNNNNNNNNYHNGATMMMSHNHQSIG 744



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 22/94 (23%), Positives = 33/94 (35%)
 Frame = -2

Query: 584 RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
           R ++  + D    NS N    N  ++   N+     NN N     NN    N    N N 
Sbjct: 644 RRRNKDDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNN 703

Query: 404 ERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
              +++  N+ N     N     N+   A   MS
Sbjct: 704 NNNNNNNNNNNNNNNNNNNNNNNNYHNGATMMMS 737



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/89 (23%), Positives = 33/89 (37%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           +DEN+ N     + +S   +    NS N    N  ++   N+     NN N+    NN  
Sbjct: 651 NDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNN 710

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQN 351
             N    N N    +++  N A      N
Sbjct: 711 NNNNNNNNNNNNNNNNNYHNGATMMMSHN 739



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 25/98 (25%), Positives = 37/98 (37%), Gaps = 3/98 (3%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           D+N++N     N +S   +    N+ N    N  +S   N+     NN N+    NN   
Sbjct: 649 DDNDENDGNSNNTNSNNSNNNNNNNNNSSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNN 708

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKT---KYNH 330
            N    N N      +  N+ N     NG T    +NH
Sbjct: 709 NNNNNNNNN------NNNNNNNNNNYHNGATMMMSHNH 740



>pir|T18426|T18426 hypothetical protein C0330w - malaria parasite
           (Plasmodium falciparum)>gb:PFMAL3P3_1394454 Plasmodium
           falciparum MAL3P3, complete sequence.
          Length = 699

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 45/211 (21%), Positives = 76/211 (36%), Gaps = 10/211 (4%)
 Frame = -2

Query: 971 KRMQMKKSKQLLKARLARERQIYEMRKRTELKAAISELERPWEMVEKAPTLFSVSADEQL 792
           K +  KK+K  L  R  +E+ I E           S    P++ +EK  T F        
Sbjct: 64  KLLNRKKNKHTLFYRSKKEKDIQE-----------SGYLYPFDHLEKKKTKFPPDP---- 108

Query: 791 KVLADRFQRPGGFDMWSEK-DGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFD 615
             +    ++    D++ +K +  +L+  E D  + ++F K   +      K EN  D  D
Sbjct: 109 -YIPSEDEKESSIDIFHDKINDDDLMIYEDDDDAKKYFGKTTFNKPNIIQKDENSEDDQD 167

Query: 614 DE---------NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           D+         N     L  N ++   D    NS++    N   +   NS   P NN  D
Sbjct: 168 DDLNDQNDDPINNPTNNLTDNPTNNSTDNPTNNSIDNPTNNSIDNPTNNSIDNPTNNSID 227

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
               N+         +      + + +NS N
Sbjct: 228 NPTNNSIDNPTNNSIDNPTNNSTDNPINSPN 258



>sp|O94260|G3BP_SCHPO Putative G3BP-like protein.>pir|T40805|T40805
           probable RNA-binding protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBP8B7_1720661 S.pombe
           chromosome II p1 p8B7.
          Length = 434

 Score = 40.4 bits (93), Expect = 0.075
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           D  N +   L  NK + +   +   +LN  ER    SG+ N  G   +N N   MK NFR
Sbjct: 356 DFVNHECVQLALNKKTLQ---INNATLNIEERRRLFSGKFNKSGDKKSNDNYNGMKRNFR 412

Query: 437 KGNRRKYNTNLERLSSDK 384
           KGNR  ++   + +++ K
Sbjct: 413 KGNRGAFDGRSKEVTTSK 430



>gb:PFMAL3P2_1394431 Plasmodium falciparum MAL3P2, complete sequence.
          Length = 3933

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 35/151 (23%), Positives = 63/151 (41%), Gaps = 7/151 (4%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTV-KTNSLNRRERNVTHSGEQNSKGMPYN 474
            Y  +E+  D  D ++ED +    NK+        + N +     ++T+    N+  +  N
Sbjct: 1315 YSDMEHDEDNLDVDDEDEQMFSYNKNKIRNKHFGELNKMKYMNEDITN----NNNNINNN 1370

Query: 473  NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRR----QNGKTKYNHSKSAVFDM 306
            + N+   KNN    N    N N    +++ +N+ N F       NG  KY +   +  + 
Sbjct: 1371 SNNNNNNKNNINNNNNNNNNNN---NNNNNLNNLNNFNNNVSINNGNNKYRNYFRSTEEE 1427

Query: 305  SLQSDGSYEF--QTEN*ACKLSFRWLKMLLK 219
             L +    EF     N   K  F+++K+L K
Sbjct: 1428 LLFNKRFVEFLLPYSNNIAKYIFQYIKILKK 1458



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 15/56 (26%), Positives = 27/56 (48%)
 Frame = -2

Query: 554  VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSD 387
            ++T+S N    N  +S   N+     NN N+    NN    N   Y++++ ++S D
Sbjct: 2700 IRTDSSNNNNNNNINSNNNNNNNNNNNNNNNNNNNNNIYNNNNYYYSSSINKVSFD 2755



>gb:PFA929357_1393448 Plasmodium falciparum strain 3D7, chromosome 9;
            segment 3/5.
          Length = 4202

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 24/103 (23%), Positives = 42/103 (40%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            +  N ++  DD++E+N     N ++   +    N+ N    N  ++   N+     NN N
Sbjct: 1266 RFNNNNNDDDDDDENNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1325

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY 336
            +    NN    N  K N N  +     +N+  +F   N K  Y
Sbjct: 1326 NNNNNNNNNNNNNNKSNKNNNK-QMHIINTETKFSSNNFKKDY 1367



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 25/111 (22%), Positives = 44/111 (39%), Gaps = 2/111 (1%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++  DD++++N T   N +         N+ N    N  ++   N+     NN N+  
Sbjct: 1268 NNNNNDDDDDDENNTNNNNNN---------NNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1318

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY--NHSKSAVFD 309
              NN    N    N N    +    N+  +    N +TK+  N+ K   F+
Sbjct: 1319 NNNNNNNNNNNNNNNNNNNNNKSNKNNNKQMHIINTETKFSSNNFKKDYFE 1369



>gb:CR382399_1374945 Plasmodium falciparum chromosome 6, complete
           sequence; segment 2/5.
          Length = 3248

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 22/101 (21%), Positives = 39/101 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N +D  ++ N  N     N S+   +   +N+ N    N  ++   N+     NN N+  
Sbjct: 641 NDNDSSNNNNNSNNNNNSNNSNNNINNNNSNNSNNNNNNNNNNNNNNNNNNNKNNNNNSN 700

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
             NN    N    N N +    + + S + ++  N   K N
Sbjct: 701 NNNNSYNNNNSNNNNNAQITYGENIYSTSNYQNNNFYEKNN 741



 Score = 39.3 bits (90), Expect = 0.17
 Identities = 24/105 (22%), Positives = 41/105 (39%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + N +   ++ N DN +   N +S        N+ N    N+ ++   NS     NN N+
Sbjct: 629 IMNFNTNNNNNNNDNDSSNNNNNSNN-----NNNSNNSNNNINNNNSNNSN----NNNNN 679

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
               NN    N  K N N    +++  N+ N     N +  Y  +
Sbjct: 680 NNNNNNNNNNNNNKNNNNNSNNNNNSYNNNNSNNNNNAQITYGEN 724



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 23/98 (23%), Positives = 38/98 (38%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           +ENE+N   G      + + +  N+ N    N   S   N+     NN N+    NN   
Sbjct: 610 NENENNDIKGNKNIIRKNNIMNFNTNNNNNNNDNDSSNNNNNSNNNNNSNNS--NNNINN 667

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N    N N    +++  N+ N   + N     N++ S
Sbjct: 668 NNSNNSNNNNNNNNNNNNNNNNNNNKNNNNNSNNNNNS 705



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 27/129 (20%), Positives = 51/129 (39%), Gaps = 9/129 (6%)
 Frame = -2

Query: 638 ENISDGFDDENED---NRTLGRNKSSFEWDTVKTNSLNRRE-----RNVTHSGEQNSKGM 483
           EN  +  ++EN D   N+ + R  +   ++T   N+ N  +      N  ++   N+   
Sbjct: 604 ENNIEYNENENNDIKGNKNIIRKNNIMNFNTNNNNNNNDNDSSNNNNNSNNNNNSNNSNN 663

Query: 482 PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV-FDM 306
             NN N     NN    N    N N     ++  NS N     N     N++ + + +  
Sbjct: 664 NINNNNSNNSNNNNNNNNNNNNNNNNNNNKNNNNNSNNNNNSYNNNNSNNNNNAQITYGE 723

Query: 305 SLQSDGSYE 279
           ++ S  +Y+
Sbjct: 724 NIYSTSNYQ 732



>gb:AC117081_1207897 Dictyostelium discoideum chromosome 2 map
           5862124-6045772 strain AX4, complete sequence.
          Length = 836

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 23/98 (23%), Positives = 39/98 (39%), Gaps = 1/98 (1%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + NI++  +  N +N     N  +   +   +N+ N    N  ++   N+     NN N+
Sbjct: 185 INNINNNNNKNNNNNNNNNNNDDNNNINNNNSNNNNNNNNNNNNNNNNNNNNNNNNNSNN 244

Query: 461 KVMKNNFRKGN-RRKYNTNLERLSSDKVNSANEFRRQN 351
               NN    N    YN N    SS   N+ N+  + N
Sbjct: 245 NNNNNNLNNNNSNNNYNNNTTTTSSSNNNNNNKQSKYN 282



 Score = 39.7 bits (91), Expect = 0.13
 Identities = 22/101 (21%), Positives = 45/101 (44%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++  ++ N++N     N ++ + + +  N+ N    N  ++   N+     NN N+  
Sbjct: 184 NINNINNNNNKNNNNNNNNNNNDDNNNINNNNSNNNNNNNNNNNNNNNNNNNNNNNNNS- 242

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
             NN    N    N+N    ++    S++     N ++KYN
Sbjct: 243 -NNNNNNNNLNNNNSNNNYNNNTTTTSSSNNNNNNKQSKYN 282



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 21/105 (20%), Positives = 43/105 (40%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + NI++  +  N++N     N ++   + +  N+      N  ++   ++  +  NN N+
Sbjct: 162 INNINN-ININNKNNNNNNNNNNNI--NNINNNNNKNNNNNNNNNNNDDNNNINNNNSNN 218

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
               NN    N    N N    +S+  N+ N     N    YN++
Sbjct: 219 NNNNNNNNNNNNNNNNNNNNNNNSNNNNNNNNLNNNNSNNNYNNN 263



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 23/111 (20%), Positives = 41/111 (36%), Gaps = 6/111 (5%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK---- 468
           N S+  +  N +N     N ++   +    N+ N    N+ +    N+K    NN     
Sbjct: 146 NNSNNNNSNNNNNNNNINNINNININNKNNNNNNNNNNNINNINNNNNKNNNNNNNNNNN 205

Query: 467 --NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N+ +  NN    N    N N    +++  N+ N     N     N++ S
Sbjct: 206 DDNNNINNNNSNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNNNNNLNNNNS 256



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 22/102 (21%), Positives = 41/102 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++  ++ N +N+    N ++F       N+ N    N  ++   N+     NN N+  
Sbjct: 109 NINNNNNNSNINNKNNNNNNTNFNTSNNNNNTNNNSNNNSNNNNSNNN-----NNNNNIN 163

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             NN    N+   N N    + + +N+ N     N     N+
Sbjct: 164 NINNININNKNNNNNNNNNNNINNINNNNNKNNNNNNNNNNN 205



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 21/105 (20%), Positives = 43/105 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++   + N +N     N ++   + +   ++N +  N  ++   N   +  NN N+K 
Sbjct: 138 NNTNNNSNNNSNNNNSNNNNNNNNINNINNININNKNNNNNNNNNNNINNI--NNNNNK- 194

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N+   +S+  N+ N     N     N++ +
Sbjct: 195 NNNNNNNNNNNDDNNNINNNNSNNNNNNNNNNNNNNNNNNNNNNN 239



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 21/108 (19%), Positives = 42/108 (38%), Gaps = 3/108 (2%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK- 459
           N +  F+  N +N T   + ++   +    N+ N    N+ +    N      NN N+  
Sbjct: 126 NNNTNFNTSNNNNNTNNNSNNNSNNNNSNNNNNNNNINNINNININNKNNNNNNNNNNNI 185

Query: 458 --VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             +  NN +  N    N N +  ++   N++N     N     N++ +
Sbjct: 186 NNINNNNNKNNNNNNNNNNNDDNNNINNNNSNNNNNNNNNNNNNNNNN 233



>gb:AC117080_1207888 Dictyostelium discoideum chromosome 2 map
            complement(821514-735598) strain AX4, complete sequence.
          Length = 2472

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 24/116 (20%), Positives = 41/116 (35%), Gaps = 3/116 (2%)
 Frame = -2

Query: 665  HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
            H    Y    N ++  ++ N +N     N ++   +    N+ N    N   +   N+  
Sbjct: 1047 HPSNMYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNYNSNNNYNNNS 1106

Query: 485  ---MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
                 YNN N     ++    N    N N    +++  N+ N     N    YNHS
Sbjct: 1107 NNSYSYNNNNTTNNNSSININNNNNSNNNFNYNNNNNNNNNNNNNNNNNNNNYNHS 1162



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 26/112 (23%), Positives = 47/112 (41%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++  ++ N +N     N ++   ++   NS N    N  +S   N+     NN +  +
Sbjct: 1067 NNNNNNNNNNNNNNNNNNNNNNNNNNSNNYNSNNNYNNNSNNSYSYNNNNTTNNNSSINI 1126

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSL 300
              NN    N   YN N    +++  N+ N     N     N+S S++ + SL
Sbjct: 1127 NNNN-NSNNNFNYNNNNNNNNNNNNNNNNNNNNYNHSNGGNNSNSSLNEQSL 1177



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 22/106 (20%), Positives = 42/106 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N+++G +  N +N     + ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 464 NVNNGNNSNNSNNNNNSISGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 523

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
             NN    N    N N    +++  N+ N     N  T  + S +A
Sbjct: 524 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTSSSSSATA 569



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 25/93 (26%), Positives = 35/93 (37%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           E +D   LG   S  E+D    N+ N    N  ++   N+     NN N+    NN    
Sbjct: 646 ERDDTVQLG---SIIEFDVNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNNNNNN 700

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           N    N N    +S+  +S N     N    YN
Sbjct: 701 NNNNNNNNNNNNNSNNSSSNNNINNNNINNNYN 733



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 23/108 (21%), Positives = 43/108 (39%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           V N ++  +  N +N   G N ++   +    N+ N    N  ++   N+     NN N+
Sbjct: 465 VNNGNNSNNSNNNNNSISGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNNNN 522

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
               NN    N    N N    +++  N+ N     NG +  + + +A
Sbjct: 523 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTSSSSSATAA 570



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 26/121 (21%), Positives = 43/121 (35%)
 Frame = -2

Query: 680 PKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGE 501
           PK    S+ P   + N ++  +  N +N     N  S   +    N+ N    N  ++  
Sbjct: 447 PKKFTFSL-PLSMLNNNNNVNNGNNSNNSNNNNNSISGNNNNNNNNNNNNNNNNNNNNNN 505

Query: 500 QNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N+     NN N+    NN    N    N N    +++  N+ N     N       S S
Sbjct: 506 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTSSSS 565

Query: 320 A 318
           +
Sbjct: 566 S 566



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 20/98 (20%), Positives = 36/98 (36%)
 Frame = -2

Query: 614  DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
            + N +N     N ++   +    N+ N    N  ++   NS     NN  +    N++  
Sbjct: 1053 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNYNSNNNYNNNSNNSYSY 1112

Query: 434  GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N    N N     ++  NS N F   N     N++ +
Sbjct: 1113 NNNNTTNNNSSININNNNNSNNNFNYNNNNNNNNNNNN 1150



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 19/112 (16%), Positives = 46/112 (41%)
 Frame = -2

Query: 662 SIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGM 483
           SI  +    N ++  ++ N +N     N ++   +    N+ N    N  ++   N+   
Sbjct: 655 SIIEFDVNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNS 714

Query: 482 PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             ++ N+ +  NN        YN   + ++++ +N+ N     N  +  N++
Sbjct: 715 NNSSSNNNINNNNINNNYNSNYN---KSINNNSINNNNNNNNNNNNSSINNN 763



>gb:AC117072_1207704 Dictyostelium discoideum chromosome 2 map
           3879572-4071762 strain AX4, complete sequence.
          Length = 772

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 32/118 (27%), Positives = 48/118 (40%), Gaps = 4/118 (3%)
 Frame = -2

Query: 656 KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKT----NSLNRRERNVTHSGEQNSK 489
           K +GK +   DG DD N+D++   R K S+   + K     N+ N    N  +S   N  
Sbjct: 519 KDFGKYQ---DGSDDYNDDDQNDYRVKDSYSRKSKKQKTSHNNNNNNNNNDNNSSNNNKN 575

Query: 488 GMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
               +NK     KN+ +K  + K     +    DK    N   R+  + K N   S V
Sbjct: 576 NSNNSNKESSEEKNDKKKKKKNKKGNQEKEKEKDK-KDKNHKTRERDREKDNDIDSMV 632



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 2/101 (1%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK-NDKVMKNN- 444
           ++ N DN +   NK+    ++  +N  +  E+N     ++N KG     K  DK  KN+ 
Sbjct: 561 NNNNNDNNSSNNNKN----NSNNSNKESSEEKNDKKKKKKNKKGNQEKEKEKDKKDKNHK 616

Query: 443 FRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            R+ +R K N     +  DKV + N  + +N     N++ +
Sbjct: 617 TRERDREKDNDIDSMVDLDKVKNNNNNKNKNNNKNNNNNNN 657



>gb:AC116977_1207001 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 633

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 22/90 (24%), Positives = 37/90 (41%)
 Frame = -2

Query: 590 LGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNT 411
           L   K S +  ++ +N++N    N  ++   N+  M  NN N+    NN    N    N+
Sbjct: 378 LDHKKGSRDGHSISSNNMNSNSSNNNNNSSNNNNNMN-NNNNNNSNNNNNNMSNNNNSNS 436

Query: 410 NLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N    +S+  N+ N     N     N+  S
Sbjct: 437 NSSNSNSNSNNNNNNMNNNNNNMNNNNMNS 466



 Score = 39.7 bits (91), Expect = 0.13
 Identities = 25/119 (21%), Positives = 49/119 (41%), Gaps = 2/119 (1%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNR-RERNVTHSGEQNSKGMPYNNKND- 462
           N S+   + N +N  +  N ++   + + +N+ N     N+ ++   N+ G   NN N+ 
Sbjct: 437 NSSNSNSNSNNNNNNMNNNNNNMNNNNMNSNNNNNMNNNNMDNNNNMNNNGNNMNNNNNM 496

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
             M NN    N    N N    + +  N+       N     N++ S+    S  ++G+
Sbjct: 497 NNMNNNMNNNNNNMNNMNNNNNNMNNTNNNINNNNMNNSNTNNNNNSSNSSNSNNNNGA 555



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 23/115 (20%), Positives = 44/115 (38%), Gaps = 2/115 (1%)
 Frame = -2

Query: 665 HSIKPYGKVENISDGFDDENEDNRTLGRNKS--SFEWDTVKTNSLNRRERNVTHSGEQNS 492
           HSI       N S+  ++ + +N  +  N +  S   +   +N+ N    +   +   N+
Sbjct: 388 HSISSNNMNSNSSNNNNNSSNNNNNMNNNNNNNSNNNNNNMSNNNNSNSNSSNSNSNSNN 447

Query: 491 KGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
                NN N+ +  NN    N    N N    +++  N+ N     N     N++
Sbjct: 448 NNNNMNNNNNNMNNNNMNSNNNNNMNNNNMDNNNNMNNNGNNMNNNNNMNNMNNN 502



>gb:AC116963_1206850 Dictyostelium discoideum chromosome 2 map
            4657875-4914984 strain AX4, complete sequence.
          Length = 2254

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 21/86 (24%), Positives = 33/86 (38%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            N++   +  N S+ E +    N+ N    N  ++   N+     NN N+    NN     
Sbjct: 829  NDEYNNINNNNSNIESNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNT 888

Query: 428  RRKYNTNLERLSSDKVNSANEFRRQN 351
                N N+E   +D  NS N     N
Sbjct: 889  TELVNNNIESNDNDNNNSNNNNNNNN 914



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 17/82 (20%), Positives = 33/82 (40%)
 Frame = -2

Query: 566  EWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSD 387
            E++ +  N+ N    N  ++   N+     NN N+    NN    N    N N    +++
Sbjct: 831  EYNNINNNNSNIESNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTE 890

Query: 386  KVNSANEFRRQNGKTKYNHSKS 321
             VN+  E    +     N++ +
Sbjct: 891  LVNNNIESNDNDNNNSNNNNNN 912



>gb:AC116305_1206140 Dictyostelium discoideum chromosome 2 map
           1005175-1418323 strain AX4, complete sequence.
          Length = 941

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 24/87 (27%), Positives = 38/87 (43%)
 Frame = -2

Query: 551 KTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSA 372
           KTN+ N  E N  H+   N+    YNN N+ +  NN    N    N N   ++++  N++
Sbjct: 235 KTNN-NNNENNNNHNNNHNNNHNKYNNNNNNINNNNNIINNYNNNNNNNSNINNN--NNS 291

Query: 371 NEFRRQNGKTKYNHSKSAVFDMSLQSD 291
            +F       K N S +  F  +   D
Sbjct: 292 IKFNNNINSNKNNTSNNLFFKQNQHDD 318



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 23/106 (21%), Positives = 39/106 (36%)
 Frame = -2

Query: 632 ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
           + + F + +  N T G N  +   + +  N+ N    N  ++   N+     NN N+   
Sbjct: 86  VGNSFFNSSRLNNTGGDNSINNNNNNININNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 145

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
            NN    N    N N     S  +NS +    +N        KS +
Sbjct: 146 NNNNNNNNNNNNNNNNNSSISSIINSHSNNNYKNNFLNIVEEKSQI 191



>gb:AC115607_1205908 Dictyostelium discoideum chromosome 2 map
           4559693-4624405 strain AX4, complete sequence.
          Length = 673

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 32/134 (23%), Positives = 52/134 (38%), Gaps = 11/134 (8%)
 Frame = -2

Query: 650 YGKVENISDG-FDDENEDNRTLGRNKSSF----------EWDTVKTNSLNRRERNVTHSG 504
           +    N ++G F++ N +N     N S F           ++    NS N    N  ++ 
Sbjct: 315 FNNTNNYNNGSFNNNNNNNNNNNNNNSGFINSSNGNNFNSYNNNSGNSNNNNNNNNNNNV 374

Query: 503 EQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
            Q S G+  NN N     NN   G+    N N    S++  N  N+    + ++ YNH  
Sbjct: 375 SQYSNGVNGNNNNYNNGFNNNINGSIDNNNNNNTTNSNNVYNYQNKSYSVDDRSSYNHKP 434

Query: 323 SAVFDMSLQSDGSY 282
           + +   S    G Y
Sbjct: 435 NFMQPSSPSMQGQY 448



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 30/138 (21%), Positives = 64/138 (46%), Gaps = 3/138 (2%)
 Frame = -2

Query: 668 VHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSK 489
           V+S        N S+  ++ N  NR +  N +S        +++ R +++  ++   ++K
Sbjct: 485 VNSFNNNNNNNNSSNNSNNSNNSNR-ISPNLTS--------SNMYRNDKDQFYNSNNSNK 535

Query: 488 GMPYNNKNDKVMKNN--FRKGNRRKY-NTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
           G  YNN N+    NN  F + +R +Y N N+   +++  N++N     N     N++ + 
Sbjct: 536 G-NYNNANNNSNNNNNRFYEKDRDQYNNNNINNNNNNNNNNSNNNNNNNNNNNNNNNNNN 594

Query: 317 VFDMSLQSDGSYEFQTEN 264
           + + +  +   Y +Q  N
Sbjct: 595 INNNNNNNGNGYHYQNYN 612



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 2/120 (1%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           +D+++   +   NK ++      +N+ N R          N+     NN N+    NN  
Sbjct: 522 NDKDQFYNSNNSNKGNYNNANNNSNNNNNRFYEKDRDQYNNNNINNNNNNNNNNSNNNNN 581

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQS--DGSYEFQTEN 264
             N    N N   ++++  N+ N +  QN    YN++ +  ++ + +S  D SYE  + N
Sbjct: 582 NNNNNNNNNNNNNINNNNNNNGNGYHYQN----YNNNDNRGYNNNRRSDNDNSYEDGSSN 637



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 25/110 (22%), Positives = 44/110 (40%), Gaps = 8/110 (7%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S+  +  N +N +   N   +E D  + N+ N    N  ++   N+     NN N+  
Sbjct: 531 NNSNKGNYNNANNNSNNNNNRFYEKDRDQYNNNNINNNNNNNNNNSNNNNNNNNNNNNNN 590

Query: 455 MKNNFRKGNR--------RKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             NN    N         + YN N  R  ++   S N+   ++G +  N+
Sbjct: 591 NNNNINNNNNNNGNGYHYQNYNNNDNRGYNNNRRSDNDNSYEDGSSNNNN 640



>gb:PFMAL13_1191672 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 2030

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 26/104 (25%), Positives = 46/104 (44%), Gaps = 4/104 (3%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           +EN D ++   N +       + N+  ++E N     E N+     NN N K   NN +K
Sbjct: 654 NENHDKKSENFNLNLIYQKKKENNNNKKKENNDNKKKENNNNKKKENNNNKKKENNNNKK 713

Query: 434 ----GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
                N++K N N    +  K N+ N+ +  N K   N++ + +
Sbjct: 714 KENNNNKKKENNN----NKKKENNNNKKKENNNKNNNNNNNNHI 753



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 27/118 (22%), Positives = 50/118 (42%), Gaps = 2/118 (1%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           EN +N+    N +  +    + N+  ++E N     E N+     NN N K   NN    
Sbjct: 675 ENNNNKKKENNDNKKK----ENNNNKKKENNNNKKKENNNNKKKENNNNKKKENNN---- 726

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH--SKSAVFDMSLQSDGSYEFQTEN 264
           N++K N N ++  ++  N+ N     N     N+    S +F+ +   +G++     N
Sbjct: 727 NKKKENNNNKKKENNNKNNNN---NNNNHISINNIVKPSFIFEANYVEEGNHRDTQHN 781



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 25/110 (22%), Positives = 46/110 (41%), Gaps = 3/110 (2%)
 Frame = -2

Query: 650 YGKVENISDGFDDENEDNRTLGRN---KSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
           Y K +  ++    EN DN+    N   K     +  K N+ N+++ N  +  ++N+    
Sbjct: 670 YQKKKENNNNKKKENNDNKKKENNNNKKKENNNNKKKENNNNKKKENNNNKKKENNNNKK 729

Query: 479 YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             N N+K  +NN    N+   N N   +S + +   +     N   + NH
Sbjct: 730 KENNNNKKKENN----NKNNNNNNNNHISINNIVKPSFIFEANYVEEGNH 775



>gb:AE014187_938635 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014818_1227711 Plasmodium falciparum 3D7
           chromosome 14 section 3 of 13 of the complete sequence.
          Length = 4466

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 29/114 (25%), Positives = 44/114 (38%)
 Frame = -2

Query: 668 VHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSK 489
           +++ K    V N   G      +N     NKS+      KT+  N+   N    G +N+ 
Sbjct: 296 INNKKTNDSVTNKISGAKANKGNNSNNNNNKSNNN----KTSHNNKSNNNNKDDGSKNNN 351

Query: 488 GMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
               NN N+    NN    N  K N N    ++D  N+ N     NG    N++
Sbjct: 352 NNNNNNSNNNNNNNNNYGNNNSKKNNNNNNDNNDNNNNNNNNNNNNGDNNKNNN 405



 Score = 39.7 bits (91), Expect = 0.13
 Identities = 32/116 (27%), Positives = 46/116 (39%), Gaps = 10/116 (8%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKS--------SFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
           N S+  ++++ +N+T   NKS        S   +    N+ N    N  + G  NSK   
Sbjct: 318 NNSNNNNNKSNNNKTSHNNKSNNNNKDDGSKNNNNNNNNNSNNNNNNNNNYGNNNSKKNN 377

Query: 479 YNN--KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
            NN   ND    NN    N    N N      D  N  N   ++N K K NH  ++
Sbjct: 378 NNNNDNNDNNNNNNNNNNNNGDNNKNNNNDEDDDDNDNNGDNKKNKKDKGNHKDTS 433



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 26/129 (20%), Positives = 57/129 (44%), Gaps = 12/129 (9%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N   G N S         N+ N    N  ++   N+     NN ND+ 
Sbjct: 353 NNNNNSNNNNNNNNNYGNNNSK---KNNNNNNDNNDNNNNNNNNNNNNGDNNKNNNNDED 409

Query: 455 MKNNFRKGNRRK--------YNTNLERLSSDKVNSA----NEFRRQNGKTKYNHSKSAVF 312
             +N   G+ +K         +T+ +  ++DK+N +    ++ +++N K   N+  ++  
Sbjct: 410 DDDNDNNGDNKKNKKDKGNHKDTSNKNNNTDKINDSHMVKSDKKKKNTKNNTNNKNNSSI 469

Query: 311 DMSLQSDGS 285
             ++  +GS
Sbjct: 470 SNTINMNGS 478



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 13/121 (10%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERN--VTH--SGEQNSKGMPY 477
           K E+I++    E  DN  L  N+       ++ N++N ++ N  VT+  SG + +KG   
Sbjct: 266 KCEHINNTI--EELDNLCLSENEHI---QNIEANNINNKKTNDSVTNKISGAKANKGNNS 320

Query: 476 NNKNDKV---------MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
           NN N+K            NN  K +  K N N    +S+  N+ N     N   K N++ 
Sbjct: 321 NNNNNKSNNNKTSHNNKSNNNNKDDGSKNNNNNNNNNSNNNNNNNNNYGNNNSKKNNNNN 380

Query: 323 S 321
           +
Sbjct: 381 N 381



>gb:AE014187_938594 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014818_1227670 Plasmodium falciparum 3D7
           chromosome 14 section 3 of 13 of the complete sequence.
          Length = 471

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 27/130 (20%), Positives = 51/130 (39%), Gaps = 7/130 (5%)
 Frame = -2

Query: 632 ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERN-------VTHSGEQNSKGMPYN 474
           +S  F  + +   T   N+S      +K N  N +E+N       + H     +K +   
Sbjct: 136 VSKSFSMKYKHIHTNNNNRSEKNNSAIKLNKSNNKEKNKHVHKKKIVHDSIDKNKSVNKK 195

Query: 473 NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQS 294
             ND + KN  +  N++  N  + +  +   NS  +   +  K K+    S V +++ +S
Sbjct: 196 IGNDSINKN--KNDNKKNVNEKINKNRNGTSNSTTKMSLKKNKGKHEKDTSNVMNITTRS 253

Query: 293 DGSYEFQTEN 264
            G       N
Sbjct: 254 SGDTTSNNNN 263



>gb:AE014185_937715 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014831_1228449 Plasmodium falciparum 3D7
            chromosome 10 section 3 of 7 of the complete sequence.
          Length = 1455

 Score = 40.0 bits (92), Expect = 0.098
 Identities = 27/111 (24%), Positives = 45/111 (40%)
 Frame = -2

Query: 665  HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
            HS K +  + N  +G +  N +N  +   K  + ++  K N     + +  +    N   
Sbjct: 803  HSAKNFYNISN-ENGDNTFNNNNNNMDNKKRMYNYNKHKDNDSRYTDNSNKNRDNSNKNR 861

Query: 485  MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
              YN   DK   NN  + N  +Y  N    ++   N+ NE +R   K  YN
Sbjct: 862  DNYNRNKDK---NNTNRDNYNRYKDNNYYYNNSDNNNYNERKRYIRKKTYN 909



>gb:PFMAL3P7_1394591 Plasmodium falciparum MAL3P7, complete sequence.
          Length = 2706

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 36/168 (21%), Positives = 59/168 (35%), Gaps = 24/168 (14%)
 Frame = -2

Query: 695  SARFFPKGVVHSIKPYGKVENISDGFDDENED-----------------------NRTLG 585
            SA +F +        Y   +   D +DD+++D                       NR   
Sbjct: 2536 SANYFSEDEEEDDDDYYDDDYYDDDYDDDDDDDEDYADDDFYNDEYTYTNPAYYYNRRYT 2595

Query: 584  RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG-NRRKYNTN 408
            RN++       + N  N    N  +   +         KN++  K NF    N RK    
Sbjct: 2596 RNRARRTSQRTRNNRRNNNNNNNNNRKSRKRSTRTNRKKNERTKKKNFENFLNVRK---- 2651

Query: 407  LERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
             +RL + + N   E    N     N++ +A+F  SL S   Y  ++ N
Sbjct: 2652 SDRLRNKEQNKKEENNNNNNNNNNNNNNNALFRNSLNSRNRYNTRSSN 2699



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 32/105 (30%), Positives = 43/105 (40%), Gaps = 1/105 (0%)
 Frame = -2

Query: 632  ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
            + D     NE NR L     S    T   N ++ R R +T S   N      NN N+   
Sbjct: 1338 VYDSVGGMNESNRVLPVGGVS----TSNNNLMSMRGRRLTRSTRNNG-----NNNNNNNN 1388

Query: 452  KNNFRKG-NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN R   N R  N N  R S++  +S N     N ++  N+S S
Sbjct: 1389 NNNNRSSINNRSSNNN--RSSNNNSSSNNNNSSNNNRSSNNNSSS 1431



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 29/119 (24%), Positives = 49/119 (41%), Gaps = 18/119 (15%)
 Frame = -2

Query: 596  RTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNN--------- 444
            R  G N ++   +    +S+N R  N   S   NS     N+ N+    NN         
Sbjct: 1377 RNNGNNNNNNNNNNNNRSSINNRSSNNNRSSNNNSSSNNNNSSNNNRSSNNNSSSNNRSG 1436

Query: 443  ---FRKGNRRKYNTN----LERLSSDKVNSAN--EFRRQNGKTKYNHSKSAVFDMSLQS 294
                R GN+ +  +N    LE +S + VN++N  +    N     N++K    ++S +S
Sbjct: 1437 HRLTRGGNKIERTSNSDDELEIISRNNVNNSNDQDINNNNNNNNSNNNKEEQNNLSFKS 1495



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 19/76 (25%), Positives = 36/76 (47%)
 Frame = -2

Query: 614  DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
            +  ++ RT  +N  +F  +  K++ L  +E+N       N+     NN N+ + +N+   
Sbjct: 2631 NRKKNERTKKKNFENF-LNVRKSDRLRNKEQNKKEENNNNNNNNNNNNNNNALFRNSLNS 2689

Query: 434  GNRRKYNTNLERLSSD 387
             NR  YNT    ++ D
Sbjct: 2690 RNR--YNTRSSNINRD 2703



>gb:PFMAL3P5_1394519 Plasmodium falciparum MAL3P5, complete sequence.
          Length = 1181

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 25/95 (26%), Positives = 40/95 (42%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            +D+N+DN     N ++   ++   NS N    N  ++   NS     NN N+   +N   
Sbjct: 810  EDDNDDNNNNSSNNNNNSNNSSNNNSNNNSNNNSNNNNSNNS-----NNNNNNTNRNMSS 864

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
              NR   NTN E   ++ +   N  R  N    Y+
Sbjct: 865  NNNRNNNNTN-ESSGNNILVGRNNIRNPNNDVIYS 898



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 1/104 (0%)
 Frame = -2

Query: 626  DGFDDENE-DNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            +G D+EN+ +N    +NK+  E D  K +  N ++ +       NS     NN N+    
Sbjct: 776  NGKDNENKNENENEDKNKNEDE-DKNKNDDHNNKKEDDNDDNNNNSSNNN-NNSNNSSNN 833

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
            N+    N    N N    +++  N+       N +   N ++S+
Sbjct: 834  NSNNNSNNNSNNNNSNNSNNNNNNTNRNMSSNNNRNNNNTNESS 877



>gb:AF052006_1236728 Dictyostelium discoideum C-module-binding
           factor (cbfA) gene, complete cds.
          Length = 1000

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 27/98 (27%), Positives = 42/98 (42%), Gaps = 4/98 (4%)
 Frame = -2

Query: 545 NSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANE 366
           NS N    N+ ++   N+  +  NN N     NN    N    N N   ++++ +N+ N 
Sbjct: 578 NSNNNNNNNINNNNNNNNNNINNNNNN----MNNNNSINNNNNNNNNNNINNNNINN-NN 632

Query: 365 FRRQNGKTKYNHSKSAVFDMSL----QSDGSYEFQTEN 264
               NG    N S S++  +S     QS GSY+    N
Sbjct: 633 HHNNNGNNNLNSSYSSLNALSSLSQQQSYGSYDNYNNN 670



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 18/73 (24%), Positives = 32/73 (43%)
 Frame = -2

Query: 548 TNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
           +NS +     + ++ +Q   G+PYNN N+    NN    N    N N    +++ +N+ N
Sbjct: 552 SNSNSSNHPRILNNNQQ--LGLPYNNNNNSNNNNNNNINNNNNNNNNNINNNNNNMNNNN 609

Query: 368 EFRRQNGKTKYNH 330
                N     N+
Sbjct: 610 SINNNNNNNNNNN 622



>gb:AF047005_1236364 Plasmodium falciparum asparagine-rich protein
           mRNA, partial cds.
          Length = 728

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 34/133 (25%), Positives = 57/133 (42%), Gaps = 4/133 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N +D  ++   +N   G N +      +  N  NR+  N  ++     KG P+N+ N  V
Sbjct: 579 NNNDNNNNNYINNIGSGINSTGISNKNLMINHQNRKNNNHNNNNNDKFKGNPFNDFNGIV 638

Query: 455 MKNNFRK--GNRRKYNTNLERLSSDK--VNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
             NN +K   N    N NL  ++++K  +N  N         KY  + ++ F  +  S  
Sbjct: 639 TSNNIKKILNNENNNNNNLYMMNNNKTPINDIN--------VKYVEALNSQF--NFLSRD 688

Query: 287 SYEFQTEN*ACKL 249
           S +  TEN A  +
Sbjct: 689 SRKIDTENNAINI 701



>gb:AC116305_1206174 Dictyostelium discoideum chromosome 2 map
           1005175-1418323 strain AX4, complete sequence.
          Length = 1271

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 22/97 (22%), Positives = 41/97 (42%), Gaps = 1/97 (1%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTN-SLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNF 441
           ++ N +N     N ++    T+  N +LN    N  ++   N+     NN N+    NN 
Sbjct: 14  NNNNNNNNNNNNNNNNNNNHTISGNENLNNNNNNNNNNNNYNNNNNNNNNNNNNNNNNNN 73

Query: 440 RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
              N    N N  + + +  +++N     NG  KY++
Sbjct: 74  NNNNNNNNNNNNNKNNGNSNSNSNNNNNNNGINKYSN 110



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 21/93 (22%), Positives = 37/93 (39%)
 Frame = -2

Query: 569  FEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSS 390
            F+ D  + ++ N    N  ++   N+     NN N+    NN    N    N +    ++
Sbjct: 1016 FQEDIDQLSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDDNNNNN 1075

Query: 389  DKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
            +  N+ N   R NG ++   SK  V +     D
Sbjct: 1076 NNNNNNNNNNRFNGTSESKGSKKLVIETGSSID 1108



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 20/76 (26%), Positives = 32/76 (42%), Gaps = 1/76 (1%)
 Frame = -2

Query: 545 NSLNRRERNVTHSGEQN-SKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
           N+ N    N T SG +N +     NN N+    NN    N    N N    +++  N+ N
Sbjct: 24  NNNNNNNNNHTISGNENLNNNNNNNNNNNNYNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 83

Query: 368 EFRRQNGKTKYNHSKS 321
              + NG +  N + +
Sbjct: 84  NNNKNNGNSNSNSNNN 99



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 23/114 (20%), Positives = 46/114 (40%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            N+ N +    K S + +T   +        ++++   N+     NN N+    NN    N
Sbjct: 993  NKKNNSKQEKKISVKNETTDDDEFQEDIDQLSNNNNNNNN----NNNNNNNNNNNNNNNN 1048

Query: 428  RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTE 267
                N N    +++  N+ N+    N     N++ +  F+ + +S GS +   E
Sbjct: 1049 NNNNNNNNNNNNNNNNNNNNDDNNNNNNNNNNNNNNNRFNGTSESKGSKKLVIE 1102



>gb:AC115680_1205976 Dictyostelium discoideum chromosome 2 map
           4915084-5005461 strain AX4, complete sequence.
          Length = 652

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 28/127 (22%), Positives = 52/127 (40%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K++N ++ F + N +N  +  + ++           N    N T++   N+     NN N
Sbjct: 395 KIDNNNNNFSNNNFNNSNINNSTNN-----------NSNINNSTNNNSTNNNSTNNNNNN 443

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
           +    NN    N    N N   +++   N++N     NG   + ++ SA  + +  S  S
Sbjct: 444 NNNNNNNNNFNNNNSNNNNNSNINNSNNNNSN--NTYNGNNSFGNNNSA--NSNQYSPSS 499

Query: 284 YEFQTEN 264
           Y  Q  N
Sbjct: 500 YNAQLPN 506



>gb:AC115598_1205763 Dictyostelium discoideum chromosome 2 map
           581427-735498 strain AX4, complete sequence.
          Length = 300

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 34/149 (22%), Positives = 54/149 (36%)
 Frame = -2

Query: 737 KDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWD 558
           K  P+    +        FP        PY K ++    F + N +N     N +     
Sbjct: 126 KRSPQYFLKKMPTYGEPLFPSNFNSPPPPY-KEQSKYLSFSNNNNNNNNNNNNNN----- 179

Query: 557 TVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVN 378
               N+ N    N  ++   N+     NN+N++   NNF   N   YN N    + +  N
Sbjct: 180 ----NNNNNNNNNNNNNNNNNNNNNINNNQNNQNNNNNFPTNNNNNYNNN----NYNNNN 231

Query: 377 SANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
           + N F  Q  + K   SK   F +  + D
Sbjct: 232 NNNNFINQQLQIKLEESKKNNFILEQRVD 260



>gb:AC123513_1192416 Dictyostelium discoideum strain AX4 chromosome
           2 map 2779865-2840915, *** SEQUENCING IN PROGRESS
           ***.>gb:AC117070_1207602 Dictyostelium discoideum
           chromosome 2 map 2097701-2233941 strain AX4, complete
           sequence.
          Length = 1880

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 27/110 (24%), Positives = 45/110 (40%), Gaps = 5/110 (4%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHS---GEQN--SKGMPYNNKN 465
           SD  DDEN +N     N ++   +    N+ N    N  ++   G+ N  S     NN N
Sbjct: 63  SDSIDDENNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNIGDNNNISNNNINNNNN 122

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
           +    NN    N RK  T+    +    NS N     +  +  N++ +++
Sbjct: 123 NINNNNNTINNNNRKLATSFSTSNIINNNSTNNINNSSSSSSNNNNNNSI 172



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 26/124 (20%), Positives = 48/124 (38%), Gaps = 2/124 (1%)
 Frame = -2

Query: 686  FFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHS 507
            FF    + S     K+ N ++  ++ N +N T     ++   + + TN  +    N    
Sbjct: 1212 FFENQTISSGNTSPKITNNNNNSNNINNNNSTTTTTTTTNNNNPIATNIQSNINNNEKDK 1271

Query: 506  GEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNT--NLERLSSDKVNSANEFRRQNGKTKYN 333
               N++    NN ND    NN    N    NT  N    +++ +N+ N     N     N
Sbjct: 1272 ERDNNQKNNNNNNNDNNNNNNNNNINNNNNNTSNNNNNNNNNNINNNNNISNNNNNNNNN 1331

Query: 332  HSKS 321
            ++ +
Sbjct: 1332 NNNN 1335



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/98 (22%), Positives = 36/98 (36%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI++   D+  DN     N ++ + +    N+      N T +   N+     NN N+  
Sbjct: 1263 NINNNEKDKERDNNQKNNNNNNNDNNNNNNNNNINNNNNNTSNNNNNNNNNNINNNNNIS 1322

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKT 342
              NN    N    N N     ++  N+ N     N  T
Sbjct: 1323 NNNNNNNNNNNNNNNNNNNNINNNNNTMNSSESTNTNT 1360



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 29/122 (23%), Positives = 48/122 (39%), Gaps = 4/122 (3%)
 Frame = -2

Query: 680  PKGVVHSIKPYGKVENISDGFDD----ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVT 513
            P G V S + + + + IS G        N +N     N +S    T  TN+ N    N+ 
Sbjct: 1202 PAGNVSSKRLFFENQTISSGNTSPKITNNNNNSNNINNNNSTTTTTTTTNNNNPIATNIQ 1261

Query: 512  HSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
             +   N K    + + D   KNN    N    N N   ++++  N++N     N     N
Sbjct: 1262 SNINNNEK----DKERDNNQKNNNNNNNDNNNNNNNNNINNNNNNTSNNNNNNNNNNINN 1317

Query: 332  HS 327
            ++
Sbjct: 1318 NN 1319



>gb:PFMAL8P1_1192052 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 738

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 25/132 (18%), Positives = 53/132 (40%)
 Frame = -2

Query: 725 ELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKT 546
           E+L +E  L     +     H    + +   +     + N D+ T  + ++    + +  
Sbjct: 321 EVLNNEDILNKLNAYKHYTKHGATSFIQSREVKIVNQNVNNDDTTKNQQQNVNNNEKLNN 380

Query: 545 NSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANE 366
           N+ N   + V ++   N++ +  NN N+    NN    N  + N N    ++   N+ N 
Sbjct: 381 NNNNNNNQQVNNNNNNNNQQVNNNNNNNNNQVNNNNNNNNNQVNNNNYNNNNQVNNNNNN 440

Query: 365 FRRQNGKTKYNH 330
            ++ N    YN+
Sbjct: 441 NQQVNNNNNYNN 452



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 1/93 (1%)
 Frame = -2

Query: 602 DNRTLGRNKSSFEWDTVKTNSLNRRER-NVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNR 426
           +N  L  N ++     V  N+ N  ++ N  ++   N      NN N++V  NN+   N+
Sbjct: 374 NNEKLNNNNNNNNNQQVNNNNNNNNQQVNNNNNNNNNQVNNNNNNNNNQVNNNNYNNNNQ 433

Query: 425 RKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
              N N    ++ +VN+ N +  Q     +N++
Sbjct: 434 VNNNNN----NNQQVNNNNNYNNQLNNNNFNNN 462



>gb:PFMAL13_1191412 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 633

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 6/110 (5%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSG------EQNSKGMPY 477
           +N  +  ++EN DN     NK +     V  ++ N  E+N  HS        Q +  M +
Sbjct: 391 DNNENNDNNENNDNNIPVNNKKNSHTPHVPKDTKNNIEKN--HSNYNYKPINQENLSMYF 448

Query: 476 NNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
           NN N K  K N +K N++    N ++ + D  N     ++ N   +Y  S
Sbjct: 449 NNNNKKKNKKNSQKNNQKNNQKNNQKHNQDLYN----IKKNNDLPQYEES 494



>gb:AE014187_939153 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014827_1228229 Plasmodium falciparum 3D7
           chromosome 14 section 12 of 13 of the complete sequence.
          Length = 720

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 33/128 (25%), Positives = 56/128 (43%), Gaps = 3/128 (2%)
 Frame = -2

Query: 710 EADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNR 531
           E D  + R F + +  S+K      N +D   ++N+DN+    +  +   D  K N+ N+
Sbjct: 393 ENDNKNVRNFNRDIT-SMKHNTYCHNENDDNKNKNDDNKNKNDDNKNKNDDNKKKNNDNK 451

Query: 530 RERNVTHSGEQNSKGMPYNNK---NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFR 360
            + +       ++K    +NK   ND   KNN    N+ K N N +  + D  N  N+ +
Sbjct: 452 NKNDDNKKKNNDNKNKNDDNKKKNNDNKNKNN---DNKNKNNDN-KNNNDDNKNKNNDNK 507

Query: 359 RQNGKTKY 336
             N   KY
Sbjct: 508 NNNNSNKY 515



>pir|T10265|T10265 arabinogalactan-protein AGP2 - Persian
           tobacco>gb:S79359_1704574 arabinogalactan-protein
           [Nicotiana alata, cell-suspension culture filtrate,
           mRNA, 1700 nt].
          Length = 461

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 27/114 (23%), Positives = 46/114 (40%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           ++G+D  N DN           +D+   N+ N  +   + +   N      NNKN+    
Sbjct: 177 NNGYDSNNNDNNN--------GYDS--NNNNNNNDDGFSENYNNNGYSENANNKNNNGYS 226

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
            N+   N   Y  N     S   N+ N F  +N    YN++ + VF  +  ++G
Sbjct: 227 ENYNNNNNNGYAKNYNNGYSQSYNNNNNFYSEN----YNNNNNNVFSENSNNNG 276



>gb:PFMEZSA1B_1394900 P.falciparum gp190 (MSA1, MSP1, PMMSA) for
           precursor of major merozoite surface antigens.
          Length = 1720

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 421 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPHTKEKINEKIITDNKERKIFINNIKK 479

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 480 KIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 539

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 540 YNVEKQRYNNKFSSSNNSVYNV 561



>gb:PFMAL1P2_1394301 Plasmodium falciparum DNA from MAL1P2.
          Length = 2359

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 6/130 (4%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI D    +N ++  +  NK++ + +    N+ N    N  ++   N+     NN N+  
Sbjct: 887  NIMDESIHKNNNDNNMNSNKNNNDNNMNSNNNNNDNNMNSNNNNNDNNMNSNNNNNNNYN 946

Query: 455  MKNNFR--KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH--SKSAVFDMS--LQS 294
              ++ +  + N   Y+ N       K    N   + N   KYN   +K+ +F  +  +Q 
Sbjct: 947  SSSDMKIIESNNIPYSPNNNMKKKKKKKKKNLKEKLNNNIKYNEIITKTHIFPTNKIIQH 1006

Query: 293  DGSYEFQTEN 264
            D   E++T N
Sbjct: 1007 DKGVEYETTN 1016



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 30/96 (31%), Positives = 41/96 (42%), Gaps = 1/96 (1%)
 Frame = -2

Query: 635  NISDGFDDENEDNRT-LGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            N ++  DD  +DN + + R  S   +  V+ N  N++E N  +S E N      NNKN+ 
Sbjct: 1651 NKNNIIDDRMKDNISKINRYNSDDTYIKVENNYDNKKEMN--NSDELNGNNNNNNNKNNN 1708

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
               NN    N    N N      DK N  N F   N
Sbjct: 1709 NNNNNNNNNNNNNNNNNNINNGGDK-NRRNNFNNNN 1743



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 8/113 (7%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            Y KVEN  D   + N  +   G N ++      K N+ N    N  ++   N+  +  NN
Sbjct: 1676 YIKVENNYDNKKEMNNSDELNGNNNNNNN----KNNNNNNNNNNNNNNNNNNNNNI--NN 1729

Query: 470  KNDKVMKNNFRKGNR------RKYNTNLERLSSDKVNSANE--FRRQNGKTKY 336
              DK  +NNF   N       +    +LE  + +K+N   +  F   + + KY
Sbjct: 1730 GGDKNRRNNFNNNNIYMCKNVKNIILSLELSNEEKINEVRKILFYSSSDEKKY 1782



>gb:AF218248_1252062 Plasmodium falciparum major merozoite surface
           antigen (gp195) gene, complete cds.
          Length = 1694

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 402 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 460

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 461 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 520

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 521 YNVEKQKYNNKFSSSNNSVYNV 542



>gb:AF062349_1237335 Plasmodium falciparum strain HN2 merozoite
           surface protein 1 precursor (msp1) gene, complete cds.
          Length = 1704

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 406 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 464

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 465 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 524

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 525 YNVEKQRYNNKFSSSNNSVYNV 546



>gb:AF062348_1237334 Plasmodium falciparum strain HN1 merozoite
           surface protein 1 precursor (msp1) gene, complete cds.
          Length = 1694

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 402 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 460

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 461 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 520

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 521 YNVEKQRYNNKFSSSNNSVYNV 542



>gb:AC117075_1207742 Dictyostelium discoideum chromosome 2 map
           5201047-5455781 strain AX4, complete sequence.
          Length = 597

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 25/115 (21%), Positives = 46/115 (40%)
 Frame = -2

Query: 665 HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
           ++I    K  N++  +++ N +N     N ++   +    N+ N    N  ++   N+  
Sbjct: 431 NNINNKNKNLNLNVDYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 490

Query: 485 MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           +  NN N+    NN    N    NTN     ++K N  N     N     N+S +
Sbjct: 491 INNNNHNNNNNNNNNNTNNNINNNTN-----NNKSNDNNNHNNTNNNNTNNNSNN 540



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 21/109 (19%), Positives = 44/109 (40%), Gaps = 2/109 (1%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNK--SSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           ++NI    ++ N  N+ L  N   ++   +    N+ N    N  ++   N+     NN 
Sbjct: 423 LDNIDCNNNNINNKNKNLNLNVDYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 482

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N+    NN    N    N N    +++ +N+     + N    +N++ +
Sbjct: 483 NNNNNNNNINNNNHNNNNNNNNNNTNNNINNNTNNNKSNDNNNHNNTNN 531



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 21/104 (20%), Positives = 40/104 (38%), Gaps = 8/104 (7%)
 Frame = -2

Query: 602 DNRTLGRNKSSFEWDT----VKTNSLNRRERN----VTHSGEQNSKGMPYNNKNDKVMKN 447
           +N  +   +S  +WD        N++N + +N    V ++   N+     NN N+    N
Sbjct: 408 NNILIQSQQSPIDWDLDNIDCNNNNINNKNKNLNLNVDYNNNNNNNNNNNNNNNNNNNNN 467

Query: 446 NFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
           N    N    N N    +++  N  N     N     N++ + +
Sbjct: 468 NNNNNNNNNNNNNNNNNNNNNNNINNNNHNNNNNNNNNNTNNNI 511



>gb:AC116986_1207464 Dictyostelium discoideum chromosome 2 map
            2234041-2567370 strain AX4, complete sequence.
          Length = 930

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 25/125 (20%), Positives = 54/125 (43%), Gaps = 4/125 (3%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI++  ++ N  N ++  N ++   +    N+ N    N  ++   N+     NN N+ +
Sbjct: 741  NINNSINNNNNINNSINNNNNNKNNNNNNNNNKNNNNNNNNNNNNNNNNNNNNNNNNNNI 800

Query: 455  ---MKNNFRKGNRRKYNTNLERL-SSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
               + N+         N N+  + +++ +N+ N     N     N+S S +    L S  
Sbjct: 801  NNSINNSINNNINNSINNNINNINNNNNINNINNNNNINNSIN-NNSVSGIRPNILISKN 859

Query: 287  SYEFQ 273
            S++F+
Sbjct: 860  SFKFK 864



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 26/133 (19%), Positives = 48/133 (36%)
 Frame = -2

Query: 725  ELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKT 546
            +L++ E  L     F   V    K Y    N  + ++++N        N ++   +    
Sbjct: 684  DLVRREKSLQDINDFTNNVFLK-KVYNNNNNNKNYYNNKNNSINNKNNNNNNINNNNNNI 742

Query: 545  NSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANE 366
            N+      N+ +S   N+     NN N+    NN    N    N N    +++  N+ N 
Sbjct: 743  NNSINNNNNINNSINNNNNNKNNNNNNNNNKNNNNNNNNNNNNNNNNNNNNNNNNNNINN 802

Query: 365  FRRQNGKTKYNHS 327
                +     N+S
Sbjct: 803  SINNSINNNINNS 815



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 24/102 (23%), Positives = 41/102 (40%), Gaps = 2/102 (1%)
 Frame = -2

Query: 614  DENEDNRTLGRNKS-SFEWDTVKTNSLNRRERNVTHS-GEQNSKGMPYNNKNDKVMKNNF 441
            + N +N+    NK+ S        N++N    N+ +S    N+     NN N+   KNN 
Sbjct: 709  NNNNNNKNYYNNKNNSINNKNNNNNNINNNNNNINNSINNNNNINNSINNNNNN--KNNN 766

Query: 440  RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
               N  K N N    +++  N+ N     N     N   +++
Sbjct: 767  NNNNNNKNNNNNNNNNNNNNNNNNNNNNNNNNNINNSINNSI 808



>gb:AC116919_1206375 Dictyostelium discoideum chromosome 2 map
            complement(6245035-6206343) strain AX4, complete
            sequence.
          Length = 1918

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 23/106 (21%), Positives = 45/106 (42%), Gaps = 1/106 (0%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKT-NSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            N S   ++ N +N ++ +N  +     +K+ N+    + N  ++G   +    YNN N+ 
Sbjct: 942  NNSSNNNNNNNNNISMNKNNMANTPLVIKSPNNSGNNQNNYINNGNNGNNNANYNNNNNN 1001

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               NN    N    N N    +  + N+ N     N K   N++++
Sbjct: 1002 NNNNNNNNNNNNNNNNNSNNYNYHQNNNQNIQNNNNNKNINNNNQN 1047



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 23/120 (19%), Positives = 49/120 (40%), Gaps = 5/120 (4%)
 Frame = -2

Query: 665  HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
            H ++      N S+  ++ N  N     N ++   + +  N++N    N  ++   NS  
Sbjct: 1272 HQLQKSQPTNNNSNNVNNANNMNNNNNMNNNN-NMNNINNNNINHNNNNFNNNNNNNSNN 1330

Query: 485  MPYNNKNDKV-----MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               NN N+K+       +N++  N    N N    +++  N+ N     N    +N++ +
Sbjct: 1331 NNNNNNNNKMNGGYNNYSNYQNNNSNNNNMNNNNNNNNNNNNNNNNNNNNMNNGFNNNNN 1390



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 22/109 (20%), Positives = 44/109 (40%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            ++ N +N     NK +  ++       N    N  ++   N+     NN N+    NN  
Sbjct: 1326 NNSNNNNNNNNNNKMNGGYNNYSNYQNNNSNNNNMNNNNNNNNNNNNNNNNNNNNMNNGF 1385

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
              N    N N     ++ +N+ N   R +G   Y +S + V + +++ +
Sbjct: 1386 NNNNNFNNNNFNNNKNNIINNNNNNIRNSGDGPYYNSTNTVNNNNIRME 1434



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 38/155 (24%), Positives = 58/155 (37%), Gaps = 16/155 (10%)
 Frame = -2

Query: 680 PKGVVHSIKPYGKVENISDGF--------DDENEDNRTLGRNKSSFEWD-TVKTNSLNRR 528
           PK + H     G + N S+          +  NE N     N ++F    T K+NSL  +
Sbjct: 206 PKDITHKRNSTGNIPNNSNNSGLSNIIKNNISNEHNIISNNNNNTFFGPVTSKSNSLFGK 265

Query: 527 ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN------RRKYNTNLERLSSDKVNS-AN 369
             N  +S   N+K    +N ND    NN    N      +   N N   L+S   NS  N
Sbjct: 266 NNN-DNSNNNNNKNNNNDNNNDLANNNNSNNNNSNINNSKNIINNNGNNLTSSNNNSNIN 324

Query: 368 EFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
                N  TK   + +   + ++ ++ S      N
Sbjct: 325 ISAGSNNSTKNTSTSNNNNNNNINNNNSNNINNNN 359



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 24/118 (20%), Positives = 46/118 (38%), Gaps = 9/118 (7%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN----- 471
            N+++  +  N +N  +  N ++F       N+ N    N  ++   N     YNN     
Sbjct: 1298 NMNNNNNMNNINNNNINHNNNNFN------NNNNNNSNNNNNNNNNNKMNGGYNNYSNYQ 1351

Query: 470  ----KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFD 309
                 N+ +  NN    N    N N     ++  N+ N F   N    +N++K+ + +
Sbjct: 1352 NNNSNNNNMNNNNNNNNNNNNNNNNNNNNMNNGFNNNNNFNNNN----FNNNKNNIIN 1405



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 22/108 (20%), Positives = 41/108 (37%), Gaps = 2/108 (1%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK-ND 462
            +N     +  +  N     N++  +      N    + +N   S  Q  K  P NN  N+
Sbjct: 1227 QNYQRNSNQNSNQNPNQNPNQNPNQNPNQNPNQYPNQYQNNPQSTHQLQKSQPTNNNSNN 1286

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVN-SANEFRRQNGKTKYNHSKS 321
                NN    N    N N+  ++++ +N + N F   N     N++ +
Sbjct: 1287 VNNANNMNNNNNMNNNNNMNNINNNNINHNNNNFNNNNNNNSNNNNNN 1334



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 22/98 (22%), Positives = 42/98 (42%), Gaps = 2/98 (2%)
 Frame = -2

Query: 671  VVHSIKPYGKVEN--ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ 498
            V+ S    G  +N  I++G +  N  N     N ++   +    N+ N    N  +  + 
Sbjct: 968  VIKSPNNSGNNQNNYINNGNNGNNNANYNNNNNNNNNNNNNNNNNNNNNNNSNNYNYHQN 1027

Query: 497  NSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDK 384
            N++ +  NN N  +  NN    N    N + + +++DK
Sbjct: 1028 NNQNIQNNNNNKNINNNNQNISNNSSNNISNQNINTDK 1065



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 22/94 (23%), Positives = 40/94 (42%), Gaps = 7/94 (7%)
 Frame = -2

Query: 545 NSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKY------NTNLERLSSDK 384
           N+ N    N  ++   N+     NN N+    NN + GNR  +      N N     ++ 
Sbjct: 431 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNIQNGNRNSFSGQISNNNNNGNNYNNN 490

Query: 383 VNSANEFRRQ-NGKTKYNHSKSAVFDMSLQSDGS 285
           +NS+N      NG T  N+  + + + ++ +  S
Sbjct: 491 INSSNIGNNNVNGTTNNNNISNNISNNNINNKPS 524



>gb:AB116600_1200353 Plasmodium falciparum msp1 gene for merozoite
           surface protein 1, complete cds, isolate:97B220-58.
          Length = 1688

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 396 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 454

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 455 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 514

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 515 YNVEKQKYNNKFSSSNNSVYNV 536



>gb:AB116599_1200352 Plasmodium falciparum msp1 gene for merozoite
           surface protein 1, complete cds, isolate:97P224-30.
          Length = 1688

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 396 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 454

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 455 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 514

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 515 YNVEKQKYNNKFSSSNNSVYNV 536



>gb:PFMAL8P1_1192227 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1774

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 25/110 (22%), Positives = 43/110 (39%)
 Frame = -2

Query: 656  KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPY 477
            +P  K  N+++  ++ N +N     N ++   +    N+ N    N  +S   N+     
Sbjct: 1204 EPDYKENNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNSNNNNSNNNNNSNNNN 1263

Query: 476  NNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
            NN N+    NN    N    N N    +++  NS N     +     NHS
Sbjct: 1264 NNNNNNNNSNN-NNNNSNNNNNNNNNNNNNNNNSNNNNYNNSNNNNNNHS 1312



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 25/107 (23%), Positives = 41/107 (38%), Gaps = 1/107 (0%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            +N+++    EN  N     N ++   +    N+ N    N  +S   NS     NN N+ 
Sbjct: 1200 DNLNEPDYKENNMNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNSNNNNSNNNNNS 1259

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN-GKTKYNHSKS 321
               NN    N    N N    +++  N+ N     N     YN+S +
Sbjct: 1260 NNNNNNNNNNNNSNNNNNNSNNNNNNNNNNNNNNNNSNNNNYNNSNN 1306



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 24/124 (19%), Positives = 48/124 (38%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++  ++ N +N     N ++   ++   NS N    N  +S   N+     NN N+  
Sbjct: 1217 NNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNSNNNNSNNNNNSNNNNNNNNNNNNSNNNN 1276

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
              +N    N    N N    +++  N++N     N  T  +++ + +   +   D S   
Sbjct: 1277 NNSNNNNNNNNNNNNNNNNSNNNNYNNSNN-NNNNHSTLISNNDNTIVSNNDNEDNSNHT 1335

Query: 275  QTEN 264
               N
Sbjct: 1336 TNNN 1339



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 20/99 (20%), Positives = 40/99 (40%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            +++N  N++   N  + +      N  + +E N+ ++   N+     NN N+    NN  
Sbjct: 1179 NNKNSKNKSKNNNDPNKKASGDNLNEPDYKENNMNNNNNNNNNNNNNNNNNNNNNNNNNN 1238

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              N    N +    S++  NS N     N     N++ +
Sbjct: 1239 NNNNSNNNNSNNNNSNNNNNSNNNNNNNNNNNNSNNNNN 1277



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 27/119 (22%), Positives = 45/119 (37%), Gaps = 13/119 (10%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTV--KTNSLNRRERNVTHSGEQ-----------N 495
            N +   ++ N + + L  NK+S + +    K  S N  + N   SG+            N
Sbjct: 1154 NNNSSNNNRNNNGKVLSNNKNSNKGNNKNSKNKSKNNNDPNKKASGDNLNEPDYKENNMN 1213

Query: 494  SKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
            +     NN N+    NN    N    N N    +S+  NS N     N     N++ ++
Sbjct: 1214 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNNNSNNNNSNNNNNSNNNNNNNNNNNNS 1272



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 22/110 (20%), Positives = 42/110 (38%), Gaps = 1/110 (0%)
 Frame = -2

Query: 647  GKVENISDGFDDENEDNRTL-GRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
            G  +N  +   + N+ N+   G N +  ++     N+ N    N  ++   N+     NN
Sbjct: 1178 GNNKNSKNKSKNNNDPNKKASGDNLNEPDYKENNMNNNNNNNNNNNNNNNNNNNNNNNNN 1237

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N+    NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 1238 NNNNNSNNNNSNNNNSNNNNNSNNNNNNNNNNNNSNNNNNNSNNNNNNNN 1287



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 27/122 (22%), Positives = 43/122 (35%), Gaps = 18/122 (14%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N ++   + N  N     N ++   +    N+ N    N  +S   N+     NN N+  
Sbjct: 1237 NNNNNNSNNNNSNNNNSNNNNNSNNNNNNNNNNNNSNNNNNNSNNNNNNNNNNNNNNNNS 1296

Query: 455  MKNNFRKGNRRKYN------TNLERLSSDKVNSAN------------EFRRQNGKTKYNH 330
              NN+   N    N       N   + S+  N  N            + +  N KT+ NH
Sbjct: 1297 NNNNYNNSNNNNNNHSTLISNNDNTIVSNNDNEDNSNHTTNNNEQDKDDKNNNMKTEGNH 1356

Query: 329  SK 324
            SK
Sbjct: 1357 SK 1358



>gb:PFMAL13_1191377 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 596

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 21/84 (25%), Positives = 33/84 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N  +   + N  N+  G     F      +NS N    N   +   N+    YNN N+  
Sbjct: 510 NKRNSMHNNNGMNKNRGGGNKGFFGKKFSSNSNNYNNNNNNGNNYNNNNNNNYNNNNNNN 569

Query: 455 MKNNFRKGNRRKYNTNLERLSSDK 384
             NNF K N++K++       + K
Sbjct: 570 NGNNFNKNNKKKFSKPFNNFKNKK 593



>gb:PFMAL13_1191282 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1442

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 34/156 (21%), Positives = 62/156 (39%), Gaps = 25/156 (16%)
 Frame = -2

Query: 656 KPYGKVENISDGFDDENEDNRT-------------LGRNKSSFEWDTVKTNSLNRRERNV 516
           K YGK  ++S+   +EN D+               +G + SSF+ +T   + +N      
Sbjct: 444 KNYGKDNSLSESEINENSDDNIDDSDYSTNFQKNKMGTDTSSFDTETHTNSMINMNSNTT 503

Query: 515 THSGEQN-----------SKGMPYNNKNDKVMKNNFRKG-NRRKYNTNLERLSSDKVNSA 372
           T++ + N            +  P  +KN  ++ NN  K  +R     NLE+     +N +
Sbjct: 504 TNNEDDNYFDKDNNKINSKESYPRGDKNGYIIHNNVNKNKHRNNKKMNLEKEGKFLLNPS 563

Query: 371 NEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
           N   R  G T     +  +++     +  Y  + EN
Sbjct: 564 NYSERFIGVTS---KQMYIYNDKCDDEPEYVLRIEN 596



>gb:AE014188_968024 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014847_1229416 Plasmodium falciparum 3D7
            chromosome 12, section 4 of 9 of the complete sequence.
          Length = 2432

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 29/126 (23%), Positives = 57/126 (45%), Gaps = 9/126 (7%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM--KNN 444
            D +N++N+    NK++      K N  N+ + N  ++   N+     NN  D ++  KNN
Sbjct: 1328 DIKNKNNKNNKNNKNN---KNNKNNKNNKNKNNNDNNNNNNNNNNNSNNNKDIIILNKNN 1384

Query: 443  FRKGNRRKYNTNLERLSSDKVNSANE-------FRRQNGKTKYNHSKSAVFDMSLQSDGS 285
                N    N+  E+L +D ++   E        R+   + K N  ++   +   +++GS
Sbjct: 1385 INNANIFNINSLKEKLLNDDISKNKEKKKKKCVIRKIKKRNKVNPKRNNNINNRNKNNGS 1444

Query: 284  YEFQTE 267
            Y+  T+
Sbjct: 1445 YKCDTK 1450



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 29/102 (28%), Positives = 49/102 (48%), Gaps = 3/102 (2%)
 Frame = -2

Query: 560  DTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV 381
            D  K NS++    N  +S   N+     NN N+    NN    N R YN + E L+S K 
Sbjct: 718  DNFKHNSISNHNNNNNNSNNNNNS----NNSNNNNNSNNSNNSN-RLYNISSEALNSLKK 772

Query: 380  NSANEFRRQN---GKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
            N +   R QN     + +N++K  V +++  ++ + +F+  N
Sbjct: 773  NDSLYMRLQNIISFSSGHNNTKIKVININNFNNNANKFKNLN 814



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/93 (23%), Positives = 41/93 (44%), Gaps = 4/93 (4%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFE----WDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           S+  +D++ED +   + K  F+     D  K    N+++    +  ++N+K    NN N+
Sbjct: 459 SNNGNDDDEDEKYQNKRKKYFDDCNMKDEHKKEGKNKQKNKKNNKNKKNNKNNNINNINN 518

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEF 363
               NN    N    N N    +++  N+ N F
Sbjct: 519 INNNNNNNNNNSNNNNNNNNNNNNNNNNNNNSF 551



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 27/124 (21%), Positives = 51/124 (41%), Gaps = 3/124 (2%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            ++N +   ++ ++ N +   N +S     V  N+    +  +T +   N+K +PY   N 
Sbjct: 2264 IDNNNQNDNNSSKSNNSNNSNNNSNNQHYVSANADINNDATITFNNPLNNKNVPYQYLNL 2323

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK---YNHSKSAVFDMSLQSD 291
            K  K  F++ N  K   N    S   ++   E ++   K K    NH       +S Q +
Sbjct: 2324 KDKKQTFQQYNHIKDREN----SYPYMHIKGETQQNGMKLKNDINNHHSQNQLSLSKQEN 2379

Query: 290  GSYE 279
              Y+
Sbjct: 2380 NIYK 2383



>gb:AE014187_938934 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014823_1228010 Plasmodium falciparum 3D7
            chromosome 14 section 8 of 13 of the complete sequence.
          Length = 1029

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 36/151 (23%), Positives = 60/151 (39%), Gaps = 7/151 (4%)
 Frame = -2

Query: 656  KPYG---KVENISDGFDDENEDNRTLG-RNKSSFEWDTVKTNSLNRR---ERNVTHSGEQ 498
            KPY    K +NI    D+++E N+ +   NK  +       NS+  +   ER V +    
Sbjct: 667  KPYDERPKSKNIMHKHDEQDEHNKNVKIMNKKKY----CTNNSVQGKSGSERVVGYRSAN 722

Query: 497  NSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
            N+      N N+    NN    N    N N+ R S   +N +++ +     T  +  +  
Sbjct: 723  NNNNNNNKNNNNSSSNNNISSNNMCNKNMNISRKS---LNVSSKIKNDKSITYISFDEIT 779

Query: 317  VFDMSLQSDGSYEFQTEN*ACKLSFRWLKML 225
             FD  + +D   E  +E  A      W K +
Sbjct: 780  NFDFEMNNDYMNEMISELLAITKDHEWTKQI 810



>gb:AE014186_938204 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014839_1228938 Plasmodium falciparum 3D7
            chromosome 11 section 4 of 8 of the complete sequence.
          Length = 2467

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 25/103 (24%), Positives = 44/103 (42%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N +    + N +N     N  S   +   T++ N+   N   S   N+K +  NNK+  +
Sbjct: 2024 NSNKSLSNNNNNNNNNNNNNKSISNNNKSTSNNNKSISNNNKSISNNNKSISSNNKS--I 2081

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
              NN    N  K  +N  + +S+   S N  R+ + K   +H+
Sbjct: 2082 SSNNKSTSNNNKSTSNNNKSTSNNNKSINNHRKVSQKLGGSHT 2124



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 35/146 (23%), Positives = 65/146 (44%), Gaps = 6/146 (4%)
 Frame = -2

Query: 740  EKDGPELLKSE--ADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSF 567
            +KD   + K++  A+L +     KG          V+NI     + + +N+ +  NKS  
Sbjct: 1960 QKDNKNVKKNKHFANLKNVTMLQKGKA--------VKNIPINNKNASHNNKVVNSNKSV- 2010

Query: 566  EWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR--KGNRRKYNTNLERLS 393
                   N+ N+   N   S   N+     NN N+K + NN +    N +  + N + +S
Sbjct: 2011 --SNNNNNNNNKSTSNSNKSLSNNNNNNNNNNNNNKSISNNNKSTSNNNKSISNNNKSIS 2068

Query: 392  SD--KVNSANEFRRQNGKTKYNHSKS 321
            ++   ++S N+    N K+  N++KS
Sbjct: 2069 NNNKSISSNNKSISSNNKSTSNNNKS 2094



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 27/128 (21%), Positives = 58/128 (45%), Gaps = 11/128 (8%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK-- 468
            + N ++  ++ N +N+++  N  S   +    ++ N+   N   S   N+K +  NNK  
Sbjct: 2029 LSNNNNNNNNNNNNNKSISNNNKSTSNNNKSISNNNKSISNNNKSISSNNKSISSNNKST 2088

Query: 467  --NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN-------GKTKYNHSKSAV 315
              N+K   NN +  +    + N  R  S K+  ++ F +++        K K  + K  +
Sbjct: 2089 SNNNKSTSNNNKSTSNNNKSINNHRKVSQKLGGSHTFCKKSISSQLVASKIKETNPKRQL 2148

Query: 314  FDMSLQSD 291
             D+ +++D
Sbjct: 2149 QDVRVEND 2156



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 35/142 (24%), Positives = 62/142 (43%), Gaps = 8/142 (5%)
 Frame = -2

Query: 677  KGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ 498
            K   H+ K     +++S+  ++ N +  T   NKS         N+ N    N   S   
Sbjct: 1995 KNASHNNKVVNSNKSVSNN-NNNNNNKSTSNSNKS-----LSNNNNNNNNNNNNNKSISN 2048

Query: 497  NSKGMPYNNK----NDKVMKNNFR--KGNRRKYNTNLERLSSDKVNSANEFR--RQNGKT 342
            N+K    NNK    N+K + NN +    N +  ++N +  S++  +++N  +    N K+
Sbjct: 2049 NNKSTSNNNKSISNNNKSISNNNKSISSNNKSISSNNKSTSNNNKSTSNNNKSTSNNNKS 2108

Query: 341  KYNHSKSAVFDMSLQSDGSYEF 276
              NH K     +S +  GS+ F
Sbjct: 2109 INNHRK-----VSQKLGGSHTF 2125



>gb:BX842642_822307 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 1/4.
          Length = 272

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 26/100 (26%), Positives = 50/100 (50%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K+ ++   ++D+ +  +   +N +      +KT SL   E  V++  +QN K +     N
Sbjct: 83  KISSLKISYNDQIDQIKEFKKNHN-----LLKTISLKELEDKVSNLDDQNKKALKQIEHN 137

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGK 345
           DK++K N  K N   Y TNL+   S ++ +  + + +N K
Sbjct: 138 DKLLKANQDKLN---YLTNLKNQYSKQITTLEQNKNENLK 174



>pir|S50977|S50977 hypothetical protein YDL005c - yeast
           (Saccharomyces cerevisiae)>gb:AY558156_1614383
           Saccharomyces cerevisiae clone FLH110952.01X YDL005C
           gene, complete cds.>gb:SC8119_1705430 S.cerevisiae
           chromosome IV cosmid 8119.>gb:SCCHRIV42_1706970 S.
           cerevisiae chromosome IV left arm (EU) DNA segment
           (41372 bp).>gb:SCYDL005C_1711561 S.cerevisiae chromosome
           IV reading frame ORF YDL005c.
          Length = 431

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 29/107 (27%), Positives = 41/107 (38%), Gaps = 6/107 (5%)
 Frame = -2

Query: 623 GFDDENEDNRTLGRNKSSFE------WDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           GFDD +  N     N SS E       ++ K    N  E N  ++G++ +K    NN  D
Sbjct: 260 GFDDNDSGNNYNDINISSIENNINNNINSTKNGKDNNNESNKNNNGDEKNK----NNNED 315

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               NN  + N    N N      +  N+ N     N  T  N S +
Sbjct: 316 NENNNNSSEKNNNNNNNNNNNNDDNGNNNNNNSGNDNNNTTNNDSNN 362



>pir|A90570|A90570 lipoprotein [imported] - Mycoplasma pulmonis
           (strain UAB CTIP)>gb:MPULM02_149978 Mycoplasma pulmonis
           (strain UAB CTIP) complete genome; segment 2/3.
          Length = 622

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 26/115 (22%), Positives = 54/115 (46%), Gaps = 5/115 (4%)
 Frame = -2

Query: 638 ENISDGFDDENE---DNRTLGRNKSSFEWDTVKTNSLNRRERNVTH--SGEQNSKGMPYN 474
           +NIS   D++N+   DN     N S  + D ++ N+ ++   NV    + ++NS      
Sbjct: 133 DNISSKEDEKNKNPKDNENSNNNSSDQKNDELQKNNSDKLNDNVQDEKANKENSNSNDSK 192

Query: 473 NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFD 309
            KND+      +  N++K + + +++  +K N+ N  + +N         + +FD
Sbjct: 193 EKNDENTNKIQQDQNQQKEDQDTKQIEQEKQNNLNSNKNENLNNSTKIFSNKIFD 247



>pir|A26868|A26868 major merozoite surface antigen precursor -
           malaria parasite (Plasmodium falciparum) (strain
           MAD20/papua New Guinea)
          Length = 1701

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 402 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 460

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 461 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 520

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 521 YNVEKQRYNNKFSSSNNSVYNV 542



>sp|P40467|YIN0_YEAST Putative 108.8 kDa transcriptional regulatory
            protein in FKH1-STH1 intergenic region.>pir|S48404|S48404
            probable membrane protein YIL130w - yeast (Saccharomyces
            cerevisiae)>gb:SC4357_1705281 S.cerevisiae chromosome IX
            lambda clones 4357-3717.
          Length = 964

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 26/105 (24%), Positives = 42/105 (40%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            NI D  DD    N       S+F++ + K+N+ N    +  ++   N  G   NN N   
Sbjct: 781  NILDATDDVFIRNDGDIPTNSAFDFSSSKSNASNNSNPDTINNNYNNVSGKNNNNNNITN 840

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              NN    N    N N    +++  N+ N     N     N++K+
Sbjct: 841  NSNNNHNNNNNDNNNNNNNNNNNNNNNNNSGNSSNNNNNNNNNKN 885



>sp|P08569|MSP1_PLAFM Merozoite surface protein 1 precursor
           (Merozoite surface antigens) (PMMSA)
           (P190).>gb:PFP190G1_1394928 Plasmodium falciparum p190
           gene for p190 surface antigen precursor.
          Length = 1701

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 402 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 460

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 461 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 520

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 521 YNVEKQRYNNKFSSSNNSVYNV 542



>sp|P13819|MSP1_PLAFF Merozoite surface protein 1 precursor
           (Merozoite surface antigens) (PMMSA).>pir|A54498|A54498
           major merozoite surface antigen precursor - malaria
           parasite (Plasmodium falciparum) (isolate
           FC27)>gb:PFAMMSAA_1393876 P.falciparum major merozoite
           surface antigen (PMMSA) mRNA, complete cds, isolate
           FC27.
          Length = 1701

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 402 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 460

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 461 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 520

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 521 YNVEKQRYNNKFSSSNNSVYNV 542



>sp|Q16992|LWA_ANTEL LWamide neuropeptides precursor [Contains:
           LWamide I; Metamorphosin A (LWamide II) (MMA); LWamide
           III; LWamide IV; LWamide V; LWamide VI; LWamide VII;
           LWamide VIII; LWamide IX].>gb:AEU34781_1230381
           Anthopleura elegantissima Antho-LWamidII preprohormone
           mRNA, complete cds, encoding multiple metamorphosin A
           peptides.
          Length = 514

 Score = 21.2 bits (43), Expect(8) = 0.19
 Identities = 14/30 (46%), Positives = 15/30 (50%)
 Frame = +1

Query: 697 GRSASDLSNSGPSFSDHISNPPGLWNRSAN 786
           GRSA  L    P       NP GLW RSA+
Sbjct: 258 GRSADPLQ---PGLWGKRQNP-GLWGRSAD 283



 Score = 20.8 bits (42), Expect(8) = 0.19
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 760 PGLWNRSANT 789
           PGLW RSA +
Sbjct: 462 PGLWGRSAGS 471



 Score = 20.8 bits (42), Expect(8) = 0.19
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 760 PGLWNRSAN 786
           PGLW RSA+
Sbjct: 441 PGLWGRSAD 449



 Score = 20.8 bits (42), Expect(8) = 0.19
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 760 PGLWNRSAN 786
           PGLW RSA+
Sbjct: 420 PGLWGRSAD 428



 Score = 20.8 bits (42), Expect(8) = 0.19
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 760 PGLWNRSAN 786
           PGLW RSA+
Sbjct: 399 PGLWGRSAD 407



 Score = 20.8 bits (42), Expect(8) = 0.19
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 760 PGLWNRSAN 786
           PGLW RSA+
Sbjct: 357 PGLWGRSAD 365



 Score = 20.8 bits (42), Expect(8) = 0.19
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 760 PGLWNRSAN 786
           PGLW RSA+
Sbjct: 317 PGLWGRSAD 325



 Score = 20.8 bits (42), Expect(8) = 0.19
 Identities = 7/9 (77%), Positives = 8/9 (88%)
 Frame = +1

Query: 760 PGLWNRSAN 786
           PGLW RSA+
Sbjct: 296 PGLWGRSAD 304



>gb:PFA929357_1393455 Plasmodium falciparum strain 3D7, chromosome
           9; segment 3/5.
          Length = 357

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 24/109 (22%), Positives = 43/109 (39%), Gaps = 2/109 (1%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNK--SSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           V N ++   D+N+ N  +  NK  S  +  + + N  N    N  ++   N+     NN 
Sbjct: 98  VTNKNNNISDKNQHNNNININKRNSISKGTSRRHNHNNNNNNNNNNNNNNNNNNNNNNNN 157

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N+    NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 158 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 206



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 26/119 (21%), Positives = 47/119 (39%), Gaps = 3/119 (2%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 148 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 207

Query: 455 MKNNFRKGNRRKYNTNLERLSS---DKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
             NN    N   Y + LE L++    K  S  E   +N   ++  S S  +   + S G
Sbjct: 208 NNNNNNNNNDDDYYSILEELANLEKPKFRSVQESMDENLNLEFLKSSSENYTYKITSRG 266



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 22/104 (21%), Positives = 37/104 (35%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K  +IS G    +  N     N ++   +    N+ N    N  ++   N+     NN N
Sbjct: 119 KRNSISKGTSRRHNHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 178

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           +    NN    N    N N    +++  N+ N     N    Y+
Sbjct: 179 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDDDYYS 222



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 2/98 (2%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTV-KTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK-NNFRK 435
           +++N+    NK+++ ++T+ KTN    ++RN             YN KN   +K NN  K
Sbjct: 12  SKNNKYNYENKNNYSYNTINKTNQGISKKRN------------SYNKKNVPTIKENNNNK 59

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N  K N N    +++  N+ N  +  N     N + S
Sbjct: 60  NNNHKINNNNNNKNNNNNNNKNNNKCANHNNHLNKNNS 97



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 23/107 (21%), Positives = 46/107 (42%), Gaps = 11/107 (10%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWD---TVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           N+ N+ + + ++S+      T+K N+ N+   +  ++   N      NNKN+    N+  
Sbjct: 31  NKTNQGISKKRNSYNKKNVPTIKENNNNKNNNHKINNNNNNKNNNNNNNKNNNKCANHNN 90

Query: 437 KGNRRKYNTNLERLSSDK--------VNSANEFRRQNGKTKYNHSKS 321
             N+    TN     SDK        +N  N   +   + ++NH+ +
Sbjct: 91  HLNKNNSVTNKNNNISDKNQHNNNININKRNSISKGTSR-RHNHNNN 136



>gb:PFA929351_1392950 Plasmodium falciparum strain 3D7, chromosome 5,
            segment 1/4.
          Length = 2349

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 4/97 (4%)
 Frame = -2

Query: 605  EDNRTLGRNKSSFEWDTVKTNSLNRR--ERNVTHSGEQNSKGMPY--NNKNDKVMKNNFR 438
            +DN  +G   S + +D  K N+ N +  + N     +QN+    Y  NN NDK   NN+ 
Sbjct: 2042 QDNNYIG--VSLYNYDKSKQNNYNDKYNDNNYNDKYKQNNYNDKYKQNNYNDKYNDNNYN 2099

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
              ++ K N   ++ + +  N       +N  T+YNH+
Sbjct: 2100 --DKYKQNNYNDKYNDNNYNGVYAKIHKNNNTQYNHN 2134



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 26/109 (23%), Positives = 48/109 (44%), Gaps = 3/109 (2%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR--ERNVTHSGEQNSKGMPYNN 471
            K  N +D ++D N +++    N +    D  K N+ N +  + N     +QN+    YN+
Sbjct: 2058 KQNNYNDKYNDNNYNDKYKQNNYN----DKYKQNNYNDKYNDNNYNDKYKQNNYNDKYND 2113

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSD-KVNSANEFRRQNGKTKYNHS 327
             N   +     K N  +YN N+   + D  V   N+  + +    YN++
Sbjct: 2114 NNYNGVYAKIHKNNNTQYNHNILPTNKDLLVFKTNQQSKHHTDILYNNN 2162



>gb:CR382399_1374948 Plasmodium falciparum chromosome 6, complete
           sequence; segment 2/5.
          Length = 656

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 21/83 (25%), Positives = 35/83 (42%)
 Frame = -2

Query: 578 KSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLER 399
           K+ ++    K  +  R + N  ++   N+     NN N+    NN    N   Y    ++
Sbjct: 551 KTKYDNFRKKLKNKTRNKHNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNYYYYHKNKQ 610

Query: 398 LSSDKVNSANEFRRQNGKTKYNH 330
              DK +  N+  RQN + K NH
Sbjct: 611 NKQDKQDKQNKLNRQNKQNKQNH 633



>gb:AC117072_1207647 Dictyostelium discoideum chromosome 2 map
           3879572-4071762 strain AX4, complete sequence.
          Length = 635

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 25/110 (22%), Positives = 43/110 (39%), Gaps = 5/110 (4%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGR-NKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPY----NN 471
           NI++  ++ N +N   G  N +S   +    N+ N    N+ +S   NS         N 
Sbjct: 163 NINNNTNNSNTNNSNTGNSNINSSNTNNSNINNSNTNNSNINNSNTSNSNTNSNINSSNT 222

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N   + NN    N    NTN   ++S   ++ N     N     N++ +
Sbjct: 223 NNSNTINNNTNNSNINNNNTNNSNINSSNSSNTNNNNNNNNNNNNNNNNN 272



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 3/92 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDN-RTLGRNKSSFEWDTVKTNSLNRRERNV--THSGEQNSKGMPYNNKN 465
           N +   +  N +N  T+  N ++   +   TN+ N    N   T++   N+     NN N
Sbjct: 212 NTNSNINSSNTNNSNTINNNTNNSNINNNNTNNSNINSSNSSNTNNNNNNNNNNNNNNNN 271

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
           +    NN    N    NTN    S++ +N++N
Sbjct: 272 NNNNNNNNNNNNNNNNNTNNSNSSNNNINNSN 303



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 20/105 (19%), Positives = 40/105 (38%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + N +    + N +  +   N S+   +    +++N    N ++    NS     NN N+
Sbjct: 203 INNSNTSNSNTNSNINSSNTNNSNTINNNTNNSNINNNNTNNSNINSSNSSNTNNNNNNN 262

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
               NN    N    N N    +++  N++N        +  N+S
Sbjct: 263 NNNNNNNNNNNNNNNNNNNNNNNNNNTNNSNSSNNNINNSNINNS 307



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 25/108 (23%), Positives = 43/108 (39%), Gaps = 1/108 (0%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +   TN+ N    N+ +S   NS     N  N  +
Sbjct: 260 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNNSNSSNNNINNSNINNS-----NINNSNI 314

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN-HSKSAV 315
             NN    N    NTN     +   N++N     N  T  N H+ + +
Sbjct: 315 NNNNINNINNNVSNTN-----NSNTNNSNIKNTNNNNTNINDHNNTTI 357



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 23/99 (23%), Positives = 40/99 (40%), Gaps = 6/99 (6%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGR---NKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPY---N 474
           N ++  ++ N  N  +     N S+     +  N++N    NV+++   N+        N
Sbjct: 284 NNNNNTNNSNSSNNNINNSNINNSNINNSNINNNNINNINNNVSNTNNSNTNNSNIKNTN 343

Query: 473 NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRR 357
           N N  +  +N    N    N N+   SS K N  NE  +
Sbjct: 344 NNNTNINDHNNTTINNNNNNNNVSS-SSSKSNKINEIEK 381



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 24/105 (22%), Positives = 42/105 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++  ++ N +N     N  +   +   TN+ N    N+  S   NS     NN N   
Sbjct: 146 NINNNINNNNNNNNI--NNNINNNTNNSNTNNSNTGNSNINSSNTNNSN---INNSNTN- 199

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             +N    N    NTN   ++S   N++N        +  N++ +
Sbjct: 200 -NSNINNSNTSNSNTN-SNINSSNTNNSNTINNNTNNSNINNNNT 242



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 23/109 (21%), Positives = 43/109 (39%), Gaps = 5/109 (4%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNS-LNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
           SD  DD    N+ +  N ++   +    N+ +N    N +++   N      NN N+  +
Sbjct: 101 SDSDDDRYNTNKNIQNNNNNNNNNNYNNNNNINNIINNNSNTNNSNINNNINNNNNNNNI 160

Query: 452 KNNFRKG----NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
            NN        N    NT    ++S   N++N        +  N+S ++
Sbjct: 161 NNNINNNTNNSNTNNSNTGNSNINSSNTNNSNINNSNTNNSNINNSNTS 209



>gb:AC116984_1207315 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 766

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 31/132 (23%), Positives = 52/132 (39%), Gaps = 17/132 (12%)
 Frame = -2

Query: 620 FDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNF 441
           FD++   N  L    + F ++    ++ N    N  ++   N+     NN N+    NN 
Sbjct: 112 FDNQTNINNYL----NGFNFNNFMNSNFNNNNNNNNNNNNNNNNNNNNNNNNNN-NNNNN 166

Query: 440 RKGNRRKYNTNLERLS-----------SDKVNSANEFRRQNGKTKYNHSKSAVFDMS--- 303
              N   YN NL  L+           + ++NS N     N    YN+   + FD S   
Sbjct: 167 NNNNSNNYNNNLNSLNNINNLNNQNFQNYQINSNNLNNLNNSNNNYNNEFLSFFDYSNPI 226

Query: 302 ---LQSDGSYEF 276
              L+++ + EF
Sbjct: 227 EDILKNNSNIEF 238



>gb:AC116977_1207016 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 757

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 31/135 (22%), Positives = 55/135 (40%), Gaps = 10/135 (7%)
 Frame = -2

Query: 671 VVHSIKPYGKVENIS--DGFDD--ENEDNRTLGRNKSS---FEWDTVKTNSLNRRERNVT 513
           +VH+ KP     NI+  D  ++  EN  N +   N ++      +T  TNS N    N  
Sbjct: 238 IVHN-KPLNDSTNITSTDNIENKSENSSNNSSNNNNNNNNDNNNNTGNTNSNNNNSSNNN 296

Query: 512 HSGEQNSKGMPYNNKNDKV---MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKT 342
           ++   N+     NN N+ +   + NN    N    N N    +++  N+ N     N   
Sbjct: 297 NNNNNNNNNNNNNNNNNNINNNINNNSNNNNNNNINNNNSNNNNNNNNNNNNSNNNNNSN 356

Query: 341 KYNHSKSAVFDMSLQ 297
             N+ ++   D  ++
Sbjct: 357 NNNNEENLSKDKKIE 371



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 30/120 (25%), Positives = 45/120 (37%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           V+ I DG +D+ E   + G + S  E               +THS + N   +  NN N 
Sbjct: 499 VDEIFDGLNDQVESIDSSGESISLLE--------------KITHSSKNNINSV--NNVNS 542

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSY 282
               NN    N    NTN    +++   S +     N     + + S+    S  SD SY
Sbjct: 543 NNNNNNNNNNNINNTNTNANTNNNNNGTSRSNSGNINNHNNNDKTTSSSTHSSSSSDASY 602



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 20/90 (22%), Positives = 36/90 (40%), Gaps = 5/90 (5%)
 Frame = -2

Query: 581 NKSSFEWDTVKTNSLNRRERNVT-----HSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKY 417
           N+S+ +++ +  N       N+T      +  +NS     NN N+    NN   GN    
Sbjct: 229 NQSNMDYEVIVHNKPLNDSTNITSTDNIENKSENSSNNSSNNNNNNNNDNNNNTGNTNSN 288

Query: 416 NTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
           N N    +++  N+ N     N     N++
Sbjct: 289 NNNSSNNNNNNNNNNNNNNNNNNNNNINNN 318



>gb:AC116977_1206941 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 1163

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 23/109 (21%), Positives = 47/109 (43%), Gaps = 6/109 (5%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSF---EWDTVKTNSLNRRERNVT-HSGEQNSKGMPYNNKNDKVMK 450
           ++ N +N  +  N+ SF   + + +    +N+ + +   H+   N+  M +NN +  +  
Sbjct: 449 NNNNNNNNNINNNQPSFSMMDQNQMYIGQMNQNQMDFNNHNNNNNNNNMDFNNMDFNINN 508

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANE--FRRQNGKTKYNHSKSAVFD 309
           NN    N   YN N    +++ +N+ N       N    YN+     F+
Sbjct: 509 NN---NNNNIYNNNNNNNNNNNINNNNNNNINNNNNSNNYNNEDDEEFN 554



>gb:AC115598_1205758 Dictyostelium discoideum chromosome 2 map
            581427-735498 strain AX4, complete sequence.
          Length = 1407

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 24/126 (19%), Positives = 51/126 (40%), Gaps = 4/126 (3%)
 Frame = -2

Query: 677  KGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ 498
            +G+ +S        N+    ++ N +N     N ++   +    N+ N+   N  ++   
Sbjct: 1075 QGIFNSTNTKSSSSNLPTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNNNQNNNNN 1134

Query: 497  NSKG----MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             +K     +P NN N+    NN    N    N N     ++  N+ N  ++Q  + + N+
Sbjct: 1135 QNKSQQQKIPNNNNNNNNNNNNNNNNNNNNNNNNNNNNINNNNNNNNNQQQQQQQQQINN 1194

Query: 329  SKSAVF 312
              S ++
Sbjct: 1195 YHSNIY 1200



>gb:AC115592_1205743 Dictyostelium discoideum chromosome 2 map
            1-125959 strain AX4, complete sequence.
          Length = 3446

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 26/89 (29%), Positives = 38/89 (42%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            NE       N  SF+ D+ K N+ N    N  ++   N+     NN N+    NN    N
Sbjct: 2415 NETTNIDKTNTVSFDGDSSKNNNNNNNNNNNNNNNNNNNN----NNNNNNNNNNNNNNNN 2470

Query: 428  RRKYNTNLERLSSDKVNSANEFRRQNGKT 342
                N N E  S+D  +++N     +GKT
Sbjct: 2471 NNNNNNNGENKSNDTSSNSNGL-SDSGKT 2498



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 25/100 (25%), Positives = 42/100 (42%), Gaps = 1/100 (1%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTV-KTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNF 441
            ++ N +N +LG   +  E   + KTN+       V+  G+ +      NN N+    NN 
Sbjct: 2399 NNNNNNNSSLGSTGNVNETTNIDKTNT-------VSFDGDSSKN----NNNNNNNNNNNN 2447

Query: 440  RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               N    N N    +++  N+ N     NG+ K N + S
Sbjct: 2448 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGENKSNDTSS 2487



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 24/125 (19%), Positives = 48/125 (38%), Gaps = 7/125 (5%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQN-------SKGM 483
            V  ++   D+ N +N  +  N  +   +T   N+ N    ++  +G  N       +  +
Sbjct: 2367 VSPLTTSLDNNNNNNINVQDNNLTSIEETSTVNNNNNNNSSLGSTGNVNETTNIDKTNTV 2426

Query: 482  PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
             ++  + K   NN    N    N N    +++  N+ N     N     N+ ++   D S
Sbjct: 2427 SFDGDSSKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGENKSNDTS 2486

Query: 302  LQSDG 288
              S+G
Sbjct: 2487 SNSNG 2491



>gb:AC114263_1205633 Dictyostelium discoideum chromosome 2 map
           215673-367476 strain AX4, complete sequence.
          Length = 261

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 20/107 (18%), Positives = 43/107 (40%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           V ++++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+
Sbjct: 135 VNHLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 194

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               NN    N    N N    +++  N+ N   + N  +  N+  +
Sbjct: 195 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNN 241



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 20/105 (19%), Positives = 41/105 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 150 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 209

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N+ N+    N     N++ +
Sbjct: 210 NNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNN 254



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 21/100 (21%), Positives = 39/100 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 162 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 221

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY 336
             NN    N    N N +  +++  N+ N     N   KY
Sbjct: 222 NNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNNNNKNLKY 261



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 21/101 (20%), Positives = 37/101 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 158 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 217

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
             NN    N  K N N    + +  N+ N     N     N
Sbjct: 218 NNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNNNNKN 258



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 21/103 (20%), Positives = 38/103 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 153 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 212

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             NN    N    N N    +S+  N  N     N     N++
Sbjct: 213 NNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNNN 255



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 21/104 (20%), Positives = 38/104 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 157 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 216

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
             NN    N    N N    ++D  N+ N     N      + K
Sbjct: 217 NNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNNNNKNLK 260



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 20/105 (19%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 152 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 211

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N +  ++   N+ N     N     N++ +
Sbjct: 212 NNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNNNN 256



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 21/105 (20%), Positives = 39/105 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 148 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 207

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    + +  NS N     N     N++ +
Sbjct: 208 NNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNN 252



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 20/105 (19%), Positives = 41/105 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 146 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 205

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++K N+ +     N     N++ +
Sbjct: 206 NNNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNN 250



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 20/105 (19%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 147 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 206

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    ++   N++N     N     N++ +
Sbjct: 207 NNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNN 251



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 20/105 (19%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 142 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 201

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 202 NNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNN 246



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 20/105 (19%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 154 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 213

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N      S++  ++ N     N     N++K+
Sbjct: 214 NNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNNNNKN 258



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 19/105 (18%), Positives = 41/105 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 151 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 210

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N  + +++  N+ +     N     N++ +
Sbjct: 211 NNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNNNN 255



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 20/105 (19%), Positives = 39/105 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 143 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 202

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N  N     N     N++ +
Sbjct: 203 NNNNNNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNN 247



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 19/105 (18%), Positives = 40/105 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 145 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 204

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N+ N     +     N++ +
Sbjct: 205 NNNNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNN 249



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 19/107 (17%), Positives = 42/107 (39%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           + N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+
Sbjct: 138 LNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 197

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
               NN    N    N N    +++  N+ N+    +     N++ +
Sbjct: 198 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNN 244



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 19/105 (18%), Positives = 39/105 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 149 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 208

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N     ++  ++ N     N     N++ +
Sbjct: 209 NNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNNNNNNN 253



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 19/105 (18%), Positives = 39/105 (37%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 144 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 203

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++   + N     N     N++ +
Sbjct: 204 NNNNNNNNNNNNNNNNNNNNNNNNNKNNNNSNNNNDNNNNNNNNN 248



>gb:PFMAL7P1_1191771 Plasmodium falciparum 3D7 chromosome 7, ***
           SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 2283

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 2/112 (1%)
 Frame = -2

Query: 656 KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPY 477
           K Y    N +D  ++ N +N     N +         N+ N    N  ++ + +S    Y
Sbjct: 399 KKYMSHYNNNDNNNNNNNNNNNNNNNNN---------NNNNNNSHNNNYNNQPHSNNYYY 449

Query: 476 NNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV--NSANEFRRQNGKTKYNHS 327
           NNK++  + NN  K +   Y  N +R +SD +  N+ N        T YN++
Sbjct: 450 NNKSNDNLNNN--KTSSSSYAPNFKRETSDDISNNNINYNNTNYNNTNYNNT 499



>gb:AE014188_967840 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014844_1229232 Plasmodium
           falciparum 3D7 chromosome 12, section 1 of 9 of the
           complete sequence.>gb:AF373219_1266447 Plasmodium
           falciparum origin recognition complex 1 protein (orc1)
           gene, complete cds.
          Length = 1189

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 5/111 (4%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDT-VKTNSLNRR----ERNVTHSGEQNSKGMPYN 474
           +N+ +   +   +N TL R+  S   D+ + +   N+R    E+N+ H    N+     N
Sbjct: 306 DNVKNNLKNNINNNNTLKRSSQSVRIDSDLSSAHQNKRIKYDEKNIIHRNNNNN-----N 360

Query: 473 NKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N N+K   NN  K N+   N   E     K  +  +        KYN +K+
Sbjct: 361 NNNNKTTSNNHNKNNKINNNNPSENY---KKQTDTKHTNNTQNNKYNKTKT 408



>gb:AE014187_938973 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014824_1228049 Plasmodium falciparum 3D7
           chromosome 14 section 9 of 13 of the complete sequence.
          Length = 1923

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 28/145 (19%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTV----------------KTNSLNRRERNVTHSGEQ 498
           SD +  +N       +NKS   ++ V                 TN++ ++ +N T +   
Sbjct: 257 SDFYQTQNSYVENYMKNKSELAYENVIKKIYECVYTYPHYQDNTNNIIKK-KNATSTRND 315

Query: 497 NSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLER----LSSDKVNSANEFRRQNGKTKYNH 330
           +   MP ++K+D   KNN  +G ++  +TN  +    +SSD     +  RRQ  K+KY  
Sbjct: 316 DISTMPQSDKSDTYNKNNSNEGKKKSMHTNHLKNGISISSDDDIFISMKRRQKKKSKYEE 375

Query: 329 S------KSAVF--DMSLQSDGSYE 279
           +      K   F  D+++  + +YE
Sbjct: 376 NMYKLKPKEQYFFNDINIYDEETYE 400



>gb:AE014186_938076 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014837_1228810 Plasmodium falciparum 3D7
            chromosome 11 section 2 of 8 of the complete sequence.
          Length = 1483

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 24/96 (25%), Positives = 38/96 (39%)
 Frame = -2

Query: 584  RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
            RN SS      K N     E ++ ++     K M      D + +N   KGN  +YN N+
Sbjct: 809  RNDSSSNMRGQKMNEKKNVENDLLNNDRDGLKNMDDEEGYDNINRNMNSKGNTERYNNNI 868

Query: 404  ERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQ 297
                       N     N  + YN++   ++D SL+
Sbjct: 869  N----------NNNNNNNNNSSYNYNMENLYDSSLK 894



 Score = 38.9 bits (89), Expect = 0.22
 Identities = 27/97 (27%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKN-NFR 438
           ++N  N  + +N ++ E + +   S N+   N+ HSG  NS  M  N+ N+K M N N +
Sbjct: 603 NKNNANNNMKKNMNNLESNNM---SGNKNLANLNHSGNTNSNNM-VNDMNNKKMNNVNNK 658

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             N+   N N+ R  S+  N+  +  ++N      H+
Sbjct: 659 NFNKNMDNNNITRDFSNLKNNTPDDNKKNINVSVIHN 695



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 5/115 (4%)
 Frame = -2

Query: 620 FDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG---MPYNNKNDKVMK 450
           +   N  NR    N +         N++N    N  ++   N+K    M  NN N+ + K
Sbjct: 554 YKKNNNTNRNFNYNNNFANNTKNNNNNINNNNNNNNNNNNNNTKKIFMMNKNNANNNMKK 613

Query: 449 N-NFRKGNRRKYNTNLERLS-SDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
           N N  + N    N NL  L+ S   NS N     N K K N+  +  F+ ++ ++
Sbjct: 614 NMNNLESNNMSGNKNLANLNHSGNTNSNNMVNDMNNK-KMNNVNNKNFNKNMDNN 667



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 30/131 (22%), Positives = 53/131 (40%), Gaps = 4/131 (3%)
 Frame = -2

Query: 665 HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
           H  +   K + + +  ++ N  N   G N  +   +    N+ N    N  ++   N+  
Sbjct: 236 HVNQKQNKFKKMINRNNNNNFSNIRQGNNNMNNIMNNYNGNNNNNSNNNNNNNNSSNNNH 295

Query: 485 MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV----NSANEFRRQNGKTKYNHSKSA 318
           M  NN N+  M N+    N   +N N + +  D +    N+ N    QN    YN+ K +
Sbjct: 296 MSNNNNNNNNMYNHM-NNNNPFFNDNNKNMKMDMMKNVGNTINNNMNQN--FNYNNIKGS 352

Query: 317 VFDMSLQSDGS 285
             + + Q  GS
Sbjct: 353 YLNNNQQVGGS 363



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 7/120 (5%)
 Frame = -2

Query: 668 VHSIKPYGKVENISDGFDDENEDNRTLGRN-------KSSFEWDTVKTNSLNRRERNVTH 510
           ++ +   GK       FD+  + NR+L  N        +SFE  T+    +N+ +    H
Sbjct: 178 INILNKKGKTAAAYVEFDNIEDMNRSLELNGKMIYSGNNSFEHGTISV-IINKDKMKNFH 236

Query: 509 SGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
             ++ +K     N+N+    +N R+GN    N  +   + +  N++N     N  +  NH
Sbjct: 237 VNQKQNKFKKMINRNNNNNFSNIRQGN-NNMNNIMNNYNGNNNNNSNNNNNNNNSSNNNH 295



>gb:AE014185_937631 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014829_1228365 Plasmodium falciparum 3D7
           chromosome 10 section 1 of 7 of the complete sequence.
          Length = 1131

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 11/115 (9%)
 Frame = -2

Query: 632 ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRE-------RNVTHSGEQNSKGM-PY 477
           +++  D  N +N T   N  +    T   +++N+ E       RN  +    NS  +   
Sbjct: 207 LNNSHDIHNNNNNTTSINHKNVNTHTQNIHNINKEEHDKNIPDRNYLNENIMNSNNIHTN 266

Query: 476 NNKNDKVMKNNFRKGNRRKYNTNLERLS-SDKVNSANEFRRQNGKTK--YNHSKS 321
           NNKN   +  N   GN    N NL   + S+ + + N F   N +    YN+SK+
Sbjct: 267 NNKNCHNLSENDMNGNHFDANNNLNSHNLSENIMNGNNFDTNNSQNNLLYNYSKT 321



>pir|T18489|T18489 hypothetical protein C0820w - malaria parasite
            (Plasmodium falciparum)>gb:PFMAL3P6_1394558 Plasmodium
            falciparum MAL3P6, complete sequence.
          Length = 4981

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 4/111 (3%)
 Frame = -2

Query: 611  ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP-YNNKNDKVMKNNFRK 435
            EN+ N  + RN      D       +  + N T   E+N KG P YNN N+    NN   
Sbjct: 2897 ENKSNYNIERNNMDKATDLYDNYVSDMTKENRTLGHEENEKGTPKYNNNNNNNNNNNI-- 2954

Query: 434  GNRRKYNTNLERLSS---DKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
             N +  +++  R SS   D  N  N    +NG+   N+S S V   + + D
Sbjct: 2955 NNSKGSDSSNGRDSSNGRDSSNGRNSRNGRNGRNGPNNSCSFVEGYNKKGD 3005



 Score = 38.5 bits (88), Expect = 0.28
 Identities = 26/110 (23%), Positives = 50/110 (45%), Gaps = 3/110 (2%)
 Frame = -2

Query: 689  RFFPKGVVHSIKPYGKVENISDGFDD---ENEDNRTLGRNKSSFEWDTVKTNSLNRRERN 519
            +FF +G+++  + Y K E I    +D    N+D  ++  N  +        ++ N   +N
Sbjct: 2324 KFFYRGIINKSEYYFKEEIIKKYGEDGQYNNDDYMSINNNTKNNN----HYSNNNHHNKN 2379

Query: 518  VTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
             +++   N+     NN N+    NN  KGN  K +    R + D+++  N
Sbjct: 2380 NSNNNNSNNNNNNNNNNNNNNNYNNNNKGNINKVHNKTIRKNIDRLHQLN 2429



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 21/81 (25%), Positives = 34/81 (41%), Gaps = 2/81 (2%)
 Frame = -2

Query: 644  KVENISDGF-DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHS-GEQNSKGMPYNN 471
            K  ++ D +  D  ++NRTLG  ++         N+ N    N+ +S G  +S G   +N
Sbjct: 2911 KATDLYDNYVSDMTKENRTLGHEENEKGTPKYNNNNNNNNNNNINNSKGSDSSNGRDSSN 2970

Query: 470  KNDKVMKNNFRKGNRRKYNTN 408
              D     N R G   +   N
Sbjct: 2971 GRDSSNGRNSRNGRNGRNGPN 2991



>pir|T17414|T17414 TipC protein - slime mold (Dictyostelium
            discoideum)>gb:AF079445_1239506 Dictyostelium discoideum
            TipC (tipC) gene, complete cds.
          Length = 3848

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 23/104 (22%), Positives = 41/104 (39%)
 Frame = -2

Query: 659  IKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
            IKP    +N ++  +D N +N     N ++   +    N+ N    N  ++   N+    
Sbjct: 2209 IKPADDQKNNNNNKNDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN---- 2264

Query: 479  YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNG 348
             NNKN+    NN +  N  + N N      +++      R   G
Sbjct: 2265 -NNKNNNDNNNNIKNNNNNENNNNKNLQEKEEIKYPYYIRNDTG 2307



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 2/108 (1%)
 Frame = -2

Query: 638  ENISDGFDDEN--EDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            +N S+ +D++   ED      N      D  K N+ N+ + N  ++   N+     NN N
Sbjct: 2185 KNKSNDYDNDEIIEDTVEQVNNDLIKPADDQKNNNNNKNDNNNNNNNNNNNNN---NNNN 2241

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            +    NN    N    N N    ++   N  N   + N   + N++K+
Sbjct: 2242 NNNNNNNNNNNNNNNNNNNNNNNNNKNNNDNNNNIKNNNNNENNNNKN 2289



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 21/102 (20%), Positives = 41/102 (40%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            VE +++      +D +    NK+    D    N+ N    N  ++   N+     NN N+
Sbjct: 2201 VEQVNNDLIKPADDQKNNNNNKN----DNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 2256

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY 336
                NN         N N  + +++  N+ N+  ++  + KY
Sbjct: 2257 NNNNNNNNNNKNNNDNNNNIKNNNNNENNNNKNLQEKEEIKY 2298



>pir|A42239|A42239 adenylate cyclase (EC 4.6.1.1) germination stage -
            slime mold (Dictyostelium discoideum)>gb:AC116986_1207470
            Dictyostelium discoideum chromosome 2 map 2234041-2567370
            strain AX4, complete sequence.
          Length = 858

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 28/118 (23%), Positives = 51/118 (43%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            +DENE N TL      F  + +K   +   +R+++ +    +  +  NN N+ +  NN  
Sbjct: 697  EDENEQNETL-----LFNQEQLKKKQIENIQRDLSLNDSIEAIKILNNNNNNNINDNNIN 751

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
              N    N ++   +SD VN+       + K + N       D +  +D +Y+   EN
Sbjct: 752  NTNLNNNNNDININNSDNVNNYENNNNFSDKIENNDG-----DNNNINDNNYKSTNEN 804



>gb:AF275345_1782529 Lycopersicon esculentum putative permease gene,
           partial cds; suppressor-like protein, putative
           centromere protein, putative auxin growth promotor
           protein, and putative protein phosphatase genes,
           complete cds; LTR-A long terminal repeat, complete
           sequence; putative copia-like polyprotein gene, complete
           cds; LTR-B long terminal repeat, complete sequence;
           MADS-box transcription factor JOINTLESS gene, complete
           cds; TH65-like protein gene, partial cds; and unknown
           genes.
          Length = 319

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 45/211 (21%), Positives = 89/211 (42%), Gaps = 16/211 (7%)
 Frame = -2

Query: 986 SKWQWKRMQMKKSKQLLKARLARERQIYEMRKRTELKAAISELERPWEMVEKAPTLFSVS 807
           ++++W  ++ +  K +++   A        R  ++LK    E  +  +M+EK  T F  S
Sbjct: 97  ARYEWMHLRFQDFKTVIEYNSA------VFRITSQLKLC-GETIKDEDMLEKTLTTFHAS 149

Query: 806 ADEQLKVLADRFQRPGGFDMW---------SEKDGPELLKSEADLPS-ARFFPKGVVHSI 657
                 V+  +  R  GF  +         +E+    L+K+    P+ A   P+  V   
Sbjct: 150 -----NVILQQQYREKGFQKYFELISCLLVAEQHNALLMKNHEARPTGAAPLPEANVVEA 204

Query: 656 KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVT---HSGEQNSKG 486
           +   KV+      DD    N   GR K    +   +    N+RE N++   +  ++N  G
Sbjct: 205 RDQSKVKR-----DDHGGYNNARGRGKDKRRYTNRQGGGHNKRENNMSSQNNPSKRNKSG 259

Query: 485 MPYNN---KNDKVMKNNFRKGNRRKYNTNLE 402
              +N   ++   +K++ + G  +KY+ N+E
Sbjct: 260 ASSSNARAESHMTLKDDDKPGTSQKYDKNVE 290



>gb:PFAP190A_1394010 P.falciparum merozoite 190 kD precursor protein
           (p190) mRNA, 5' end.>gb:PFP190G_1394927 Plasmodium
           falciparum surface antigen P190 gene fragment.
          Length = 1061

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 394 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPHTKEKINEKIITDNKERKIFINNIKK 452

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N  +   DK+ SA   
Sbjct: 453 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKIFSARYT 512

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 513 YNVEKQRYNNKFSSSNNSVYNV 534



>gb:PFA929358_1393519 Plasmodium falciparum strain 3D7, chromosome
           9; segment 4/5.
          Length = 1720

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 421 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPHTKEKINEKIITDNKERKIFINNIKK 479

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N  +   DK+ SA   
Sbjct: 480 KIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKIFSARYT 539

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 540 YNVEKQRYNNKFSSSNNSVYNV 561



>gb:PFA929352_1393017 Plasmodium falciparum strain 3D7, chromosome 5,
            segment 2/4.
          Length = 10061

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 7/124 (5%)
 Frame = -2

Query: 614  DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK--NDKVMKNNF 441
            ++N++N     +K+       K +  ++ ++N  + G+ N+KG   NN   NDK   NN 
Sbjct: 1047 NKNKNNNNNNNDKND------KNDKNDKNDKNDKNDGKNNNKGNDKNNNRGNDK---NND 1097

Query: 440  RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS-----KSAVFDMSLQSDGSYEF 276
            +K NR     N +          N  +++NGK +   S     +S+V D +   D S + 
Sbjct: 1098 KKNNRDNDKNNDKNNDKKNNKDNNNKKKKNGKEQNEDSTESDDESSVIDDNYIDDDSCDC 1157

Query: 275  QTEN 264
             +E+
Sbjct: 1158 DSES 1161



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 28/124 (22%), Positives = 50/124 (40%), Gaps = 2/124 (1%)
 Frame = -2

Query: 677   KGVVHSIKPYGKVENISDGFDDENEDNRTLGRNK-SSFEWDTVKTNSLNRRERNVTHSGE 501
             K  + +  P+ +++N      +  + N   G N+ S +  + V +N  N    N TH+  
Sbjct: 9944  KNTLSNNNPFNEIKN------NTQKTNMDFGLNQLSMYMQNNVTSNLKNNSITNETHNNN 9997

Query: 500   QNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS-ANEFRRQNGKTKYNHSK 324
              N K    NN N+    NN    N   Y  N      ++ +S  N     N K   N++ 
Sbjct: 9998  DNMKTNHNNNNNNNNNNNNNNNNNTSGYPINYLIFQQNQNHSDTNNNNNNNNKNNSNNNN 10057

Query: 323   SAVF 312
             + ++
Sbjct: 10058 NNIY 10061



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 28/102 (27%), Positives = 47/102 (46%)
 Frame = -2

Query: 629  SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            +DG ++EN++     +NKSS E    K N+ N+++ N  ++ ++++     NNK D    
Sbjct: 5902 NDGSNNENKNKEN--KNKSS-EKSKAKDNNNNKKDNNNNNNNKKDNNNN--NNKKDNNNS 5956

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
            NN         N N   LS++     N+      K K N  K
Sbjct: 5957 NN---------NNNNNNLSNNGEEDPNDSDSDKDKKKKNKKK 5989



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 22/95 (23%), Positives = 35/95 (36%)
 Frame = -2

Query: 647  GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
            G ++N ++     N +N+    N  S         + N + +N  +S   N+     NN 
Sbjct: 4340 GLIDNNNNMNSSSNNNNKINSNNSHS------NNKNNNNKNKNNNNSNNNNNNNNSNNNS 4393

Query: 467  NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEF 363
            N+    NN    N    N N       K+NS   F
Sbjct: 4394 NNNNSNNNNNNNNNNNNNNNNVNKEIIKLNSLYSF 4428



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 25/96 (26%), Positives = 51/96 (53%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            +N ++  D+ N +N     N ++ + D   +N+ N    N++++GE++    P ++ +DK
Sbjct: 5926 DNNNNKKDNNNNNNNKKDNNNNNNKKDNNNSNN-NNNNNNLSNNGEED----PNDSDSDK 5980

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
              K    K N++K N N+   S D  N+ N+ + +N
Sbjct: 5981 DKK----KKNKKKDNKNINDDSDD--NNKNKKKLKN 6010



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 2/74 (2%)
 Frame = -2

Query: 545  NSLNRRERNVTHSGEQNSKG--MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSA 372
            N  N+ + N  ++ ++N K      N+KNDK    N  KGN +  N   ++ +  K N  
Sbjct: 1044 NIFNKNKNNNNNNNDKNDKNDKNDKNDKNDKNDGKNNNKGNDKNNNRGNDKNNDKKNNRD 1103

Query: 371  NEFRRQNGKTKYNH 330
            N+        K N+
Sbjct: 1104 NDKNNDKNNDKKNN 1117



>gb:CR382401_1375118 Plasmodium falciparum chromosome 6, complete
            sequence; segment 4/5.
          Length = 6761

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 28/128 (21%), Positives = 56/128 (43%), Gaps = 3/128 (2%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            ++N  +G    NE+N     N ++   +    N+ N    N  ++   N+     NN N+
Sbjct: 5335 LDNNMNGPIKNNEENNNNNDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 5394

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH---SKSAVFDMSLQSD 291
                NN  K N +K   ++  +  ++ NS N+  ++   +K N    S +   + +  SD
Sbjct: 5395 NNNNNNKSKKNTQKKKDHVNDVKINQNNSNNKNNKKKKTSKDNEELKSDNTKNNKTKDSD 5454

Query: 290  GSYEFQTE 267
            G+   +T+
Sbjct: 5455 GNNNDKTK 5462



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 22/95 (23%), Positives = 35/95 (36%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            N DN T          D +  N++N  + N+    + N +    N+ N+    NN    N
Sbjct: 5309 NNDNGTKVDVNLDNADDIINNNNMNMLDNNMNGPIKNNEENNNNNDNNNNNNNNNNNNNN 5368

Query: 428  RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
                N N    +++  N+ N     N     N SK
Sbjct: 5369 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKSK 5403



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 22/108 (20%), Positives = 45/108 (41%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            ++E +   + + + DN  + R         +K++  N    ++ ++   N++     N N
Sbjct: 5869 ELEGLISKYVNRSNDNNYMDRKYDMLLLKNIKSDINNDNNNDINNNDNNNNE-----NNN 5923

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            + +  NN    N    N N    +S+  N+ N +   N + KYN   S
Sbjct: 5924 ENINDNNNNNNNNNNNNNNN---NSNNNNNNNYYYYHNNEGKYNEQGS 5968



>gb:CR382400_1375004 Plasmodium falciparum chromosome 6, complete
           sequence; segment 3/5.
          Length = 795

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 28/121 (23%), Positives = 56/121 (46%), Gaps = 11/121 (9%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K++N +D  D ENED      N ++  +  +  ++++  E+ +    E+       NN+ 
Sbjct: 137 KIQNYND--DKENEDTINDVNNYNNEVYKLINKDNIHENEKIIVGEDEEEDMTHDINNEY 194

Query: 464 DKVMKNNF--RKGNRRKYNTNLERLSSDKVNSANEFRRQN-------GKTKYN--HSKSA 318
           D+   NN   RK  R+ YN N     + K ++ + +   N       G+  Y+  H+K++
Sbjct: 195 DEEHCNNIGKRKAKRKSYNNNNNNYYTYKHHNNDYYNNNNNNNNNIYGEKNYHMEHNKNS 254

Query: 317 V 315
           +
Sbjct: 255 I 255



>gb:AY459293_1328230 Plasmodium falciparum histone acetyltransferase
           (HAT) gene, complete cds.>gb:AY463097_1329700 Plasmodium
           falciparum histone acetyltransferase (HAT) mRNA,
           complete cds.>gb:AY498855_1331087 Plasmodium falciparum
           histone acetyltransferase mRNA, complete cds.
          Length = 1464

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 21/97 (21%), Positives = 38/97 (39%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           EN DN     ++S+   +     S N    N +++   N+     NN N+    NN   G
Sbjct: 142 ENNDNENNNNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHG 201

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N    + N    +++  N+ N     N     N++ +
Sbjct: 202 NNNNSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 238



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 24/97 (24%), Positives = 38/97 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  +  N +N     N ++   +    N+ N  E N  + G  N+     NN N+  
Sbjct: 158 NNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGNNNNSSNNNNNNNNNN 217

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGK 345
             NN    N    N N    ++DK N  +E     GK
Sbjct: 218 NNNNNNNNNNNNNNNNNNNNNNDK-NEDDENTTGKGK 253



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 20/97 (20%), Positives = 40/97 (41%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           +++NE+N     N ++   +    N+ N  E N  ++   N++    NN N+    N+  
Sbjct: 143 NNDNENNNNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGN 202

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             N    N N    +++  N+ N     N     N++
Sbjct: 203 NNNSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 239



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 22/104 (21%), Positives = 40/104 (38%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           E   +  D+EN +N     N ++   ++   N+ N    N  ++    S     NN N++
Sbjct: 138 EGTQENNDNENNNNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNN---NNNNNE 194

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
              NN    N    N N    +++  N+ N     N     N++
Sbjct: 195 SNNNNHGNNNNSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 238



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 20/104 (19%), Positives = 40/104 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N  +  ++ N +N     N ++ E +    N+ N    N  ++ E N+     NN +   
Sbjct: 150 NNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGNNNNSSNN 209

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
             NN    N    N N    +++  N+ N  + ++ +      K
Sbjct: 210 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDKNEDDENTTGKGK 253



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 31/141 (21%), Positives = 62/141 (43%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N +    D   T    ++      +G + +    Y N N  +
Sbjct: 219 NNNNNNNNNNNNNNNNNNNNNDKNEDDENTTGKGKKTEVKKRAGRKRNDSTMYANSNT-M 277

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
           +KNNF + N+  YN N++ ++    N  ++F  +  K   N+    +      ++ +Y F
Sbjct: 278 LKNNFLQNNKMIYN-NMDHIND--TNEQDKFLYEQRKMMMNNKMENMGPNMNMTNKNY-F 333

Query: 275 QTEN*ACKLSFRWLKMLLKVN 213
           QT N   K++    K L+ +N
Sbjct: 334 QTVN-NMKMNVENNKNLIGIN 353



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 26/125 (20%), Positives = 52/125 (41%), Gaps = 10/125 (8%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N+S+   +  ++N+ N    N + +   N+     NN N+  
Sbjct: 166 NNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGNNNNSSNNNNNNN----NNNNNNN 221

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANE----------FRRQNGKTKYNHSKSAVFDM 306
             NN    N    N N    + D  N+  +           R++N  T Y +S + + + 
Sbjct: 222 NNNNNNNNNNNNNNNNNNDKNEDDENTTGKGKKTEVKKRAGRKRNDSTMYANSNTMLKNN 281

Query: 305 SLQSD 291
            LQ++
Sbjct: 282 FLQNN 286



>gb:AF272150_1257594 Dictyostelium discoideum deliriumA (dlrA) gene,
           complete cds.
          Length = 817

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 22/99 (22%), Positives = 39/99 (39%)
 Frame = -2

Query: 560 DTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV 381
           D    N+ N    + ++S   ++     NN N+    NN    N    N +    +++ +
Sbjct: 49  DKNNNNNNNNNSNSNSNSNSNSNSNSNSNNNNNNNNNNNNNNSNNNNNNNSNNNSNNNNI 108

Query: 380 NSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
           N++N     N     NH +       LQ   +Y FQ+ N
Sbjct: 109 NNSNNNNSNNNNHPINHMQQHHIHQHLQ---NYHFQSSN 144



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 20/73 (27%), Positives = 26/73 (35%), Gaps = 1/73 (1%)
 Frame = -2

Query: 623 GFDDENEDNRTLGRNKSSFEWDTVKTNS-LNRRERNVTHSGEQNSKGMPYNNKNDKVMKN 447
           G D  N +N     N +S       +NS  N    N  ++   NS     NN N+    N
Sbjct: 47  GLDKNNNNNNNNNSNSNSNSNSNSNSNSNSNNNNNNNNNNNNNNSNNNNNNNSNNNSNNN 106

Query: 446 NFRKGNRRKYNTN 408
           N    N    N N
Sbjct: 107 NINNSNNNNSNNN 119



>gb:AC116956_1206537 Dictyostelium discoideum chromosome 2 map
           1418423-1684967 strain AX4, complete sequence.
          Length = 1104

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 25/105 (23%), Positives = 43/105 (40%), Gaps = 8/105 (7%)
 Frame = -2

Query: 554 VKTNSLNRRERNV-THSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVN 378
           V +  +N    N+ +++   NS     NN N+    NN    N    N N    S++  N
Sbjct: 256 VASTGVNNNNNNINSNNSNNNSSSNNNNNNNNNNNNNNNNNNNNNNSNNNNSSNSNNTTN 315

Query: 377 SANEFRR-------QNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
           + N  ++        NG   + +S + V D +L+ +G Y     N
Sbjct: 316 NGNNSQKYNSLNGSSNGTNNFVNSLNNVDDNNLKINGIYNINNNN 360



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 27/105 (25%), Positives = 42/105 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++  +  N +N     N S+     + +NS N    N+  +G  NS  +  NN +   
Sbjct: 361 NINNNNNINNNNNNNNNNNNSNINKSNMNSNSNNSLNGNINING--NSANI-INNNSSSN 417

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N N    +++  N+ N     N     NHS S
Sbjct: 418 NNNNNNNNNNNNNNNNNNNNNNNSNNNNNNNSNNNINGLINHSPS 462



>gb:AC115607_1205913 Dictyostelium discoideum chromosome 2 map
           4559693-4624405 strain AX4, complete sequence.
          Length = 259

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 25/104 (24%), Positives = 37/104 (35%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S    D+N +N  L             TN+ N    N  ++  +N+     NN N+  
Sbjct: 32  NFSSNQIDKNNNNENLNNQIIDL------TNNNNNSNNNNKNNNYENNNNDNNNNNNNNN 85

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
             NN    N    N N    +++  N+ N     N    YN  K
Sbjct: 86  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNYNDEK 129



 Score = 38.1 bits (87), Expect = 0.37
 Identities = 23/126 (18%), Positives = 49/126 (38%), Gaps = 4/126 (3%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           EN+++   D   +N     N  +  ++    ++ N    N  ++   N+     NN N+ 
Sbjct: 45  ENLNNQIIDLTNNNNNSNNNNKNNNYENNNNDNNNNNNNNNNNNNNNNNNNNNNNNNNNN 104

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANE----FRRQNGKTKYNHSKSAVFDMSLQSD 291
              NN    N    N N    + +K  ++NE     ++     K++ S+    +  L+  
Sbjct: 105 NNNNNNNNNNNNNNNNNNNNYNDEK-RTSNENIPILKKYESPIKFSESQLLQLEQQLRQQ 163

Query: 290 GSYEFQ 273
              ++Q
Sbjct: 164 QQIDYQ 169



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 24/109 (22%), Positives = 43/109 (39%), Gaps = 2/109 (1%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKS--SFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           +EN ++ F+  N  N+ +  N    +F  + +  N+ N    N       N+     NNK
Sbjct: 9   IENFTNNFN--NNINKVIFNNNVIINFSSNQIDKNNNNENLNNQIIDLTNNNNNSNNNNK 66

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N+    NN    N    N N    +++  N+ N     N     N++ +
Sbjct: 67  NNNYENNNNDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 115



>gb:AC115592_1205718 Dictyostelium discoideum chromosome 2 map
            1-125959 strain AX4, complete sequence.
          Length = 1204

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 45/247 (18%), Positives = 101/247 (40%), Gaps = 10/247 (4%)
 Frame = -2

Query: 977  QWKRMQMKKSKQLLKARLARERQIYEMRKRTELKAAISELERPWEMVEKAPTLFSVSADE 798
            Q+++ Q ++ +Q  + +  +++Q  + +++ +L+    + + P +    +P L  +S  +
Sbjct: 594  QFEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQQFQPKPKTPQKFRLNSPQLNQISPQK 653

Query: 797  QLKVLADR--FQRPGGFDMWSEKDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISD 624
            Q +   ++  FQ     D  +E+   EL+K +               S++   + +  +D
Sbjct: 654  QRQQQIEQLEFQLQQRQDRENEEYDQELIKEQ---------------SLQQQQQQQRNND 698

Query: 623  GFDDENEDN-RTLGRNKSSFE-----WDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
              DDE +D+ +T  + +  F         +K N  N    N  ++   N+     NN N+
Sbjct: 699  SEDDEYDDDYQTQQQKQQQFNNHQNFQKPLKLNVNNNNNNNNNNNNNNNNNNNNNNNNNN 758

Query: 461  KVMKNNFRKGNRRKYN--TNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
                NN    +    N  +  +  S    +S +     N K   N++ +   + S  +  
Sbjct: 759  NNNNNNNSSSSNSSNNNFSGNDSSSGSSSSSGSSGSSNNNKNNKNNNSNNSNNNSNNNSS 818

Query: 287  SYEFQTE 267
             YE Q +
Sbjct: 819  EYEDQDQ 825



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 24/125 (19%), Positives = 49/125 (39%)
 Frame = -2

Query: 641  VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
            VEN ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+
Sbjct: 960  VENFNNQQNNNNNNNNNNSNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1019

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSY 282
                NN    N    N N     +++ N+ N+ +    ++  N S      +  Q +   
Sbjct: 1020 N--NNNNNNNNNNNNNNNNNNNKNNRTNNKNQVKIPKEESPLNLSSGNTSPIDTQFNQQQ 1077

Query: 281  EFQTE 267
            + Q +
Sbjct: 1078 QQQQQ 1082



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 23/99 (23%), Positives = 38/99 (38%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            +I + F+++  +N     N S+   +    NS N    N  ++   N+     NN N+  
Sbjct: 958  SIVENFNNQQNNNNNNNNNNSNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1017

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
              NN    N    N N         N+ N+  R N K +
Sbjct: 1018 NNNNNNNNNNNNNNNN-------NNNNNNKNNRTNNKNQ 1049



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 23/86 (26%), Positives = 35/86 (40%)
 Frame = -2

Query: 626  DGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKN 447
            D   DEN D++ +  N  SF ++    N  N    N  ++   N+     NN N+    N
Sbjct: 1102 DVSSDENIDDQDILNN--SFNFNNFNNNDNNNINNNNNNNNINNNINNNNNNNNNNNNNN 1159

Query: 446  NFRKGNRRKYNTNLERLSSDKVNSAN 369
            N    N    N N  + ++  V S N
Sbjct: 1160 NNNNNNNNNNNNNSTKNNNFNVQSQN 1185



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 26/79 (32%), Positives = 30/79 (37%), Gaps = 3/79 (3%)
 Frame = -2

Query: 548 TNSLNRRERNVTHSGEQNSKGMPYNNKN---DKVMKNNFRKGNRRKYNTNLERLSSDKVN 378
           TNS     R  T S   NS    YNN N   +    NNF   N   YN N         N
Sbjct: 10  TNSSPVGTRRNTPSNN-NSNNFNYNNNNSNNNNNNNNNFNSNNNNNYNNN-------NFN 61

Query: 377 SANEFRRQNGKTKYNHSKS 321
           + N F   N    YNH+ +
Sbjct: 62  N-NNFNNNNNNNNYNHNNN 79



>gb:AC115584_1205689 Dictyostelium discoideum chromosome 2 map
           complement(3622543-3568102) strain AX4, complete
           sequence.
          Length = 948

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 30/122 (24%), Positives = 59/122 (48%), Gaps = 5/122 (4%)
 Frame = -2

Query: 617 DDENEDNR-----TLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
           DD+N+  R     ++ +N S  + + +  + LN  E  +T++G+  +  +P  N  +K +
Sbjct: 283 DDDNQHLRLHHKHSILKNGSKIK-EALSKSILN--EMKITNNGKGVTFSLP--NSMEKAI 337

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQ 273
                K N+    T LE+   +  N+ N+F ++N   +YNH +  +  + +  D   E Q
Sbjct: 338 NQVLNKFNQNPIGTLLEKYLPNLFNNKNKFYQENENEQYNHDEEELNIIDIDIDIEEEEQ 397

Query: 272 TE 267
            E
Sbjct: 398 EE 399



>gb:AC115579_1205661 Dictyostelium discoideum chromosome 2 map
           6097680-6105897 strain AX4, complete sequence.
          Length = 1303

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 41/179 (22%), Positives = 73/179 (40%)
 Frame = -2

Query: 866 SELERPWEMVEKAPTLFSVSADEQLKVLADRFQRPGGFDMWSEKDGPELLKSEADLPSAR 687
           S LE   E+V   P  F    +  +K++++ F+R       S     E LK+     +  
Sbjct: 166 SNLETIKELVNLEPINFK---NYGIKLISEEFKRKS----LSLAAHRETLKTTI---TEY 215

Query: 686 FFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHS 507
            F    ++SI P   +  +++    E ++  T  R K+S   +T+ +N  N    N  ++
Sbjct: 216 IFNNPSLYSIPP--PLSLVNNQKKQEQQEQSTNKRLKTS---ETLLSNLNNNNNNNNNNN 270

Query: 506 GEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
              N+     NN N+    NN    N    N N    +++  N+ N     N + KY +
Sbjct: 271 NNNNNNNNNNNNNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNEEIKYEY 329



>gb:PFMAL8P1_1192105 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1484

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 21/97 (21%), Positives = 38/97 (39%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           EN DN     ++S+   +     S N    N +++   N+     NN N+    NN   G
Sbjct: 142 ENNDNENNNNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHG 201

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N    + N    +++  N+ N     N     N++ +
Sbjct: 202 NNNNSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 238



 Score = 37.7 bits (86), Expect = 0.49
 Identities = 24/97 (24%), Positives = 38/97 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  +  N +N     N ++   +    N+ N  E N  + G  N+     NN N+  
Sbjct: 158 NNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGNNNNSSNNNNNNNNNN 217

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGK 345
             NN    N    N N    ++DK N  +E     GK
Sbjct: 218 NNNNNNNNNNNNNNNNNNNNNNDK-NEDDENTTGKGK 253



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 20/97 (20%), Positives = 40/97 (41%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           +++NE+N     N ++   +    N+ N  E N  ++   N++    NN N+    N+  
Sbjct: 143 NNDNENNNNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGN 202

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             N    N N    +++  N+ N     N     N++
Sbjct: 203 NNNSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 239



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 22/104 (21%), Positives = 40/104 (38%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           E   +  D+EN +N     N ++   ++   N+ N    N  ++    S     NN N++
Sbjct: 138 EGTQENNDNENNNNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNN---NNNNNE 194

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
              NN    N    N N    +++  N+ N     N     N++
Sbjct: 195 SNNNNHGNNNNSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 238



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 20/104 (19%), Positives = 40/104 (38%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N  +  ++ N +N     N ++ E +    N+ N    N  ++ E N+     NN +   
Sbjct: 150 NNDESNNNNNNNNNESNNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGNNNNSSNN 209

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
             NN    N    N N    +++  N+ N  + ++ +      K
Sbjct: 210 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDKNEDDENTTGKGK 253



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 31/141 (21%), Positives = 62/141 (43%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N +    D   T    ++      +G + +    Y N N  +
Sbjct: 219 NNNNNNNNNNNNNNNNNNNNNDKNEDDENTTGKGKKTEVKKRAGRKRNDSTMYANSNT-M 277

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
           +KNNF + N+  YN N++ ++    N  ++F  +  K   N+    +      ++ +Y F
Sbjct: 278 LKNNFLQNNKMIYN-NMDHIND--TNEQDKFLYEQRKMMMNNKMENMGPNMNMTNKNY-F 333

Query: 275 QTEN*ACKLSFRWLKMLLKVN 213
           QT N   K++    K L+ +N
Sbjct: 334 QTVN-NMKMNVENNKNLIGIN 353



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 26/125 (20%), Positives = 52/125 (41%), Gaps = 10/125 (8%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N+S+   +  ++N+ N    N + +   N+     NN N+  
Sbjct: 166 NNNNNNNESNNNNNNNNNNESNNNNNNNESNNNNHGNNNNSSNNNNNNN----NNNNNNN 221

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANE----------FRRQNGKTKYNHSKSAVFDM 306
             NN    N    N N    + D  N+  +           R++N  T Y +S + + + 
Sbjct: 222 NNNNNNNNNNNNNNNNNNDKNEDDENTTGKGKKTEVKKRAGRKRNDSTMYANSNTMLKNN 281

Query: 305 SLQSD 291
            LQ++
Sbjct: 282 FLQNN 286



>gb:PFMAL13_1191491 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 982

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 32/109 (29%), Positives = 44/109 (40%)
 Frame = -2

Query: 647 GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           G V NIS+  + +NED +           D +  N+LN +      S E N     +NN 
Sbjct: 69  GFVMNISENNESKNEDLKK----------DEIINNNLNNKMLKNNQSNENNG----FNNN 114

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           ND    NN    N  +YN  L           N   R N   +YNH+K+
Sbjct: 115 NDNNNDNNNNNNNNNRYNGIL-----------NNDERHN--YEYNHNKN 150



>gb:AE014187_938961 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014824_1228037 Plasmodium falciparum 3D7
           chromosome 14 section 9 of 13 of the complete sequence.
          Length = 2189

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 24/112 (21%), Positives = 45/112 (40%)
 Frame = -2

Query: 620 FDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNF 441
           +D  N +N T   N S+   +    N+ N    N +++    +     NN       N+ 
Sbjct: 144 YDSNNTNNNTNSNNNSNNNSNNNSNNNSNNYSNNNSNTNSNTNSNTNSNNNTTNYDLNSE 203

Query: 440 RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
            +  RRK      R+  ++    N   + N   KYN+ ++  +    +SDG+
Sbjct: 204 YEKIRRKEEEAARRIERERRADINRKNQDNNSNKYNNEQNGGY----ESDGN 251



>gb:AE014186_938380 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014842_1229114 Plasmodium falciparum 3D7
           chromosome 11 section 7 of 8 of the complete sequence.
          Length = 2275

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 25/99 (25%), Positives = 40/99 (40%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           D+ N+DN+    NK++   D  K N  N    N  ++   N+     NN N+    NN  
Sbjct: 521 DNNNDDNKNNNDNKNN---DDNKNNDDNDNNDNNNNNDNNNNNN---NNNNNNNNNNNNN 574

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             N    N N    + D  N+ N+    N     N++ +
Sbjct: 575 NSNGDNNNNNNNNNNGDNCNNNNDNHNNNDNNNSNNNNN 613



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 24/114 (21%), Positives = 46/114 (40%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           N DN+    NK++ + D    N+ N    N  ++   N+     NN N     NN    N
Sbjct: 530 NNDNKNNDDNKNNDDNDNNDNNNNNDNNNNNNNNNNNNNNNNNNNNSNGDNNNNNNNNNN 589

Query: 428 RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTE 267
               N N +  +++  N++N     N   + N+   +  D + + +  + +  E
Sbjct: 590 GDNCNNNNDNHNNNDNNNSN--NNNNNNHRINNKLDSFEDNNYRENYIFNYLNE 641



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 27/135 (20%), Positives = 51/135 (37%), Gaps = 12/135 (8%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           +N  D  ++++ DN     N  +   +    N+ N    N   +G+ N+     NN  D 
Sbjct: 534 KNNDDNKNNDDNDNNDNNNNNDNNNNNNNNNNNNNNNNNNNNSNGDNNNNNNN-NNNGDN 592

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSA------NEFRRQ------NGKTKYNHSKSAV 315
              NN    N    N+N    ++ ++N+       N +R        N K K +   S  
Sbjct: 593 CNNNNDNHNNNDNNNSNNNNNNNHRINNKLDSFEDNNYRENYIFNYLNEKDKTDDHNSNS 652

Query: 314 FDMSLQSDGSYEFQT 270
           +D S  +   + + +
Sbjct: 653 YDNSNSNSNMFNYNS 667



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 24/109 (22%), Positives = 42/109 (38%)
 Frame = -2

Query: 659 IKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
           IKP  K   I++  D+  E ++ L     +   D   +   N  + N  ++  +N+    
Sbjct: 481 IKPLQKESIINNEEDNVQEHHKLLLDKNGNNNNDDDNSTDDNNNDDNKNNNDNKNNDDNK 540

Query: 479 YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
            N+ ND    NN    N    N N    +++  N++N     N     N
Sbjct: 541 NNDDNDNNDNNNNNDNNNNNNNNNNNNNNNNNNNNSNGDNNNNNNNNNN 589



>gb:AE014185_937623 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014829_1228357 Plasmodium falciparum 3D7
           chromosome 10 section 1 of 7 of the complete sequence.
          Length = 1130

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 24/109 (22%), Positives = 45/109 (41%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N  +G D++N +N     N ++   +    N+ +    N   +   NS     NN ND  
Sbjct: 435 NTYNGTDNDNNNNNNDNNNDNNNNDNNNDNNNNDNNNDNNNDNNNNNSNNDSNNNNNDSN 494

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFD 309
             NN    N    N N    ++D  N+ N+    N  ++ +++  A ++
Sbjct: 495 NNNNDSNNNNNDSNNN----NNDSNNNNNDNNSNNNNSRRHNADEANYN 539



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 22/89 (24%), Positives = 39/89 (43%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           S+  +  N +N   G  K+  + D    +S +   RN       +S+   YNN+      
Sbjct: 669 SNHSNHSNNNNNNKGNEKNERKEDMCNVSSGSNNNRN------SSSRSNYYNNR---YRY 719

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEF 363
           NN+R+ NRR  + +   +  D+V   N +
Sbjct: 720 NNYRRSNRRNMDQDYFNIQDDEVEEENYY 748



>pir|S06286|S06286 major merozoite surface antigen precursor -
           malaria parasite (Plasmodium falciparum) (strain RO-33
           Ghana) (fragment)
          Length = 1060

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 394 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPHTKEKINEKIITDNKERKIFINNIKK 452

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N  +   DK+ SA   
Sbjct: 453 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKIFSARYT 512

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 513 YNVEKQRYNNKFSSSNNSVYNV 534



>sp|P54674|P3K2_DICDI Phosphatidylinositol 3-kinase 2 (EC 2.7.1.137)
            (PI3-kinase) (PtdIns-3- kinase) (PI3K).>pir|T18273|T18273
            1-phosphatidylinositol 3-kinase (EC 2.7.1.137) 2 - slime
            mold (Dictyostelium discoideum)>gb:DDU23477_1377308
            Dictyostelium discoideum
            phosphatidylinositol-4,5-diphosphate 3-kinase (PIK2)
            mRNA, complete cds.
          Length = 1858

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 2/122 (1%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTH--SGEQNSKGMPYNN 471
            K+   SD FDD +ED  ++  N     +D +K +   ++++ +    + ++ +K    +N
Sbjct: 952  KILETSD-FDDYDEDLDSINSNS----FDDLKQSIQQQQQQQIQTVINIKETNKENKDSN 1006

Query: 470  KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
            K +K   +N    N    N N    +++  N+ N     NG    N+S S +   S+ S+
Sbjct: 1007 KENKDSSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNGNNNGNNSNNNSNSNISRGSIDSE 1066

Query: 290  GS 285
            G+
Sbjct: 1067 GN 1068



>sp|P19598|MSP1_PLAF3 Merozoite surface protein 1 precursor
           (Merozoite surface antigens) (PMMSA) (P190).
          Length = 1682

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 394 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPHTKEKINEKIITDNKERKIFINNIKK 452

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N  +   DK+ SA   
Sbjct: 453 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKIFSARYT 512

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 513 YNVEKQRYNNKFSSSNNSVYNV 534



>sp|Q03101|CYAG_DICDI Adenylate cyclase, germination specific (EC
            4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl
            cyclase).>gb:DDIADCYG_1377015 Dictyostelium discoideum
            adenylyl cyclase germination protein (ACG) gene, complete
            cds.
          Length = 858

 Score = 38.5 bits (88), Expect = 0.28
 Identities = 28/118 (23%), Positives = 51/118 (43%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
            +DENE N TL      F  + +K   +   +R+++ +    +  +  NN N+ +  NN  
Sbjct: 697  EDENEQNETL-----LFNQEQLKKKQIENIQRDLSLNDSIEAIKILNNNNNNNINDNNIN 751

Query: 437  KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
              N    N ++   +SD VN+       + K + N       D +  +D +Y+   EN
Sbjct: 752  NTNFNNNNNDININNSDNVNNYENNNNFSDKIENNDG-----DNNNINDNNYKSTNEN 804



>gb:PFMSAMSA1_1394915 P. falciparum gene for major surface antigen
           (MSA-1).
          Length = 1087

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 416 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 474

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 475 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 534

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 535 YNVEKQIYNNKFSSSNNSVYNV 556



>gb:PFMAL4P2_1394752 Plasmodium falciparum MAL4P2.
          Length = 1570

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 38/132 (28%), Positives = 58/132 (43%), Gaps = 14/132 (10%)
 Frame = -2

Query: 674 GVVHSIKPYGKVENISDGF------DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVT 513
           G V SI   G +  +S+        ++ N +N+  G  ++  + D  K  S +    N+ 
Sbjct: 281 GNVGSIGSIGNIGTLSNNKFNIHNNNNNNNNNKLGGIKENDMKGDESKMTSSSGDYNNIM 340

Query: 512 HSGEQ-NSKGMPYNNKNDKVMKN-----NFRKGNRRKYNTNLERL--SSDKVNSANEFRR 357
            S  Q N+     NN N  +  +     NF K +R  +N N ERL  S+  +N  N    
Sbjct: 341 LSVMQRNNSNSNINNSNSNIQTDYETFENFDKVDRTTHNYNNERLIKSTHLLNEQNNI-S 399

Query: 356 QNGKTKYNHSKS 321
            NGK +  HSKS
Sbjct: 400 TNGKYQSYHSKS 411



>gb:PFA929359_1393565 Plasmodium falciparum strain 3D7, chromosome
           9; segment 5/5.
          Length = 1147

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 18/76 (23%), Positives = 35/76 (46%)
 Frame = -2

Query: 512 HSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           HS E +   +  NN+ +K  +NN    N   YN  + R++S K N   + +++      +
Sbjct: 609 HSQESDINYISENNQEEKNKQNNNNNNNDNNYNNKVNRVTSKKANRKKKKKKKKKNGHLS 668

Query: 332 HSKSAVFDMSLQSDGS 285
           +S +   D  +  D +
Sbjct: 669 NSNNIAHDFMINCDNT 684



>gb:DDU68754_1377407 Dictyostelium discoideum putative transcription
           factor (stkA) mRNA, complete cds.
          Length = 872

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 28/107 (26%), Positives = 44/107 (41%), Gaps = 3/107 (2%)
 Frame = -2

Query: 626 DGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKN 447
           +  ++ N +N     N ++F+  T  TN+ N +  +  +S  Q       NN N+K    
Sbjct: 15  NNINNNNNNNNNNSNNNNNFDPITSLTNNNNNKIISPLNSNRQQPNSNTNNNSNNK---- 70

Query: 446 NFRKGNRRKY---NTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
           N  K N       N NLE    +  N+ N     N     N+SKS +
Sbjct: 71  NNNKSNLLDIILDNNNLENNIDNNNNNNNNNNNNNNNNNNNNSKSII 117



>gb:AF036171_1234870 Dictyostelium discoideum homeobox-containing
           protein (hbx-2) mRNA, partial cds.
          Length = 534

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 22/105 (20%), Positives = 48/105 (45%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N S+ +++ N ++     N +++ ++    N+      N  H  ++      +NN N+  
Sbjct: 291 NNSNNYNNGNSNSNNNRNNNNNYNYNNYINNNNYNNNNNRQHCDDEEEDEQYFNNNNNNN 350

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N R  +++ ++  SD  N+ N+    NG   YN++ +
Sbjct: 351 NNNN----NNRISDSSDDQYFSDDTNNNND-NYNNGNNNYNNNNN 390



 Score = 37.4 bits (85), Expect = 0.63
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 4/103 (3%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK----VMK 450
           DDE ED +    N ++   +    N ++    +   S + N+    YNN N+        
Sbjct: 334 DDEEEDEQYFNNNNNNN--NNNNNNRISDSSDDQYFSDDTNNNNDNYNNGNNNYNNNNNN 391

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           NNF       YN N    +++  N+ N +   NG   +N++ +
Sbjct: 392 NNFNNNYMNNYNNN---YNNNNYNNNNSYNNSNGNNNFNNNNN 431



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 26/96 (27%), Positives = 33/96 (34%)
 Frame = -2

Query: 551 KTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSA 372
           K N+++   +NV H    N+     NN N+    NN    N R  N N         N  
Sbjct: 202 KNNNMDNNNKNVPHLSLSNNNNNNNNNNNNNNNNNNNNNNNNRNRNNN---------NIY 252

Query: 371 NEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
           N     N     N  K+  F  S  SD   E    N
Sbjct: 253 NNNNNNNNNNSNNRGKN--FSDSGSSDSDSELNRHN 286



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/108 (20%), Positives = 43/108 (39%), Gaps = 3/108 (2%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N +N +  R K+  +  +  ++S   R  N  ++   N      N+ N++   NN+ 
Sbjct: 255 NNNNNNNNSNNRGKNFSDSGSSDSDSELNRHNNNNNNNSNNYNNGNSNSNNNRNNNNNYN 314

Query: 437 KGN---RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
             N      YN N  R   D      ++   N     N++ + + D S
Sbjct: 315 YNNYINNNNYNNNNNRQHCDDEEEDEQYFNNNNNNNNNNNNNRISDSS 362



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 3/104 (2%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSF--EWDTVKTNSLNRRERNVTHSGEQNSKG-MPYNNKN 465
           N ++  ++ N +N    RN ++     +    N+ N R +N + SG  +S   +  +N N
Sbjct: 229 NNNNNNNNNNNNNNNRNRNNNNIYNNNNNNNNNNSNNRGKNFSDSGSSDSDSELNRHNNN 288

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           +    NN+  GN    N+N  R +++  N  N     N     N
Sbjct: 289 NNNNSNNYNNGNS---NSNNNRNNNNNYNYNNYINNNNYNNNNN 329



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 26/113 (23%), Positives = 39/113 (34%), Gaps = 5/113 (4%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K +N  + F + N DN     NK+         N+ N    N  ++   N+     N  N
Sbjct: 193 KQQNNINFFKNNNMDNN----NKNVPHLSLSNNNNNNNNNNNNNNNNNNNNNNNNRNRNN 248

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK-----YNHSKS 321
           + +  NN    N    N       S   +S +E  R N         YN+  S
Sbjct: 249 NNIYNNNNNNNNNNSNNRGKNFSDSGSSDSDSELNRHNNNNNNNSNNYNNGNS 301



>gb:AC117081_1207967 Dictyostelium discoideum chromosome 2 map
           5862124-6045772 strain AX4, complete sequence.
          Length = 531

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 23/96 (23%), Positives = 39/96 (40%), Gaps = 2/96 (2%)
 Frame = -2

Query: 689 RFFPKGVVHSIKP--YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNV 516
           + F   +++S K   Y    N ++  ++ N +N +  RN ++F          N R  N 
Sbjct: 58  KVFKNDLIYSKKESHYNNNNNSNNNSNNNNNNNNSNNRNNNNFS---------NNRNNNN 108

Query: 515 THSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTN 408
             +   N+     NN ND   +NN     R +Y  N
Sbjct: 109 NRNNNNNNSNRNNNNSNDNNFRNNNNNNRRTEYYKN 144



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 27/128 (21%), Positives = 47/128 (36%), Gaps = 2/128 (1%)
 Frame = -2

Query: 680 PKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTV--KTNSLNRRERNVTHS 507
           P  +++ I+ +   +     F     + + L   +  F+ D +  K  S      N  ++
Sbjct: 23  PINIINGIRYFSSNQEDYPLFKKPVFNGKVLRGGRKVFKNDLIYSKKESHYNNNNNSNNN 82

Query: 506 GEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
              N+     NN+N+    NN    N R  N N    +++  N  N FR  N   +    
Sbjct: 83  SNNNNNNNNSNNRNNNNFSNNRNNNNNRNNNNNNSNRNNNNSND-NNFRNNNNNNRRTEY 141

Query: 326 KSAVFDMS 303
               FD S
Sbjct: 142 YKNDFDSS 149



>gb:AC117081_1207924 Dictyostelium discoideum chromosome 2 map
           5862124-6045772 strain AX4, complete sequence.
          Length = 2625

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 18/82 (21%), Positives = 32/82 (39%)
 Frame = -2

Query: 566 EWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSD 387
           E D+ K N +N    N+ +   + +     NN N+    NN    N    N N    +++
Sbjct: 724 EGDSFKNNQINNNNNNINNENNKENLTQSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 783

Query: 386 KVNSANEFRRQNGKTKYNHSKS 321
             N+ N     N     N++ +
Sbjct: 784 NNNNNNNNNNNNNNNNNNNNNN 805



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 24/118 (20%), Positives = 45/118 (38%), Gaps = 7/118 (5%)
 Frame = -2

Query: 626  DGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKN 447
            D +D + + +        SF+ + +  N+ N    N   +  Q++     NN N+    N
Sbjct: 709  DYYDSDEDGDEYYYHEGDSFKNNQINNNNNNINNENNKENLTQSNNNNNNNNNNNNNNNN 768

Query: 446  NFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS-------KSAVFDMSLQS 294
            N    N    N N    +++  N+ N     N     +++       +S+    SLQS
Sbjct: 769  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDNNDEEQDEIESSSIQFSLQS 826



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 43/218 (19%), Positives = 86/218 (39%), Gaps = 9/218 (4%)
 Frame = -2

Query: 962  QMKKSKQLLKARLAR-------ERQIYEMRKRTELKAAISELERPWEMVEKAPTLFSVSA 804
            ++K+ K+L K  L R       +  I + +K  +L+    EL++  ++            
Sbjct: 644  EIKEEKRLHKLYLNRIEKQNIIKNNILKKQKDQQLRLQRKELQKQKQL------------ 691

Query: 803  DEQLKVLADRFQRPGGFDMW-SEKDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENIS 627
              Q +  +  +  P   D + S++DG E    E D             S K   ++ N +
Sbjct: 692  QHQRQHQSSDYYYPHEVDYYDSDEDGDEYYYHEGD-------------SFKN-NQINNNN 737

Query: 626  DGFDDEN-EDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            +  ++EN ++N T   N ++   +    N+ N    N  ++   N+     NN N+    
Sbjct: 738  NNINNENNKENLTQSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN----NNNNNNNNN 793

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY 336
            NN    N    N N +    +  +S+ +F  Q+   ++
Sbjct: 794  NNNNNNNNNNNNDNNDEEQDEIESSSIQFSLQSSVIRF 831



>gb:AC116986_1207459 Dictyostelium discoideum chromosome 2 map
           2234041-2567370 strain AX4, complete sequence.
          Length = 593

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 26/106 (24%), Positives = 38/106 (35%)
 Frame = -2

Query: 656 KPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPY 477
           KP   V N +D  +D + DN     N +  + D    N  +    N   +   N      
Sbjct: 296 KPRPSVNNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNDNNN 355

Query: 476 NNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
           NN N+    NN    N    N N    +++  N+ N     NG  K
Sbjct: 356 NNNNNNNNNNNNNNNNNNNNNNNNNGNNNNGNNNGNNNGNGNGNNK 401



>gb:AC116984_1207322 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 734

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 37/159 (23%), Positives = 62/159 (38%), Gaps = 20/159 (12%)
 Frame = -2

Query: 689 RFFPKGVVHSIKPYGKVENISDGFDDENED----------NRTLGRNKSSFEWDTV---- 552
           RF  K    +I    +V  ISD  D E+ED            T+G N ++     +    
Sbjct: 48  RFKSKASKFNINNRKEVIEISDDDDTEDEDLQKAIAFSLGTTTIGNNNNNNRSHILSMIR 107

Query: 551 -KTNSL-----NRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSS 390
            K NS      N  +RN  +S +++S      N N     NN    N    N N    ++
Sbjct: 108 NKNNSSPPLLENSIDRNQFYSNKKSSSSYNNFNNNFNNNNNNNNNNNNNNNNNNNNNNNN 167

Query: 389 DKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQ 273
           +K N++N     N       S + +  + +  + +Y+F+
Sbjct: 168 NKNNNSNNNNNNNNNKDKKESGTIIGGVLIDKNENYKFK 206



>gb:AC115684_1206046 Dictyostelium discoideum chromosome 2 map
           3108975-3191114 strain AX4, complete sequence.
          Length = 340

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 24/105 (22%), Positives = 43/105 (40%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           +N ++   + N+DN T   N  +   +    N+ N    N  ++   N+     NN N+ 
Sbjct: 181 DNNNNENSNSNQDNNTDENNNKNDNNNDNDDNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 240

Query: 458 VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
              NN    +    N N +  S+      N  +++  KTK N +K
Sbjct: 241 NNNNNNNNNDNNDNNDNNDNNSNINNKETNNDQKKTKKTKKNVNK 285



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 23/113 (20%), Positives = 44/113 (38%)
 Frame = -2

Query: 659 IKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
           +K       I D  D+ N +N    ++ ++ E +    N+ +  + N  ++   N+    
Sbjct: 167 LKDINTTSPILDHTDNNNNENSNSNQDNNTDENNNKNDNNNDNDDNNNNNNNNNNNNN-- 224

Query: 479 YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            NN N+    NN    N    N N    + +  N+ N     N +T  +  K+
Sbjct: 225 -NNNNNNNNNNNNNNNNNNNNNNNNNDNNDNNDNNDNNSNINNKETNNDQKKT 276



>gb:AC115598_1205808 Dictyostelium discoideum chromosome 2 map
            581427-735498 strain AX4, complete sequence.
          Length = 885

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 22/130 (16%), Positives = 55/130 (42%), Gaps = 1/130 (0%)
 Frame = -2

Query: 659  IKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
            + P+   +++ +  ++ N +N  +  N +         N+ N  + N  ++   N+    
Sbjct: 692  LTPFNLFKSLPENNNNNNNNNNNINNNNN---------NNNNNNQNNNQNNSNNNNNNNN 742

Query: 479  YNNKNDKVMKNNFRKGNRRKYNT-NLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
            +NN N+    NN    N    N  N  + ++  +N+ N   + N +   N++ +   +M 
Sbjct: 743  HNNSNNNNNNNNHNNSNNNNNNNQNNNQNNNQNINNQNN-NQNNNQNNQNNNNNIEKEME 801

Query: 302  LQSDGSYEFQ 273
            +++    + Q
Sbjct: 802  IENSQPVQSQ 811



>gb:PFMAL8P1_1192193 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 758

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 25/127 (19%), Positives = 49/127 (38%), Gaps = 21/127 (16%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           E I +   + N +N  +  N ++        N++N    N+ ++   N+     NN N+ 
Sbjct: 320 EYIYNTNSNNNNNNNNINNNNNNI-------NNINNNNNNINNNNNNNNNINNINNNNNN 372

Query: 458 VMKNNFRKGNRRKYNTN---------------------LERLSSDKVNSANEFRRQNGKT 342
           +  NN    ++RKY +N                     ++  +++  NS N +   N   
Sbjct: 373 INNNNNNNNSQRKYFSNEPSHGYVPDGRFIQDDNRKKFIKTSNNNNNNSYNNYNNYNNYN 432

Query: 341 KYNHSKS 321
            YN+  S
Sbjct: 433 NYNNYNS 439



>gb:PFMAL8P1_1192056 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 589

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 30/127 (23%), Positives = 56/127 (44%), Gaps = 7/127 (5%)
 Frame = -2

Query: 692 ARFFPKGVVHSIKPYGKVE----NISDGFDD---ENEDNRTLGRNKSSFEWDTVKTNSLN 534
           +RFF    +++I  Y   +    NI+D FD    E + ++ + +N    + +     +L 
Sbjct: 151 SRFFFTMPINNINNYFNKQHNDKNINDKFDTSHCEEDPDKGVSKNIDHLKREDEHGKALT 210

Query: 533 RRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQ 354
            +E N  ++   N+    YN+ N     NN+  GN   YN N +   ++K N  + +   
Sbjct: 211 NKEMNNNNNNNNNNDDNIYNDDNVYNDDNNYNDGN--IYNNNNDYAYNNKSNEGSTYPLN 268

Query: 353 NGKTKYN 333
             +T  N
Sbjct: 269 EEETNVN 275



>gb:PFMAL7P1_1191905 Plasmodium falciparum 3D7 chromosome 7, ***
            SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 1032

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 36/168 (21%), Positives = 70/168 (41%), Gaps = 3/168 (1%)
 Frame = -2

Query: 761  GGFDMWSEKDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGR 582
            GG D+  ++     LKS   +  +R   +  ++  K Y   E+    +++ ++DN     
Sbjct: 701  GGVDITEDQSYMSDLKSNVSVDKSRKSSRSNINVDKSYTNDEDNKSNYNNNSDDNNNNSD 760

Query: 581  NKSSFEWDTVK-TNSLNRRERNVTHSGEQNSKGMPYNNK-NDKVMKNNFRKGNRRKYNTN 408
            + + +  D  K ++  N    +  ++   N+K    +NK +D   K N  K N RK    
Sbjct: 761  DNNKYSDDNNKYSDDSNEYSDDSNNNNNNNNKYSDDSNKYSDDNNKYNIDKCNGRKNKKL 820

Query: 407  LERLSSD-KVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTE 267
               LS   K+   N   ++     +N  KS   +  +  D  Y+++ E
Sbjct: 821  QPHLSYQYKLIDYNNVSKRQINKVFNTLKSNYNNNCIYIDSDYDYKEE 868



>gb:PFMAL7P1_1191872 Plasmodium falciparum 3D7 chromosome 7, ***
           SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 556

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 28/120 (23%), Positives = 47/120 (39%)
 Frame = -2

Query: 626 DGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKN 447
           D +D+  ED++ +G      E +    N      +NV +S  +NS       K   + +N
Sbjct: 251 DYYDNMEEDDKNVGHVNDMSEQNNNFMNKEKYMSKNVYNSTNKNSNNSSSKGKASNIQQN 310

Query: 446 NFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTE 267
           N    N    N N    + +++N     R    K K       V +  LQ D +Y  ++E
Sbjct: 311 NLNNNNNINNNINHNNNTYNQINDEKTKR----KKKSCCDVEKVEEDDLQKDHAYIIESE 366



>gb:PFMAL7P1_1191787 Plasmodium falciparum 3D7 chromosome 7, ***
            SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 989

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 43/219 (19%), Positives = 95/219 (43%), Gaps = 9/219 (4%)
 Frame = -2

Query: 908  IYEMRKRTELKAAISELERPWEMVEKAPTLFSVSAD--EQLKVLADRFQRPGGFDMWSEK 735
            +YEM+K   ++   +++   ++ +EK    F ++ +  EQ+K   D++Q+   +      
Sbjct: 479  LYEMKKNNSIQEK-NDMSMNFKGIEKGTANFLLNHEKNEQIKEYKDKYQKNNTY------ 531

Query: 734  DGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRN-----KSS 570
                  +SE +    +++ K            E I++ + D+ + N T  R      K  
Sbjct: 532  ------QSEQNCDIKQYYEKN-----------EQINE-YKDKYQKNNTYQREQNCDIKQY 573

Query: 569  FEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV--MKNNFRKGNRRKYNTNLERL 396
            +E +       N+ ++N T+  EQN     Y  KN+++   K+ ++K N  +   N +  
Sbjct: 574  YEKNEQINEYKNKYQKNNTYQSEQNCDIKQYYEKNEQINEYKDKYQKNNTYQSEQNCDIN 633

Query: 395  SSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
            + D     N+   ++ K++ N+  S + +    +   YE
Sbjct: 634  TLDIKQVTNQI--EDIKSEQNNVYSNITENPFFNTDEYE 670



>gb:PFMAL13_1191244 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 2672

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 17/88 (19%), Positives = 36/88 (40%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            N +N  +  + ++   +    N++N    N+ +    N+     NN N+ +   N    N
Sbjct: 950  NSNNNNINSHNNNMNNNNDNMNNMNNNNNNINNMNNNNNNINNMNNNNNNINNMNNNNNN 1009

Query: 428  RRKYNTNLERLSSDKVNSANEFRRQNGK 345
                N N   ++++  N+ +     NGK
Sbjct: 1010 MNNMNNNNNNINNNNNNNNHNNNSSNGK 1037



>gb:AE014186_938196 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014839_1228930 Plasmodium falciparum 3D7
            chromosome 11 section 4 of 8 of the complete sequence.
          Length = 1956

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 29/144 (20%), Positives = 62/144 (43%), Gaps = 8/144 (5%)
 Frame = -2

Query: 671  VVHSIKPY-----GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVT-- 513
            + ++I PY      K  N    F+ ++ED      N SSF    ++++S     ++++  
Sbjct: 833  IQNNIYPYKNYNKNKKRNFFFSFNTDSEDYNNKYLNNSSFSM--LRSHSYENHFKHISYD 890

Query: 512  -HSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY 336
             H  +     + Y + ND  + NN    N   YN++    + + +  +N+ +  N  T  
Sbjct: 891  NHLNDPKKNYIKYRDNND--INNNNNNNNNYYYNSHFGNYNHELIQHSNDEKDSNENTYN 948

Query: 335  NHSKSAVFDMSLQSDGSYEFQTEN 264
            N +++  F+    ++   E +  N
Sbjct: 949  NINRNIFFNKLESAENEKENENNN 972



>gb:AE014185_937937 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014834_1228671 Plasmodium falciparum 3D7
            chromosome 10 section 6 of 7 of the complete sequence.
          Length = 1681

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 13/124 (10%)
 Frame = -2

Query: 626  DGFDDEN--EDNRTLGRNKSSFEW---DTVKTNSLNRRERNVTHSGEQNSKG------MP 480
            + FD+ N    N  +  N S   +   + VK N LN  + N+++SG+    G      + 
Sbjct: 1279 ENFDESNLYAHNNNIHMNNSFVNFINGNNVKKNQLNGDDDNISNSGDMTITGTHQAINLT 1338

Query: 479  YNNKNDKVMKN--NFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDM 306
            ++N  + V +N  N    N    N N    +++  N+ N     NG    N + S + ++
Sbjct: 1339 HDNSTNNVNQNATNVNNNNSSNNNNNNNNNNNNNNNNNNNNNNNNGVCVDNTTNSGLGNL 1398

Query: 305  SLQS 294
            SL +
Sbjct: 1399 SLNN 1402



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 20/87 (22%), Positives = 38/87 (43%)
 Frame = -2

Query: 584  RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
            +NK+    D    N++N    N   +  +N      +NKN   + NN    N +  N  L
Sbjct: 979  KNKNQKREDYHNNNNINSIHNNDLFNESKNKSTYVSSNKNSHHINNNNNNNNNKSNNLTL 1038

Query: 404  ERLSSDKVNSANEFRRQNGKTKYNHSK 324
             ++ +   +++N    Q  +T  N++K
Sbjct: 1039 PKIGAS--SASNSLSHQQLQTSINNTK 1063



>pir|S60712|S60712 band-6-protein - human>gb:HSB6PR_2010842
           H.sapiens band-6-protein mRNA.
          Length = 725

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 44/183 (24%), Positives = 81/183 (44%), Gaps = 29/183 (15%)
 Frame = -2

Query: 902 EMRKRTELKAAISELERPWEM-VEKAPT--LFSVSADEQLK---------VLADRFQRP- 762
           E R++  ++ A+S L R     ++K  T  L+++S+ ++LK         VLADR   P 
Sbjct: 323 ETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELKEELIADALPVLADRVIIPF 382

Query: 761 -----GGFDMWSEKDGPE-----------LLKSEADLPSARFFPKGVVHSIKPYGKVENI 630
                G  +M  E   PE           L  ++A   + R +  G++ S+  Y +    
Sbjct: 383 SGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADAGRQTMRNY-SGLIDSLMAYVQNCEA 441

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           +   DD++ +N     +  S+  D        + E N  ++  + S    ++NK+DK+M 
Sbjct: 442 ASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRKLEYNARNAYPEKSSTGCFSNKSDKMMN 501

Query: 449 NNF 441
           NN+
Sbjct: 502 NNY 504



>pir|A44865|S16752 major merozoite surface antigen MSA-1 - malaria
           parasite  (Plasmodium falciparum) (fragments)
          Length = 1086

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 416 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 474

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N ++   DK+ SA   
Sbjct: 475 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFDKDVVDKIFSARYT 534

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 535 YNVEKQIYNNKFSSSNNSVYNV 556



>gb:A08351_1447156 Partial synthetic nucleotide sequence of Ag512.
          Length = 280

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 37/122 (30%), Positives = 55/122 (45%), Gaps = 15/122 (12%)
 Frame = -2

Query: 599 NRTLGRNKSS-----------FEWDT-VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N+ LG NK S           FE D   + N L  +E+N+     +NSK    N  N K+
Sbjct: 133 NKKLGNNKKSQMILEEEPEENFEEDADEELNKLMEQEKNIVDKEIKNSKA---NKSNKKL 189

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY---NHSKSAVFDMSLQSDGS 285
             NN  K N + Y  N E  +  K N  N+F +QN    Y   ++ ++  F+ + QS+  
Sbjct: 190 QFNNTNKQN-KMYMKN-EYNNKTKNNKNNKFEQQNYDESYMDDDYEQNEEFNDNNQSEDM 247

Query: 284 YE 279
            E
Sbjct: 248 KE 249



>gb:PFMAL3P7_1394567 Plasmodium falciparum MAL3P7, complete sequence.
          Length = 1200

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 26/116 (22%), Positives = 47/116 (40%)
 Frame = -2

Query: 611  ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
            +++  + +  NK S + +    N LN     +    +++ K    NN N+    NN    
Sbjct: 1031 DDDTIKNMNSNKISDKHNMKSNNILNNENGKIN---DKSKKCKNINNNNNNNNNNNNNNN 1087

Query: 431  NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
            N    N N    SS KV+  N     N   +  H+ S V+ ++L  +   E   ++
Sbjct: 1088 NNNNNNNNSSSSSSGKVDGINILNNSNTNERL-HTFSGVYSLNLNDEIKIEINKKD 1142



>gb:PFMAL1P2_1394372 Plasmodium falciparum DNA from MAL1P2.
          Length = 637

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 26/99 (26%), Positives = 46/99 (46%)
 Frame = -2

Query: 647 GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           GK  N ++  +D N++N     N S+   +    NS    +R  TH    N     Y N+
Sbjct: 164 GKKNNSNNNNNDNNDNNDNNNSNNSNNNNNNNNNNSNEYTKRKNTHKKHLNEH---YKNE 220

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
           ++K      +K N +KYN ++   ++ K N  N+ + +N
Sbjct: 221 SNK------KKVNEKKYNNSVYVNNNIKKNHVNKNKNEN 253



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 25/107 (23%), Positives = 48/107 (44%), Gaps = 4/107 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI D    + ++N+   R+    + D +  N    ++ N  ++   N+     NN N+  
Sbjct: 132 NIKDIRRKKKDNNKEYIRDHMKKKKDIIMNNK--GKKNNSNNNNNDNNDNNDNNNSNNSN 189

Query: 455 MKNNFRKGNRRKY----NTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
             NN    N  +Y    NT+ + L+    N +N  +++  + KYN+S
Sbjct: 190 NNNNNNNNNSNEYTKRKNTHKKHLNEHYKNESN--KKKVNEKKYNNS 234



>gb:PFA929355_1393256 Plasmodium falciparum strain 3D7, chromosome 9;
            segment 1/5.
          Length = 3135

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 28/113 (24%), Positives = 40/113 (35%), Gaps = 4/113 (3%)
 Frame = -2

Query: 650  YGKVENISDGFDDENEDNRTLGRNKSSFEWDTV--KTNSLNRRERNVTHSGEQNS--KGM 483
            Y + +N+      E  D +   R +SS   D    K N    ++ N  +    N+     
Sbjct: 1124 YAERDNMRVQVSKEGSDKKNNNRKRSSGSCDNSNNKNNKCYNKKNNNKNKNNNNNNYNNN 1183

Query: 482  PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
             YNN N+    NN    N    N N +    DK NS       N     N+ K
Sbjct: 1184 YYNNNNNNNNNNNNNNNNNSNNNPNDDNNEDDKNNSNKNTDNNNKNNNINNKK 1236



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 43/204 (21%), Positives = 82/204 (40%), Gaps = 3/204 (1%)
 Frame = -2

Query: 920  RERQIYEMRKRTELKAAISELERPWEMV---EKAPTLFSVSADEQLKVLADRFQRPGGFD 750
            +++QIYE      LK   +++ + W+++   EK  TLF+ S+   + + A+R        
Sbjct: 1080 KKKQIYE--NVISLKDIFTKICKQWDIIKKKEKDITLFNNSS--MVNIYAER----DNMR 1131

Query: 749  MWSEKDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSS 570
            +   K+G +   +     S         ++ K Y K  N           N+    N ++
Sbjct: 1132 VQVSKEGSDKKNNNRKRSSGSCDNSNNKNN-KCYNKKNN-----------NKNKNNNNNN 1179

Query: 569  FEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSS 390
            +  +    N+ N    N  ++   N+     NN++DK   N     N +  N N ++   
Sbjct: 1180 YNNNYYNNNNNNNNNNNNNNNNNSNNNPNDDNNEDDKNNSNKNTDNNNKNNNINNKKKRR 1239

Query: 389  DKVNSANEFRRQNGKTKYNHSKSA 318
             + N  N+  +Q  K   N +K A
Sbjct: 1240 KRNNDDND--KQINKRNKNINKKA 1261



>gb:PFA28C6_1392173 Plasmodium falciparum mRNA for asparagine-rich
           antigen (clone 28C6).
          Length = 239

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 27/138 (19%)
 Frame = -2

Query: 635 NISDGFDD-ENEDNRTLGRNKSSFEWDTVKTNSLNR-RERNVTHSGEQNSKGMPYNNKND 462
           N++D FD   N DN  + R +S+F   +++ N  N+  + N+++    N+     NN N+
Sbjct: 29  NLNDSFDSLNNNDNNNMNR-RSNF---SIRNNKFNKFHDNNMSNLNNNNNNNNNNNNHNN 84

Query: 461 KVMKNNFRKGNRRKY-------------NTNLERLS------------SDKVNSANEFRR 357
               NNF   NR  Y             N NL   +            SDK  S + +R 
Sbjct: 85  NNNNNNFDHNNRNSYKKSNYATDNSNNNNNNLNNNNNMSGTKKLLWRDSDKTGSMSTWRL 144

Query: 356 QNGKTKYNHSKSAVFDMS 303
             GK   ++  S++  M+
Sbjct: 145 --GKNSVSNHNSSMNHMN 160



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 22/96 (22%), Positives = 39/96 (40%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           NE N    RN  +  +D++  N  N   R    S   N     ++N    +  NN    N
Sbjct: 19  NERNDFYCRNNLNDSFDSLNNNDNNNMNRRSNFSIRNNKFNKFHDNNMSNLNNNNNNNNN 78

Query: 428 RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              +N N    + D  N+ N +++ N  T  +++ +
Sbjct: 79  NNNHNNNNNNNNFDH-NNRNSYKKSNYATDNSNNNN 113



>gb:CR382399_1374979 Plasmodium falciparum chromosome 6, complete
           sequence; segment 2/5.
          Length = 2747

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 20/77 (25%), Positives = 34/77 (44%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
           E  +D  +++  DN +L + K   + D    N++N    N  ++  +N+     NNKN+ 
Sbjct: 377 EPSNDITNNQGIDNHSLKKKKKKKKKDDKNNNNINNNNNNNKNNNNKNNNNKNNNNKNNN 436

Query: 458 VMKNNFRKGNRRKYNTN 408
              NN    N    N N
Sbjct: 437 NDNNNNDNNNNNNNNNN 453



>gb:CR382398_1374874 Plasmodium falciparum chromosome 6, complete
           sequence; segment 1/5.
          Length = 2874

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 34/135 (25%), Positives = 53/135 (39%), Gaps = 24/135 (17%)
 Frame = -2

Query: 635 NISDGFDD-ENEDNRTLGRNKSSFEWDTVKTNSL-----------NRRERNVTHSGEQNS 492
           N++D FD   N DN  + R +S+F     K N             N    N  H+   N+
Sbjct: 225 NLNDSFDSLNNNDNNNMNR-RSNFSIRNNKFNKFHDNNMSNLNNNNNNNNNNNHNNNNNN 283

Query: 491 KGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLS------------SDKVNSANEFRRQNG 348
               +NN+N    K+N+   N    N NL   +            SDK  S + +R   G
Sbjct: 284 NNFDHNNRNS-YKKSNYATDNSNNNNNNLNNNNNMSGTKKLLWRDSDKTGSMSTWRL--G 340

Query: 347 KTKYNHSKSAVFDMS 303
           K   ++  S++  M+
Sbjct: 341 KNSVSNHNSSMNHMN 355



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 25/102 (24%), Positives = 43/102 (42%), Gaps = 3/102 (2%)
 Frame = -2

Query: 647  GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
            GK  N ++  ++ N +N     N ++        N+ N+  R    +   N K  P +  
Sbjct: 970  GKNTNSNNNNNNNNNNNNNNNNNNNN-------NNNNNKSNRMYGMATSSNIKEHPVDRN 1022

Query: 467  N---DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
            N   DK+M NN      +K N ++    S  +NS N   ++N
Sbjct: 1023 NYNKDKIMNNNMSVLKNKKNNESVFTNGSSNINSVNNMFKEN 1064



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 23/96 (23%), Positives = 43/96 (44%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           NE N    RN  +  +D++  N  N   R    S  +N+K   +++ N   + NN    N
Sbjct: 215 NERNDFYCRNNLNDSFDSLNNNDNNNMNRRSNFS-IRNNKFNKFHDNNMSNLNNNNNNNN 273

Query: 428 RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              +N N    + D  N+ N +++ N  T  +++ +
Sbjct: 274 NNNHNNNNNNNNFDH-NNRNSYKKSNYATDNSNNNN 308



>gb:AY324391_1319649 Plasmodium falciparum rhoptry associated
           membrane antigen (RAMA) gene, complete cds.
          Length = 861

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 37/122 (30%), Positives = 55/122 (45%), Gaps = 15/122 (12%)
 Frame = -2

Query: 599 NRTLGRNKSS-----------FEWDT-VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N+ LG NK S           FE D   + N L  +E+N+     +NSK    N  N K+
Sbjct: 612 NKKLGNNKKSQIILEEEPDENFEEDADEELNKLMEQEKNIVDKEIKNSKA---NKSNKKL 668

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY---NHSKSAVFDMSLQSDGS 285
             NN  K N + Y  N E  +  K N  N+F +QN    Y   ++ ++  F+ + QS+  
Sbjct: 669 QFNNTNKQN-KMYMKN-EYNNKTKNNKNNKFEQQNYDESYMDDDYEQNEEFNDNNQSEDM 726

Query: 284 YE 279
            E
Sbjct: 727 KE 728



>gb:AY162269_1305668 Dictyostelium discoideum cGMP-specific
           phosphodiesterase (PDE3) gene, complete cds.
          Length = 522

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 25/103 (24%), Positives = 42/103 (40%)
 Frame = -2

Query: 632 ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
           +S   D+ N +  +L  N S+   +    N+ N    N  ++   N+     NN N+   
Sbjct: 77  VSQNNDNLNHNVHSLN-NSSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 135

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
            NN     + K N N  R +SD  N+ N     N     N+++
Sbjct: 136 NNNNSINEKNKINDNNNRGNSDDGNNNNSNNNSNNNNSNNNNR 178



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 25/117 (21%), Positives = 46/117 (39%), Gaps = 1/117 (0%)
 Frame = -2

Query: 668 VHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSK 489
           VHS+       N ++  ++ N +N     N ++        N+ N    N  ++   N+ 
Sbjct: 88  VHSLNNSSNNNNNNNNNNNNNNNNNNNNNNNNN--------NNNNNNNNNNNNNNNNNNN 139

Query: 488 GMPYNNK-NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            +   NK ND   + N   GN    N N    +S+  N  +E    + +   N++ S
Sbjct: 140 SINEKNKINDNNNRGNSDDGNNNNSNNNSNNNNSNNNNRDDEEEEGDDEDNNNNNNS 196



>gb:AF111943_1242077 Dictyostelium discoideum AX4 development
           protein DG1124 (DG1124) gene, partial cds.
          Length = 757

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 23/86 (26%), Positives = 34/86 (39%), Gaps = 5/86 (5%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK-----VMKN 447
           E E N  L  N ++   +    N +N  + N  +  E N       N+ND      +  N
Sbjct: 459 EGELNEGLNNNTNNINNNNNNNNEINNNDNNNNNQNENN-------NQNDNNNEYNIESN 511

Query: 446 NFRKGNRRKYNTNLERLSSDKVNSAN 369
           N+   +    NTN    SS  +NS N
Sbjct: 512 NYNNNDNSSNNTNTSNTSSSSINSPN 537



>gb:AF111942_1242076 Dictyostelium discoideum AX4 development
           protein DG1106 (DG1106) gene, partial cds.
          Length = 954

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 20/95 (21%), Positives = 40/95 (42%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI+   ++ N +N  +  N + F +     N+ N    N  ++   N+  +  NN N+  
Sbjct: 184 NINSNNNNNNNNNENINNNHNQFLYSCNNNNNNNTNNINNNNNNNNNNNNIGSNNNNNNN 243

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
             NN     +   N N+   ++  +N++N     N
Sbjct: 244 NINNSHHIYKSNSNNNIFINNNSLINNSNNSNNNN 278



>gb:AC116986_1207500 Dictyostelium discoideum chromosome 2 map
            2234041-2567370 strain AX4, complete sequence.
          Length = 1282

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 23/86 (26%), Positives = 34/86 (39%), Gaps = 5/86 (5%)
 Frame = -2

Query: 611  ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDK-----VMKN 447
            E E N  L  N ++   +    N +N  + N  +  E N       N+ND      +  N
Sbjct: 984  EGELNEGLNNNTNNINNNNNNNNEINNNDNNNNNQNENN-------NQNDNNNEYNIESN 1036

Query: 446  NFRKGNRRKYNTNLERLSSDKVNSAN 369
            N+   +    NTN    SS  +NS N
Sbjct: 1037 NYNNNDNSSNNTNTSNTSSSSINSPN 1062



>gb:AC116984_1207422 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 899

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 19/98 (19%), Positives = 40/98 (40%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           + N ++ +   N ++   +    N+ N    N T++   N     +NN N+    NN   
Sbjct: 22  NSNSNSNSNNNNNNNNNNNNNNNNNNNNNNSNNTNNSVSNITKHSHNNNNNNNNNNNSNN 81

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
            N    N N+   +++ +N+ N     N     N++ +
Sbjct: 82  NNNNNNNNNININNNNNINNNNNNNNNNNNNNNNNNNN 119



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/110 (19%), Positives = 43/110 (39%), Gaps = 4/110 (3%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVT----HSGEQNSKGMPYNNKND 462
           S+   + N +N     N ++   +   +N+ N    N+T    ++   N+     NN N+
Sbjct: 25  SNSNSNNNNNNNNNNNNNNNNNNNNNNSNNTNNSVSNITKHSHNNNNNNNNNNNSNNNNN 84

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVF 312
               NN    N    N N    +++  N+ N     N     N++ ++ +
Sbjct: 85  NNNNNNININNNNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSPY 134



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 21/103 (20%), Positives = 40/103 (38%), Gaps = 3/103 (2%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N S+   ++V   + +    N  ++   NS     NN N+ +
Sbjct: 32  NNNNNNNNNNNNNNNNNNNNSNNTNNSVSNITKHSHNNNNNNNNNNNSNNNNNNNNNNNI 91

Query: 455 ---MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKY 336
                NN    N    N N    +++  N+ N     N  + Y
Sbjct: 92  NINNNNNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSPY 134



>gb:AC116984_1207396 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 311

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 24/99 (24%), Positives = 41/99 (41%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N +  E +T   NS N    N  ++   N+     NN N+  
Sbjct: 47  NNNNNNNNNNNNNNNNNSNSNDIELETEPNNSNNNNNNNNNNNNNNNNNNN--NNNNNNN 104

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
             NN  + N +  N  +  L S K+     F++  G  K
Sbjct: 105 NNNNKNENNNKIKNEKINILLSIKLYFIQYFKKWKGGEK 143



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 25/108 (23%), Positives = 41/108 (37%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           +V+N+S    +   DN  +  N +  E +T+  +S N    N              NN N
Sbjct: 5   EVDNLSHTNKNVATDN--INNNNNDIELETIPNDSNNSNNNN--------------NNNN 48

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           +    NN    N    N+N   L ++  NS N     N     N++ +
Sbjct: 49  NNNNNNNNNNNNNNNSNSNDIELETEPNNSNNNNNNNNNNNNNNNNNN 96



>gb:AC116982_1207194 Dictyostelium discoideum chromosome 2 map
           3622643-3879522 strain AX4, complete sequence.
          Length = 1207

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 20/95 (21%), Positives = 40/95 (42%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI+   ++ N +N  +  N + F +     N+ N    N  ++   N+  +  NN N+  
Sbjct: 437 NINSNNNNNNNNNENINNNHNQFLYSCNNNNNNNTNNINNNNNNNNNNNNIGSNNNNNNN 496

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
             NN     +   N N+   ++  +N++N     N
Sbjct: 497 NINNSHHIYKSNSNNNIFINNNSLINNSNNSNNNN 531



>gb:AC116979_1207098 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 812

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 32/118 (27%), Positives = 48/118 (40%), Gaps = 3/118 (2%)
 Frame = -2

Query: 758 GFDMWSEKDGPELLKSEADLPS---ARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTL 588
           GFD  +E D  EL ++E D       R F            K +N+++  ++ N +N T 
Sbjct: 560 GFDASNENDD-ELEENEMDFSDDEKEREFKAQRKMKKNNNKKRKNMNNNNNNNNNNNNTN 618

Query: 587 GRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYN 414
             +          TN+ N   RN +++   NS     NN N  +  NN   GNR   N
Sbjct: 619 DNDGCVIP----PTNNRNFNRRNNSYNNSNNSNNNNNNNNNSNINNNNNNNGNRNNQN 672



>gb:AC116330_1206262 Dictyostelium discoideum chromosome 2 map
           3191214-3323468 strain AX4, complete sequence.
          Length = 684

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 22/106 (20%), Positives = 40/106 (37%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+    NN  
Sbjct: 550 NNNNNNNNNNNNNNNNLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 609

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSL 300
             N    N N    +++  N+ N          +N SK+    +SL
Sbjct: 610 NNNNNNNNNNNNNNNNNNNNNNNNNNNNTFDYSFNDSKNDEHKVSL 655



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 25/119 (21%), Positives = 43/119 (36%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N +   ++ N +N     N +         N+LN    N  ++   N+     NN N+  
Sbjct: 543 NSNHAHNNNNNNNNNNNNNNN---------NNLNNNNNNNNNNNNNNNNNN--NNNNNNN 591

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
             NN    N    N N    +++  N+ N     N     N++ +  FD S     + E
Sbjct: 592 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTFDYSFNDSKNDE 650



>gb:AC115605_1205886 Dictyostelium discoideum chromosome 2 map
           5817431-5836155 strain AX4, complete sequence.
          Length = 391

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 27/112 (24%), Positives = 42/112 (37%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           S   ++ N +N     N ++   +    N+ N    N + S   N+     NN N+    
Sbjct: 233 SSSNNNNNNNNNNNNNNNNNNNNNINNNNNTNNNNNNSSSSSSNNNNSNNNNNNNNNNSN 292

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQS 294
           NN    N    NTN     ++  N  +    QN    YN+S +A    S  S
Sbjct: 293 NN---NNNINNNTNNHTNINNNNNIKSYSTSQNSAIVYNYSSTATSSSSTSS 341



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 31/145 (21%), Positives = 51/145 (35%)
 Frame = -2

Query: 755 FDMWSEKDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNK 576
           FDM+S++      K E D   A+      +    P     N S   +    +N +   + 
Sbjct: 167 FDMYSKQVEKAKKKMEQDQLQAQIDNTNTI----PSSSTTNTSSVANTTVSNNTSSNNSS 222

Query: 575 SSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERL 396
           SS    +  ++S N    N  ++          NN N+    NN    N    N N    
Sbjct: 223 SSSSSSSSSSSSSNNNNNNNNNN----------NNNNNNNNNNNINNNNNTNNNNNNSSS 272

Query: 395 SSDKVNSANEFRRQNGKTKYNHSKS 321
           SS   N++N     N     N++ +
Sbjct: 273 SSSNNNNSNNNNNNNNNNSNNNNNN 297



>gb:AB116601_1200354 Plasmodium falciparum msp1 gene for merozoite
           surface protein 1, complete cds, isolate:97B317-40.
          Length = 1689

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 29/142 (20%), Positives = 62/142 (43%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 396 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 454

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    ++ K  +    K    K+N N ++   DK+ SA   
Sbjct: 455 QIDLEEKNINHTKEQNKKLLEDYEESKKDYEKLLEKFYEMKFNNNFDKDVVDKIFSARYT 514

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 515 YNVEKQRYNNKFSSSNNSVYNV 536



>gb:AB116597_1200350 Plasmodium falciparum msp1 gene for merozoite
           surface protein 1, complete cds, isolate:97S304-19.
          Length = 1700

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 408 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 466

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N  +   DK+ SA   
Sbjct: 467 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKMFSARYT 526

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 527 YNVEKQRYNNKFSSSNNSVYNV 548



>gb:AB116596_1200349 Plasmodium falciparum msp1 gene for merozoite
           surface protein 1, complete cds, isolate:97S325-14.
          Length = 1699

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 30/142 (21%), Positives = 61/142 (42%), Gaps = 16/142 (11%)
 Frame = -2

Query: 683 FPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRR-------- 528
           +P G+V+ + P   + N     +D+N     +  +      + + T++  R+        
Sbjct: 407 YPNGIVYPL-PLTDIHNSLAADNDKNSYGDLMNPDTKEKINEKIITDNKERKIFINNIKK 465

Query: 527 -----ERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN-- 369
                E+N+ H+ EQN K +    K+ K  +    K    K+N N  +   DK+ SA   
Sbjct: 466 QIDLEEKNINHTKEQNKKLLEDYEKSKKDYEELLEKFYEMKFNNNFNKDVVDKMFSARYT 525

Query: 368 -EFRRQNGKTKYNHSKSAVFDM 306
               +Q    K++ S ++V+++
Sbjct: 526 YNVEKQRYNNKFSSSNNSVYNV 547



>gb:PFMAL7P1_1191920 Plasmodium falciparum 3D7 chromosome 7, ***
            SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 2062

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 30/111 (27%), Positives = 46/111 (41%), Gaps = 8/111 (7%)
 Frame = -2

Query: 608  NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
            N DN     NK++       TN+ N  + N  ++   N+     NN ND V  N F K  
Sbjct: 857  NNDNNKNDDNKNN------DTNNNNNNDNNNNNNNNNNNNNNNNNNLNDDVYPNRFYKNL 910

Query: 428  RRKYNTNLER-LSSDKVNSANEFRRQNGKTKY-------NHSKSAVFDMSL 300
               YN N E  +++D V    +  +     +Y       N++KS+    SL
Sbjct: 911  NNVYNMNHEDCVNNDNVKCFVDGEKDKNNLQYPYYGPIENYTKSSFASDSL 961



>gb:PFMAL13_1191700 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 740

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = -2

Query: 551 KTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNF-RKGNRRKYNTNLERLSSDKVNS 375
           KT+ +N   +N +++ + N+    Y+N ND    NN+  K +   Y+ N +  + D  N 
Sbjct: 397 KTDMINNDNKNDSNNYDNNNDSNNYDNNND---SNNYDNKNDSNNYDNNNDSNNYDNKND 453

Query: 374 ANEFRRQNGKTKYNH 330
           +N +  +N    Y++
Sbjct: 454 SNNYDNKNDSNNYDN 468



>gb:PFMAL13_1191522 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 710

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 36/134 (26%), Positives = 56/134 (41%), Gaps = 3/134 (2%)
 Frame = -2

Query: 638 ENISDGFDDENEDNRTLGRNKSSFEWDTVKTN---SLNRRERNVTHSGEQNSKGMPYNNK 468
           EN  D  DDE  D+        S E D+  TN   S N  +    + G++  K      K
Sbjct: 255 ENNYDDHDDEQMDS-------DSDESDSYYTNNDDSNNYSDETDDYYGDEKKKKKKKKTK 307

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDG 288
             K  KN+ +K  ++K N         K+N+ N+  + N    +  S+  +FD  L    
Sbjct: 308 KKKKKKNSTKKKKKKKKN---------KINNNNKKNKHNNVVDFTWSRIRLFD-HLAVIL 357

Query: 287 SYEFQTEN*ACKLS 246
            YE   +N  CK++
Sbjct: 358 IYEELLKNPLCKIT 371



>gb:AY383694_1178117 Rattus norvegicus LRRGT00039 mRNA, complete
           cds.
          Length = 322

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 22/105 (20%), Positives = 41/105 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N  N     N S+   +    N++N    N  +S   N+     +N N+  
Sbjct: 65  NSNNSSNNNNNSNSNNSNNNSNI--NNSNNNNINNNNNNSNNSNSNNNSNNNNSNSNNSN 122

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    +    N N    S++  N++N     N     N++ S
Sbjct: 123 NSNNNNSNSNNSSNNNNNSNSNNSNNNSNNNNSNNNNINNNNNNS 167



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 21/105 (20%), Positives = 42/105 (40%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  +  N +N  +  N ++       +NS N    N ++S   N+     +N N+  
Sbjct: 80  NSNNNSNINNSNNNNINNNNNNSN----NSNSNNNSNNNNSNSNNSNNSNNNNSNSNNSS 135

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             NN    N    N+N    +++ +N+ N     N     N + +
Sbjct: 136 NNNNNSNSNNSNNNSNNNNSNNNNINNNNNNSNSNNNNSNNSNNN 180



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 22/106 (20%), Positives = 44/106 (41%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N  +  + +S   ++   NS N    + +++   NS     NN N   
Sbjct: 38  NSNNNNNNSNNNNSNINNSNNSNNNNSNSNNSSNNNNNSNSNNSNNNSNINNSNNNNINN 97

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
             NN    N    + N    S++  NS N     N  +  N++ ++
Sbjct: 98  NNNNSNNSNSNNNSNNNNSNSNNSNNSNNNNSNSNNSSNNNNNSNS 143



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 19/84 (22%), Positives = 33/84 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++   + N  N +   N +S        NS +    N +++   N+  +  NN N   
Sbjct: 110 NSNNNNSNSNNSNNSNNNNSNSNNSSNNNNNSNSNNSNNNSNNNNSNNNNINNNNNNSNS 169

Query: 455 MKNNFRKGNRRKYNTNLERLSSDK 384
             NN    N    N+N    +S+K
Sbjct: 170 NNNNSNNSNNNNSNSNSNNSNSNK 193



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 21/107 (19%), Positives = 43/107 (40%), Gaps = 2/107 (1%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN--K 468
           + N ++  ++ +  N +   N +S   ++   +++N    N  ++   NS     NN   
Sbjct: 53  INNSNNSNNNNSNSNNSSNNNNNSNSNNSNNNSNINNSNNNNINNNNNNSNNSNSNNNSN 112

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
           N+    NN    N    N+N    +++  NS N     N     N++
Sbjct: 113 NNNSNSNNSNNSNNNNSNSNNSSNNNNNSNSNNSNNNSNNNNSNNNN 159



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 19/105 (18%), Positives = 42/105 (40%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           ++  ++ N ++     N +S   ++   NS N    N   +   N+     +N ++    
Sbjct: 92  NNNINNNNNNSNNSNSNNNSNNNNSNSNNSNNSNNNNSNSNNSSNNNNNSNSNNSNNNSN 151

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
           NN    N    N N    +++  N++N     +     N +K+A+
Sbjct: 152 NNNSNNNNINNNNNNSNSNNNNSNNSNNNNSNSNSNNSNSNKTAI 196



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 24/108 (22%), Positives = 42/108 (38%), Gaps = 3/108 (2%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NI++  ++   +N     N +S   +    N+ N    N +++   NS     NN N   
Sbjct: 86  NINNSNNNNINNNNNNSNNSNSN--NNSNNNNSNSNNSNNSNNNNSNSNNSSNNNNNSNS 143

Query: 455 MKNNFRKGNRRKYNTNL---ERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             +N    N    N N+      S+   N++N     N  +  N+S S
Sbjct: 144 NNSNNNSNNNNSNNNNINNNNNNSNSNNNNSNNSNNNNSNSNSNNSNS 191



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 22/113 (19%), Positives = 43/113 (38%)
 Frame = -2

Query: 602 DNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRR 423
           ++R    N S+   +    N+ N    N +++   NS     NN N     +N       
Sbjct: 30  ESRDCSSNNSNNNNNNSNNNNSNINNSNNSNNNNSNSNNSSNNNNNSNSNNSNNNSNINN 89

Query: 422 KYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
             N N+   +++  NS +     N  +  N+S ++  + S  ++ S      N
Sbjct: 90  SNNNNINNNNNNSNNSNSNNNSNNNNSNSNNSNNSNNNNSNSNNSSNNNNNSN 142



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 28/126 (22%), Positives = 47/126 (37%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           +E+     ++ N +N     N S+       +N+ N    N  +S   N+     NN N+
Sbjct: 29  IESRDCSSNNSNNNNNNSNNNNSNIN----NSNNSNNNNSNSNNSSNNNNNSNS-NNSNN 83

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSY 282
               NN    N    N N    +S+  NS N     N     N++ S   + S  ++ S 
Sbjct: 84  NSNINNSNNNNINNNNNNSNNSNSNN-NSNNNNSNSNNSNNSNNNNSNSNNSSNNNNNSN 142

Query: 281 EFQTEN 264
              + N
Sbjct: 143 SNNSNN 148



>gb:AE014188_967930 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014846_1229322 Plasmodium
           falciparum 3D7 chromosome 12, section 3 of 9 of the
           complete sequence.
          Length = 558

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 34/150 (22%), Positives = 64/150 (42%), Gaps = 26/150 (17%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFE--------------WDTVKTNSLNRRERN--VTHSG 504
           ++ D  + EN++   +G++K   E               D  K   L + E+   +T+  
Sbjct: 113 HMKDNSNLENKEKGEIGKDKEQKEKEKEKIIILKDNKKLDEKKKKELQKEEKKTKLTNVL 172

Query: 503 EQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL----------ERLSSDKVNSANEFRRQ 354
           +QN+K    NNKN+   KNN    N    N N+          E +  D +N+ N+ +++
Sbjct: 173 KQNNKNKNNNNKNNN-NKNNNNNNNNNNNNNNMDDTLKKDKQTELIKKDNLNNKNDVKKK 231

Query: 353 NGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
                 N+  +   D+ L+++  Y+   EN
Sbjct: 232 KIDLNINNIDTNSRDI-LKNENKYKKHLEN 260



>gb:AE014188_967836 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014844_1229228 Plasmodium
           falciparum 3D7 chromosome 12, section 1 of 9 of the
           complete sequence.
          Length = 2158

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 34/130 (26%), Positives = 61/130 (46%), Gaps = 7/130 (5%)
 Frame = -2

Query: 737 KDGPELLKSEADLPSARFFPKGVVHS--IKPYGKVENISDGF----DDENEDNRTLG-RN 579
           KDG E+  +  ++ +    P G++++  I+ Y K+   + G     +  N DN+ LG + 
Sbjct: 198 KDGDEISNNINNVSNVH--PNGILNNGDIEEYNKLCLKNSGTVPKKNGNNNDNKMLGTKG 255

Query: 578 KSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLER 399
           K   + +  K N  N+       + E N      NN+++K  KNN    N +    N  +
Sbjct: 256 KEKCKNENNKNNESNK-------NNESNK-----NNESNKSNKNNKSNKNNKSNKNNKSK 303

Query: 398 LSSDKVNSAN 369
            ++DKV +AN
Sbjct: 304 NNNDKVENAN 313



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 28/115 (24%), Positives = 46/115 (40%), Gaps = 8/115 (6%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTL----GRNKSSF----EWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
            N  +G +   +DN  +    G NK++     E DT+K N       N   +  +N     
Sbjct: 1859 NDKEGLNKSGDDNSYVEDIYGNNKNNMKRNKENDTLKKNVSFEYNENENKNENKN----- 1913

Query: 479  YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
              NKN+   +N     N  K     E  + +K  + NE + +N     N +K+ V
Sbjct: 1914 -ENKNENKNENKNENKNENKNENKNENKNENKNENKNENKNENENENKNKNKNNV 1967



>gb:AE014187_938713 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014820_1227789 Plasmodium falciparum 3D7
            chromosome 14 section 5 of 13 of the complete sequence.
          Length = 2084

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 30/133 (22%), Positives = 60/133 (45%)
 Frame = -2

Query: 629  SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            SD  +++N D+ +   N+ ++E +  + N     ERN   + EQN++    N +N++   
Sbjct: 687  SDQHNEQNNDHSSEQNNEQNYERNNERNN-----ERNNGKNNEQNNE--RNNERNNERNN 739

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQT 270
                + N  KYN      ++++ N  N     NG   Y++    ++D    +D S++   
Sbjct: 740  EQNNEHNNEKYNEQ----NNEQNNEQNNNNNNNGDNNYDN----IYD----NDMSFQNYL 787

Query: 269  EN*ACKLSFRWLK 231
                C  +  WL+
Sbjct: 788  VQNICMKNSEWLR 800



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 25/106 (23%), Positives = 40/106 (37%)
 Frame = -2

Query: 611  ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
            E++DN +L    S+ +      +++N  E N + S   N      NN N     NN    
Sbjct: 1241 ESDDNSSLINEYSNMD----SYSNINDNETNTSISHNNN-----INNNNSNNSNNNNNSN 1291

Query: 431  NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQS 294
            N    N N    ++   NS N     N     ++S + +   S  S
Sbjct: 1292 NNNNSNNNNNNSNNSNNNSNNNNNNNNNNNNNHYSNNNIISKSCSS 1337



>gb:AE014186_938297 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014841_1229031 Plasmodium falciparum 3D7
           chromosome 11 section 6 of 8 of the complete sequence.
          Length = 903

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 6/60 (10%)
 Frame = -2

Query: 524 RNVTHSGEQ------NSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEF 363
           RNV  S E+      NS  + YNN N+ ++  NF+K N   ++T +E+   +K    N F
Sbjct: 159 RNVLWSKEKRNTENNNSLSISYNNNNNNLLSTNFQKDNSHLFSTLIEKEKKNKNKKKNNF 218



>gb:AE014186_938242 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014840_1228976 Plasmodium falciparum 3D7
            chromosome 11 section 5 of 8 of the complete sequence.
          Length = 914

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 37/144 (25%), Positives = 61/144 (42%), Gaps = 23/144 (15%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNR----------TLGRNKSSFEWDTVKTNSLNRRERNVTHSGE-- 501
            K +NI D  DD+++++            L  N  SFE    K N + ++  +    G+  
Sbjct: 718  KEKNIKDKRDDKDKNSSYDSPYYSPRDMLSHN--SFE----KNNLIQKKNEDNISQGKGS 771

Query: 500  -QNSKGMPYNNK--------NDKVMKNNFRKGNRR--KYNTNLERLSSDKVNSANEFRRQ 354
             Q+SKG  Y NK        NDK  K    K  R   KY+       + K+N  N  +++
Sbjct: 772  YQSSKGSYYINKERSIYKHSNDKYSKRQKNKSRRTPSKYSNTSSSYDNKKINKHNYNKKK 831

Query: 353  NGKTKYNHSKSAVFDMSLQSDGSY 282
              K KY +S++     +  +  +Y
Sbjct: 832  KKKKKYYYSRNNELSRNSYTSSTY 855



>gb:AE014185_937790 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014832_1228524 Plasmodium falciparum 3D7
           chromosome 10 section 4 of 7 of the complete sequence.
          Length = 1434

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 5/110 (4%)
 Frame = -2

Query: 635 NISDG--FDDENED-NRTLGRNKSSFEWDTVKTNSLNRR--ERNVTHSGEQNSKGMPYNN 471
           N SDG   + +N D N  +  NKSS   +T   N+ N     +N+T+    N    P NN
Sbjct: 81  NNSDGNNINSKNSDTNHNITNNKSSNN-NTTNHNTTNHSITNKNITNHNIAN----PNNN 135

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
             +   KNN++  N  K N      +++K N+ N   + N K   N+  +
Sbjct: 136 NPNDNPKNNYKDKNNNKNNNKNNNKNNNKNNNKNN-NKNNNKNNNNNKNN 184



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 28/115 (24%), Positives = 45/115 (39%), Gaps = 12/115 (10%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDT------VKTNSLNRRERNVTHSGEQNSK--- 489
           + NIS      + +N + G N +S   DT       K+++ N    N T+    N     
Sbjct: 67  IYNISKLILHNSNNNNSDGNNINSKNSDTNHNITNNKSSNNNTTNHNTTNHSITNKNITN 126

Query: 488 ---GMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
                P NN  +   KNN++  N  K N      +++K N+ N  +  N     N
Sbjct: 127 HNIANPNNNNPNDNPKNNYKDKNNNKNNNKNNNKNNNKNNNKNNNKNNNKNNNNN 181



>gb:AE014185_937609 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014829_1228343 Plasmodium falciparum 3D7
           chromosome 10 section 1 of 7 of the complete sequence.
          Length = 1425

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 6/118 (5%)
 Frame = -2

Query: 662 SIKPYGKVENISDGFDDENEDNR-----TLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ 498
           +I PY    +  D     N++ +     T   N ++   D    N  N    N  H+   
Sbjct: 373 NISPYKLGSHYMDHLSCHNKEGKNISTTTTNSNNNNNNDDNNNNNDNNNNHNNNNHNNNH 432

Query: 497 NSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFR-RQNGKTKYNHS 327
           N+    +NN ++ +  N ++  N   YN N     + K+N+ N+     N    Y+H+
Sbjct: 433 NNN---HNNNDNTIGTNIYKHHNNVNYNNNHNINDNIKINNLNDLNVHDNNYFPYDHT 487



>pir|S14470|S14470 asparagine-rich protein (clone 28C6) - Plasmodium
           falciparum (fragment)
          Length = 239

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 27/138 (19%)
 Frame = -2

Query: 635 NISDGFDD-ENEDNRTLGRNKSSFEWDTVKTNSLNR-RERNVTHSGEQNSKGMPYNNKND 462
           N++D FD   N DN  + R +S+F   +++ N  N+  + N+++    N+     NN N+
Sbjct: 29  NLNDSFDSLNNNDNNNMNR-RSNF---SIRNNKFNKFHDNNMSNLNNNNNNNNNNNNHNN 84

Query: 461 KVMKNNFRKGNRRKY-------------NTNLERLS------------SDKVNSANEFRR 357
               NNF   NR  Y             N NL   +            SDK  S + +R 
Sbjct: 85  NNNNNNFDHNNRNSYKKSNYATDNSNNNNNNLNNNNNMSGTKKLLWRDSDKTGSMSTWRL 144

Query: 356 QNGKTKYNHSKSAVFDMS 303
             GK   ++  S++  M+
Sbjct: 145 --GKNSVSNHNSSMNHMN 160



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 22/96 (22%), Positives = 39/96 (40%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           NE N    RN  +  +D++  N  N   R    S   N     ++N    +  NN    N
Sbjct: 19  NERNDFYCRNNLNDSFDSLNNNDNNNMNRRSNFSIRNNKFNKFHDNNMSNLNNNNNNNNN 78

Query: 428 RRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
              +N N    + D  N+ N +++ N  T  +++ +
Sbjct: 79  NNNHNNNNNNNNFDH-NNRNSYKKSNYATDNSNNNN 113



>sp|P18160|KYK1_DICDI Non-receptor tyrosine kinase spore lysis A (EC
           2.7.1.112) (Tyrosine- protein kinase
           1).>pir|T18276|T18276 protein-tyrosine kinase (EC
           2.7.1.112) 1 - slime mold  (Dictyostelium
           discoideum)>gb:DDU32174_1377329 Dictyostelium discoideum
           spore lysis A (splA) gene, complete cds.
          Length = 1584

 Score = 37.7 bits (86), Expect = 0.49
 Identities = 25/112 (22%), Positives = 46/112 (41%), Gaps = 1/112 (0%)
 Frame = -2

Query: 653 PYGKVENISDGFDDENEDNRTLGRNKSSFEWDT-VKTNSLNRRERNVTHSGEQNSKGMPY 477
           P G   N S+  ++ N +N  +G  K +    T    +S+N  E   +++   N+     
Sbjct: 402 PNGNNNNNSNN-NNNNNNNNIIGNGKITTTTTTSTSPSSINNNEDISSNNNNNNNNN--- 457

Query: 476 NNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           NN N+    NN    N    N+N    +++ +N+       N     N++ S
Sbjct: 458 NNNNNNNNNNNNNNNNNNNNNSNSSNTNNNNINNTTNNNNSNSNNNNNNNNS 509



>gb:PFMAL3P2_1394434 Plasmodium falciparum MAL3P2, complete
           sequence.
          Length = 1114

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 26/98 (26%), Positives = 45/98 (45%), Gaps = 3/98 (3%)
 Frame = -2

Query: 635 NISDGFDDENE---DNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           +ISD   ++N    DN    + +S+ E D + +   +    N ++   QNS     NN +
Sbjct: 410 DISDHHKEDNHSETDNNDSEKKESNTEDDNIDSEQNSSINMNNSNDDSQNSSNSESNNND 469

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
           D    N+  K   +K N NL+     K  S N+ +++N
Sbjct: 470 DNDSNNSNEKKKGKKENNNLK---EKKNKSKNKNKKKN 504



>gb:PFA929353_1393139 Plasmodium falciparum strain 3D7, chromosome
           5, segment 3/4.
          Length = 684

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 2/116 (1%)
 Frame = -2

Query: 743 SEKDGPELLKS-EADLPSARFFPKGVVHSIKPYGKVE-NISDGFDDENEDNRTLGRNKSS 570
           S KD  +++K+ E D  +AR   K  ++S +    +E NI++  DD  ED          
Sbjct: 86  SLKDNNKVVKNPEIDTKTARQQYKKRLNSTQSTMNIEGNINNEKDDIIEDYDDGLIRNMD 145

Query: 569 FEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLE 402
           +E   VK    N    N  ++   N+     NN N+    NN    + RK N N E
Sbjct: 146 YEMSIVKNKRNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNNVDNRKRNKNEE 201



>gb:DMC96G10_1378486 Drosophila melanogaster cosmid clone 96G10.
          Length = 168

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 6/109 (5%)
 Frame = -2

Query: 647 GKVENISDGFDDENEDNRTLGRNKSSFEWDT------VKTNSLNRRERNVTHSGEQNSKG 486
           G   ++ DG DD+ +         S  ++DT      VK  +  ++  N       N K 
Sbjct: 68  GSSSDVDDGSDDDTDSG-------SDTDYDTPTTAPVVKKRANRKKANNNKKRASNNRKK 120

Query: 485 MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
              NN N+K   N+     RR  N N ++ +S+  N++N  R  N + +
Sbjct: 121 ANNNNNNNKKRANSNNNRKRRASNNNNKKKASN--NNSNRRRNNNSRRR 167



>gb:DDU07817_1377281 Dictyostelium discoideum AX3
           glutamine-asparagine rich protein gene, partial cds.
          Length = 720

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 23/98 (23%), Positives = 41/98 (41%)
 Frame = -2

Query: 617 DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFR 438
           ++ N DN   G N ++        N++N    N  ++   N+     NN N+    NN+ 
Sbjct: 633 NNNNHDNNYNGNNYNA-------NNNINNYSNNNYNNYSNNNNNNYNNNNNNNNNNNNYG 685

Query: 437 KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
             N    N N    ++   N+ N++   N    YN++K
Sbjct: 686 NNNYSNNNNNNNNYNN---NNYNDYNNNNYNNNYNNNK 720



>gb:AY184993_1308391 Dictyostelium discoideum inositol 5-phosphatase 2
            gene, complete cds.
          Length = 1800

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 19/81 (23%), Positives = 32/81 (39%)
 Frame = -2

Query: 560  DTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV 381
            +++  NS N    N  ++   N+     NN N+    NN    N    N N    +++  
Sbjct: 1324 NSINNNSNNNNNNNTNNNNNTNNNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1383

Query: 380  NSANEFRRQNGKTKYNHSKSA 318
            N+ N     N   K + S+ A
Sbjct: 1384 NNNNNNNNNNNSDKNSDSEEA 1404



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 22/93 (23%), Positives = 38/93 (40%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            ++EN  +  ++ N  N     N ++   +   TN+ N    N  ++   N+     NN N
Sbjct: 1312 ELENSVNNSNNNNSINNNSNNNNNNNTNNNNNTNNNNNTNNNNNNNNNNNNNNNNNNNNN 1371

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANE 366
            +    NN    N    N N    +SDK + + E
Sbjct: 1372 NN-NNNNNNNNNNNNNNNNNNNNNSDKNSDSEE 1403



>gb:AC117081_1207911 Dictyostelium discoideum chromosome 2 map
            5862124-6045772 strain AX4, complete sequence.
          Length = 1657

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 32/129 (24%), Positives = 55/129 (42%), Gaps = 8/129 (6%)
 Frame = -2

Query: 683  FPKGVVHSIKPYGKVENISDG-FDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHS 507
            F + +  S K  G    +SD   DD+NE+N+ L  N           +SL + + N T  
Sbjct: 1222 FDQSISTSSKKRGNTLLLSDSDSDDDNENNKKLKLNSE---------DSLIQNDNNYTSD 1272

Query: 506  GEQNSKGMPYNNKNDKVMKNN-------FRKGNRRKYNTNLERLSSDKVNSANEFRRQNG 348
               N+     NN ND  + NN        +K  ++K  T   ++  +K     + + ++ 
Sbjct: 1273 EIDNNNN---NNNNDDNINNNNNNSNKVNKKNKKKKKKTKKVKIEENKKKIQEKVKEKSP 1329

Query: 347  KTKYNHSKS 321
            K K N +K+
Sbjct: 1330 KKKNNKNKN 1338



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/83 (26%), Positives = 34/83 (40%)
 Frame = -2

Query: 521  NVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKT 342
            N   + ++N+    YNN N+    NN    N    N N    +++  N+ N     N   
Sbjct: 1547 NFQDNQDENNYNNNYNNINNINNNNNNNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNNN 1606

Query: 341  KYNHSKSAVFDMSLQSDGSYEFQ 273
              N++K     +S Q D  Y FQ
Sbjct: 1607 NNNNNKPF---LSFQMDNQYLFQ 1626



>gb:AC117076_1207860 Dictyostelium discoideum chromosome 2 map
           3323568-3470138 strain AX4, complete sequence.
          Length = 754

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 29/128 (22%), Positives = 52/128 (40%)
 Frame = -2

Query: 665 HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
           H   P G +E I    ++ N  N+     KS    D    N+ N    N  ++   N+  
Sbjct: 635 HHGHPIGDIEEIHFNIENNNSGNKYSPMYKS----DNNNNNNTNNNNNNNNNNNNNNNN- 689

Query: 485 MPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDM 306
              NN N+    NN    N    N N   ++++K+++     +++ +   N + S   + 
Sbjct: 690 ---NNNNNNNNFNNNNNNNSDNNNNNQSIINNNKIDNNKSPNQKDIEPILNLNDSYQVNQ 746

Query: 305 SLQSDGSY 282
           S QS  +Y
Sbjct: 747 SQQSYSNY 754



>gb:AC117076_1207859 Dictyostelium discoideum chromosome 2 map
            3323568-3470138 strain AX4, complete sequence.
          Length = 1043

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 25/118 (21%), Positives = 50/118 (42%), Gaps = 2/118 (1%)
 Frame = -2

Query: 644  KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
            K  N ++  ++ N +N+    NK++ E D    N +N    +      +  + +  NN N
Sbjct: 885  KNNNNNNNNNNNNNNNQKNKNNKNNNEEDNFSVNKINDNVND-----NEKKEVVKVNNNN 939

Query: 464  DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV--FDMSLQ 297
            +    NN    N    N N    +++  N+ N     N K   N++ + +  +D +L+
Sbjct: 940  NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKKNNNNNNNLLLSYDSTLE 997



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 31/148 (20%), Positives = 55/148 (37%), Gaps = 21/148 (14%)
 Frame = -2

Query: 704  DLPSARFFPKGVVHSIKP--YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNR 531
            D+ ++ F  +G +  ++   + K    ++   D N   +    N S+ E D +K N+ N 
Sbjct: 832  DIENSIFNTEGHIFPMQSRFFKKFTTTTNDISDINLIKKENNNNNSNKEKDIIKNNNNNN 891

Query: 530  RERNVTHSGEQNSKGMPYN------------NKND-------KVMKNNFRKGNRRKYNTN 408
               N  ++ ++N      N            N ND       KV  NN    N    N N
Sbjct: 892  NNNNNNNNNQKNKNNKNNNEEDNFSVNKINDNVNDNEKKEVVKVNNNNNNNNNNNNNNNN 951

Query: 407  LERLSSDKVNSANEFRRQNGKTKYNHSK 324
                +++  N+ N     N     N++K
Sbjct: 952  NNNNNNNNNNNNNNNNNNNNNNNNNNNK 979



>gb:AC116986_1207535 Dictyostelium discoideum chromosome 2 map
            2234041-2567370 strain AX4, complete sequence.
          Length = 1838

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 19/86 (22%), Positives = 36/86 (41%)
 Frame = -2

Query: 578  KSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLER 399
            KS  ++ +++ N+ N    N +++   NS     NN N+    NN    N    N N   
Sbjct: 1650 KSILKYLSIENNNNNNNNNNNSNNNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1709

Query: 398  LSSDKVNSANEFRRQNGKTKYNHSKS 321
             +++  N+ N     N     N++ +
Sbjct: 1710 NNNNNNNNNNNNNNNNNNNNNNNNNN 1735



 Score = 36.6 bits (83), Expect = 1.1
 Identities = 27/113 (23%), Positives = 45/113 (39%)
 Frame = -2

Query: 689  RFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTH 510
            RF    +  SI  Y  +EN ++   + N +N +   N +S        N+ N    N  +
Sbjct: 1642 RFQLNFIKKSILKYLSIENNNN---NNNNNNNSNNNNNNS--------NNNNNNNNNNNN 1690

Query: 509  SGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
            +   N+     NN N+    NN    N    N N    +++  N+ N+   QN
Sbjct: 1691 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNQN 1743



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 22/96 (22%), Positives = 34/96 (35%)
 Frame = -2

Query: 611  ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
            EN +N     N S+        N+ N    N  ++   N+     NN N+    NN    
Sbjct: 1659 ENNNNNNNNNNNSN--------NNNNNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 1710

Query: 431  NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
            N    N N    +++  N+ N     N     N+ K
Sbjct: 1711 NNNNNNNNNNNNNNNNNNNNNNNNNNNQNNNQNYLK 1746



>gb:AC116979_1207137 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 634

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 28/124 (22%), Positives = 48/124 (38%), Gaps = 7/124 (5%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N+  
Sbjct: 97  NSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNINNNNNNNN 156

Query: 455 MKNNFRKGNRRKYNTNL----ERLSSDKVNSANEFRRQNGKTKYNHS---KSAVFDMSLQ 297
             NN    N    N N+      L+    NS + F  Q      N+S    ++ F   +Q
Sbjct: 157 NNNNIINNNNNNNNNNMNGGYSYLNQSLNNSNSSFFGQTSSDSVNNSIVNSNSNFHHMMQ 216

Query: 296 SDGS 285
           S GS
Sbjct: 217 SSGS 220



 Score = 35.4 bits (80), Expect = 2.4
 Identities = 26/123 (21%), Positives = 46/123 (37%)
 Frame = -2

Query: 632 ISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVM 453
           I D  + +  D      N  +    T  TNS N    N  ++   N+     NN N+   
Sbjct: 68  IKDIIEIKLADKHDYSSNNIAIISSTSSTNSNNNNNNNNNNNNNNNNNN---NNNNNNNN 124

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQ 273
            NN    N    N N    +++ +N+ N     N     N++ +   +M    +G Y + 
Sbjct: 125 NNNNNNNNNNNNNNNNNNNNNNNINNNNNNNNNNNNIINNNNNNNNNNM----NGGYSYL 180

Query: 272 TEN 264
            ++
Sbjct: 181 NQS 183



>gb:AC116977_1207005 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 557

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 19/79 (24%), Positives = 33/79 (41%), Gaps = 3/79 (3%)
 Frame = -2

Query: 554 VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV-- 381
           +K+   N   RN  +    N+     NN N+    NN    N R  + N      + +  
Sbjct: 466 IKSTHRNYNNRNNNYRNNNNNNNNNNNNNNNNNNNNNNNGSNNRNNSNNNNTSPENNIGD 525

Query: 380 -NSANEFRRQNGKTKYNHS 327
            N+ N ++ QN +  YN++
Sbjct: 526 NNATNRYKNQNNRRNYNNN 544



 Score = 37.0 bits (84), Expect = 0.83
 Identities = 26/92 (28%), Positives = 37/92 (40%), Gaps = 1/92 (1%)
 Frame = -2

Query: 602 DNRTLGRNKSSFEWDTVKTNSLNRRERNV-THSGEQNSKGMPYNNKNDKVMKNNFRKGNR 426
           D   + +NK        +TN+ N R RNV T S   N      NN N+    NN  K   
Sbjct: 204 DEYEINKNKKK------QTNNYNNRNRNVKTSSDTNNIDNNNNNNNNNNNNNNNNNKNQS 257

Query: 425 RKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
            K   N    +++ +N+ N     N K   N+
Sbjct: 258 GKRRNNNNNNNNNNINNNNNNSNNNDKRGKNY 289



>gb:AC116305_1206100 Dictyostelium discoideum chromosome 2 map
           1005175-1418323 strain AX4, complete sequence.
          Length = 369

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 38/170 (22%), Positives = 62/170 (36%), Gaps = 24/170 (14%)
 Frame = -2

Query: 701 LPSARFFPKGVVHSIKPYGKVENISDG-FDDENEDNRTLGRNK---------------SS 570
           +P A    +G + S     + E+ +DG FD  +  N  L  N                +S
Sbjct: 143 IPIALSMGRGDLDSESDISEKEDDNDGSFDGNSSGNSFLKHNTIANSYLSGNQFKNNLNS 202

Query: 569 FEWDTVKT-NSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLS 393
           +  + + + NSL+    N  +S   N+   P NN N+    NN    N    N N    +
Sbjct: 203 YAGNGINSMNSLSSHFNNNNNSSNNNNNNNPNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 262

Query: 392 SDKVNSANEFRRQNG-------KTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
           ++  N+ N  +  N            N SK+  F M   S  + +    N
Sbjct: 263 NNNNNNPNNNKNNNNNNGSNIINNSSNISKNNGFIMKSNSSNNIDNNNNN 312



>gb:AC116100_1206093 Dictyostelium discoideum chromosome 2 map
           6163571-6199719 strain AX4, complete sequence.
          Length = 1148

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 27/111 (24%), Positives = 43/111 (38%), Gaps = 1/111 (0%)
 Frame = -2

Query: 650 YGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
           +G    I++  ++ N +N     N ++        N+ N    N  +S   N+     NN
Sbjct: 44  FGNYRKINNNNNNNNSNNHYNNNNNNN-------NNNNNNNNNNNNNSNSNNNNN---NN 93

Query: 470 K-NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           K N+K   NN    N    N N    +++  N+ N     N K  Y  S S
Sbjct: 94  KYNNKYNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNKISYESSLS 144



>gb:AC115594_1205752 Dictyostelium discoideum chromosome 2 map
           4071862-4101005 strain AX4, complete sequence.
          Length = 1246

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 23/97 (23%), Positives = 38/97 (39%)
 Frame = -2

Query: 557 TVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVN 378
           T  T  L   E N  ++ + N+     NN N+    NN    N    N N    +++  N
Sbjct: 629 TSPTKLLLNLEENNNNNNKNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 688

Query: 377 SANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTE 267
           + N F   +     N   S   +  +Q+D +  FQ +
Sbjct: 689 NNNSFDDSSNNNNSNMDNSNYLNGQIQTDENGPFQIQ 725



>gb:PFMAL7P1_1192013 Plasmodium falciparum 3D7 chromosome 7, ***
            SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 2773

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 25/101 (24%), Positives = 47/101 (46%), Gaps = 3/101 (2%)
 Frame = -2

Query: 611  ENEDNRTLGRNKSS---FEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNF 441
            +N+D+  L  N  +   F ++ +  N +N+ + N  HS  +  + + Y+ KN++   NNF
Sbjct: 902  DNDDDNLLSNNSDTPMFFHYENILDNDMNQEKNNENHSLIKKEENLTYSYKNNE-STNNF 960

Query: 440  RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
                          L  DK+N  + +   N K K NH+ ++
Sbjct: 961  --------------LILDKINQMH-YIHSNKKKKCNHNNNS 986



 Score = 33.9 bits (76), Expect = 7.0
 Identities = 27/127 (21%), Positives = 50/127 (39%), Gaps = 10/127 (7%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN----------KN 465
           ++N +N T   N ++   D    N+ N    N  ++   +      NN          KN
Sbjct: 504 NDNNNNDTTNNNNNNDNNDNNNNNNNNNNNNNNNNNNSGDDSSDDNNNEESMKKRRKEKN 563

Query: 464 DKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
            K  K N     +RK N + E+    K+ S+N+        +Y   KS + +   ++  S
Sbjct: 564 KKKKKFNKNISGKRKNNYSYEKFIHKKIYSSNDVYLTE---EYEEDKSKIINEKEKTINS 620

Query: 284 YEFQTEN 264
             + ++N
Sbjct: 621 IAYISDN 627



>gb:AE014188_968086 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014848_1229478 Plasmodium falciparum 3D7
            chromosome 12, section 5 of 9 of the complete sequence.
          Length = 3209

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 27/124 (21%), Positives = 48/124 (38%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N S    + N DN     N +    +    N+ N    N  ++   ++ G   NN N+  
Sbjct: 869  NDSRDSHNRNNDNNDNNNNNNKNNNNNNNNNNNNNNNNNNNNNKNNSNTGGGGNNNNNNN 928

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEF 276
              NN    N    N N    +++  +   + +++N   K     S   D SL  D + E 
Sbjct: 929  NNNNNNNNNNNNNNNNNNNNNNNNNDDDKKKKKKNAIFKGEKRNSLSNDNSLDDDPNTEK 988

Query: 275  QTEN 264
            +T++
Sbjct: 989  KTKS 992



>gb:AE014188_967865 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014844_1229257 Plasmodium falciparum 3D7
            chromosome 12, section 1 of 9 of the complete sequence.
          Length = 1785

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 25/103 (24%), Positives = 39/103 (37%), Gaps = 4/103 (3%)
 Frame = -2

Query: 614  DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
            D N +N     N+++ + D   TN+ N    N  ++G  N+     NN       NN   
Sbjct: 942  DNNNNNNNNADNRNN-DNDNNNTNNNNNNNNNNNNNGGSNNSSGSTNNNGGNNSANNHTN 1000

Query: 434  GNRRKYNTN----LERLSSDKVNSANEFRRQNGKTKYNHSKSA 318
             N    N N        +++  N+ N     N     NHS S+
Sbjct: 1001 NNNNNNNNNNNNSNNNSNNNNSNNNNNNNSNNNSNNNNHSSSS 1043



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 27/122 (22%), Positives = 46/122 (37%), Gaps = 3/122 (2%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N S+  +  N +N     N ++    +   N+ N    N  HS + N      NN     
Sbjct: 1015 NNSNNNNSNNNNNNNSNNNSNNNNHSSSSNNAPNSSHANNNHSNDNNINNNYRNNHVHTC 1074

Query: 455  MKNNF---RKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
            + NN      GN   ++ N+    ++ +N    +  QN     N+S S      LQ +  
Sbjct: 1075 ISNNSYHRNSGNTNNFSNNMHSSYNNIINGI--YNYQNNSRNLNNSSSFGRTNILQDNSH 1132

Query: 284  YE 279
            +E
Sbjct: 1133 HE 1134



 Score = 36.2 bits (82), Expect = 1.4
 Identities = 27/125 (21%), Positives = 48/125 (38%), Gaps = 1/125 (0%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVK-TNSLNRRERNVTHSGEQNSKGMPYNNKNDK 459
            N ++  ++ N +N   G N SS   +     NS N    N  ++   N+     N+ N+ 
Sbjct: 962  NTNNNNNNNNNNNNNGGSNNSSGSTNNNGGNNSANNHTNNNNNNNNNNNNNSNNNSNNNN 1021

Query: 458  VMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYE 279
               NN    N    N N    S++  NS++     +     N++       +  S+ SY 
Sbjct: 1022 SNNNNNNNSNNNSNNNNHSSSSNNAPNSSHANNNHSNDNNINNNYRNNHVHTCISNNSYH 1081

Query: 278  FQTEN 264
              + N
Sbjct: 1082 RNSGN 1086



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 29/138 (21%), Positives = 52/138 (37%), Gaps = 16/138 (11%)
 Frame = -2

Query: 686  FFPKGVVHSIKPYGKVENISDGFD----DENEDN------------RTLGRNKSSFEWDT 555
            +F   + +S+   G+  N S   D    +E  DN            +    N+SS     
Sbjct: 1227 YFYNYLRYSVNNNGRNHNNSGSIDYLNDNEESDNNNNNNNNNNSSTKERNNNRSSVNDSC 1286

Query: 554  VKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNS 375
            +  N  +  + N  ++ + N+    +NN N     NN    N   ++ +    +++  NS
Sbjct: 1287 IVENHQHYHQNNNNNNNDNNNDEHDHNNNNSSGHGNN-NNNNSNSHSNSQNNNNNNNSNS 1345

Query: 374  ANEFRRQNGKTKYNHSKS 321
             +     NG   YN S S
Sbjct: 1346 NSNHNHGNGHNNYNKSHS 1363



>gb:AE014187_938577 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014817_1227653 Plasmodium falciparum 3D7
            chromosome 14 section 2 of 13 of the complete sequence.
          Length = 2016

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 33/162 (20%), Positives = 68/162 (41%), Gaps = 4/162 (2%)
 Frame = -2

Query: 800  EQLKVLADRFQRPGGFDM-WSEKDGPELLKSEADLPSARFFPKGVVHSIKPYGKVENISD 624
            + +K LAD ++    F   +  K  P L  +  D+          +++ K      +  +
Sbjct: 979  DYMKQLADEYESKHAFKKGYRSKLDPNLRVNNIDMIKTEIIDNSDMNNNKNVTLYVDSLE 1038

Query: 623  GFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQN---SKGMPYNNKNDKVM 453
                 + D++T   N    + + +K+   N R+  +   G ++   ++ + Y N+N    
Sbjct: 1039 NIKTISTDDKT---NDDKRDVNEIKSIKNNERKNTLKIDGNKSLGSTQNLNYENEN---- 1091

Query: 452  KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
            KNN    N  K N  +E+ + D  +S    +  NG +K N++
Sbjct: 1092 KNNNNNNNNNKSNQEMEKNNIDDKSSTGNNKNINGNSKGNNN 1133



>gb:AE014187_938561 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014817_1227637 Plasmodium falciparum 3D7
           chromosome 14 section 2 of 13 of the complete sequence.
          Length = 514

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 27/106 (25%), Positives = 45/106 (42%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKND 462
           +EN+ D FD+ N +N +      +F+   +  ++ NR   N+  + + N+     NN N+
Sbjct: 266 MENM-DNFDNNNNNNNSSYMQSHAFK--NMNMDNFNRYSMNMNFNMQNNNNNQRNNNNNN 322

Query: 461 KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSK 324
               NN    N    N N     S+  N+ N     N   K  +SK
Sbjct: 323 NGNNNNDNNNNNNINNNN-----SNGNNNNNSSSNNNSPWKQYYSK 363



>gb:AE014186_938363 Plasmodium falciparum 3D7 chromosome 11 complete
            sequence.>gb:AE014842_1229097 Plasmodium falciparum 3D7
            chromosome 11 section 7 of 8 of the complete sequence.
          Length = 1487

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 32/170 (18%), Positives = 71/170 (41%), Gaps = 18/170 (10%)
 Frame = -2

Query: 668  VHSIKPYGKVENISDGFDDENED-NRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQN- 495
            ++SI     + N++   +  N + N +   +K+ F+  T+  N++N + RN  +    N 
Sbjct: 554  INSINNMNSINNMNSAINVNNSNVNNSYQVDKTVFK--TINLNNINNKNRNQIYKYNNND 611

Query: 494  -------------SKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQ 354
                         S  + YNN N+ +  NN    N    N N+  L ++  N  +     
Sbjct: 612  SNNFIMDNNINSKSNELYYNNNNNNMNNNNNNNNNINNMNKNINLLYNEDGNFKSH-NNN 670

Query: 353  NGKTKYNHSKSAV---FDMSLQSDGSYEFQTEN*ACKLSFRWLKMLLKVN 213
            +G    N++K      F  ++++   ++   E    +++ R+   ++ +N
Sbjct: 671  SGDNNINNNKQLFMKPFHNNIENTNDFKSNNE----EINIRYNSNMIGIN 716



>gb:AE014186_938320 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014841_1229054 Plasmodium falciparum 3D7
           chromosome 11 section 6 of 8 of the complete sequence.
          Length = 1722

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 28/113 (24%), Positives = 51/113 (45%), Gaps = 8/113 (7%)
 Frame = -2

Query: 641 VENISDGF---DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
           +ENI+ G+   +D  +DNRT  +N +  + + +  N++   E N+ +            N
Sbjct: 222 MENINYGYIKYNDIKKDNRTF-KNYTFLKGENINNNTICMNENNMFYKEPYPKYICKDEN 280

Query: 470 K-----NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHS 327
           K     N+K  K+N    N    N N   ++++ VN+ N     N    YN++
Sbjct: 281 KYTHRTNNKKKKSNINNNNVNNNNVNNNNVNNNNVNNNN----HNNNNNYNYN 329



>gb:AE014186_938274 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014840_1229008 Plasmodium falciparum 3D7
           chromosome 11 section 5 of 8 of the complete sequence.
          Length = 940

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 5/99 (5%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K E  ++  +++   N+   +NK+  E +  K  + N+ +     +  +N+K    NNKN
Sbjct: 115 KNEKKNEKKNEKKNKNKNEKKNKNKNENNEKKNENKNKNKNENNENTNENNKNNK-NNKN 173

Query: 464 DKVMKNNFRKGNRRKY----NTNL-ERLSSDKVNSANEF 363
           +K  KNN    N   Y    + N+ E++  D V + NE+
Sbjct: 174 NKNNKNNSNSNNNNNYYYYNHYNMCEKIHKDLVYNYNEY 212



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 27/94 (28%), Positives = 38/94 (40%)
 Frame = -2

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
           EN+D     +N+   E    K N  N+ E+   +  E N K     NKN    +NN    
Sbjct: 106 ENKDENNEKKNEKKNEKKNEKKNK-NKNEKKNKNKNENNEK--KNENKNKNKNENNENTN 162

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNH 330
              K N N +   ++K NS +     N    YNH
Sbjct: 163 ENNKNNKNNKNNKNNKNNSNS--NNNNNYYYYNH 194



>pir|D71612|D71612 hypothetical protein PFB0540w - malaria parasite
            (Plasmodium falciparum)>gb:AE001362_939350 Plasmodium
            falciparum 3D7 chromosome 2 complete
            sequence.>gb:AE001401_1208661 Plasmodium falciparum 3D7
            chromosome 2 section 38 of 73 of the complete sequence.
          Length = 1844

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 27/123 (21%), Positives = 45/123 (36%)
 Frame = -2

Query: 701  LPSARFFPKGVVHSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRER 522
            LP   +     +++ K Y   EN +     +  D   L  N+    ++    N+ N    
Sbjct: 814  LPINMYMNNTYMYNSKAYVNYENQNWMAQQDCNDKNGLSLNEGP-RYNDNNNNNNNNNNN 872

Query: 521  NVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKT 342
            N  ++   N+     NN N  ++ NN  +G  R    N +       N    F  +N  T
Sbjct: 873  NNNNNNNNNNNNNNNNNNNHSIINNNITQGIHRGSMINNQHFDELSYNPNGIFLEKNTIT 932

Query: 341  KYN 333
             YN
Sbjct: 933  NYN 935



 Score = 34.7 bits (78), Expect = 4.1
 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 3/94 (3%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEW--DTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
           + NIS+G +   E+N +L  N +S     +    N +N  + N       N   M  NN 
Sbjct: 224 IPNISNGKNGNLENNASLSHNVNSVSTISELHNFNYMNNMDLNNVDMNNMNMNNMNMNNM 283

Query: 467 N-DKVMKNNFRKGNRRKYNTNLERLSSDKVNSAN 369
           N + +  NN    N    N N+  +  + +N  N
Sbjct: 284 NMNNMNMNNMDMNNVNMNNMNMNNMDVNSMNMNN 317



>gb:AX112153_1461381 Sequence 5 from Patent WO0127287.
          Length = 2184

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 19/69 (27%), Positives = 34/69 (49%)
 Frame = -2

Query: 584  RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
            +NKS+   +  K N  N    N+ ++   N+     NN N+K   +N ++ N R  N N 
Sbjct: 978  KNKSNKNNNNKKKNKNNYNNNNINNNNNNNNNNNINNNNNNKCKLSNSKRYNIRNNNNNK 1037

Query: 404  ERLSSDKVN 378
            +  +++K N
Sbjct: 1038 KAKNNEKNN 1046



>gb:PFA929356_1393309 Plasmodium falciparum strain 3D7, chromosome
           9; segment 2/5.
          Length = 590

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 31/117 (26%), Positives = 50/117 (42%), Gaps = 3/117 (2%)
 Frame = -2

Query: 665 HSIKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG 486
           +S    G + N +   D+ + +     + K   E D +K N+ N            N+K 
Sbjct: 3   NSFNNKGGLVNTTKKIDESDIEPVGEEKEKEKNETDKIKQNNNNNN----------NNKL 52

Query: 485 MPYNNKNDKVMKNNFRKGNRRKYNTNLE--RLSSDKVNSANEFRR-QNGKTKYNHSK 324
              N +ND ++ N +   +  K N N+E   LSS + N  N ++  QN K KY   K
Sbjct: 53  YCENPQNDNIINNLYNLNSNVKINNNVEVVGLSSKEKNYINTYKHFQNDKEKYKKEK 109



>gb:CR382399_1374961 Plasmodium falciparum chromosome 6, complete
            sequence; segment 2/5.
          Length = 1363

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 27/121 (22%), Positives = 50/121 (41%), Gaps = 2/121 (1%)
 Frame = -2

Query: 638  ENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ-NSKGMPYNNKND 462
            ENI++  +D    N     N ++   +    N++N    N+ ++    N+     NN N+
Sbjct: 823  ENINNQTNDAIHSNNNNNNNNNN---NNNNNNNINNNNNNINNNNNNINNNNNNINNNNN 879

Query: 461  KVMKNNFR-KGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGS 285
             +  NN     N    N N   ++++  N+ N     N KT +N  K  +   +  S  +
Sbjct: 880  NINNNNNNINNNNNNINNNNNNINNNNNNNVNI--SLNKKTDFNQGKDQIKIYTETSQDT 937

Query: 284  Y 282
            Y
Sbjct: 938  Y 938



>gb:AF482961_1275467 Dictyostelium discoideum ABC transporter AbcH.2
           (abcH.2) gene, complete cds.
          Length = 513

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 31/157 (19%), Positives = 59/157 (37%), Gaps = 2/157 (1%)
 Frame = -2

Query: 785 LADRFQRPGGFDMWSEKDGPELLKSEADLPSARFFP--KGVVHSIKPYGKVENISDGFDD 612
           L ++ Q+ G   ++   D  + +K +  L   R     K +         + N S+   +
Sbjct: 282 LINQNQKNGVTSVFKNDDDNKNIKKQGTLTEFRRPTDYKSIASYNNNNSNLNNNSNSNSN 341

Query: 611 ENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKG 432
            N +N       SS    +V    L++   N +     N+    +N+ N+  + NN    
Sbjct: 342 NNSNNNNSKNYASSSSSSSVLNGKLSQSTVNNSSIYNHNNDSPFFNSNNNNNINNNINNN 401

Query: 431 NRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N    N N    +++  N+ N     N  +  N+S S
Sbjct: 402 NNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNNSNS 438



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 19/85 (22%), Positives = 35/85 (41%)
 Frame = -2

Query: 545 NSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANE 366
           N++N    N  ++   N+     NN N+    N+    N    N N     S+  N+ N 
Sbjct: 396 NNINNNNNNNNNNNNNNNNNNNNNNNNNNNNNNSNSNNNNSNSNNNNNNTKSNNNNNNNI 455

Query: 365 FRRQNGKTKYNHSKSAVFDMSLQSD 291
           F   +  + Y+++ +   + SL  D
Sbjct: 456 FDIASSSSSYSNNNNNSKNNSLIDD 480



>gb:AF020407_1233341 Dictyostelium discoideum WimA (wimA) gene,
           partial cds.
          Length = 565

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 25/112 (22%), Positives = 49/112 (43%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           ++G ++ NE+N        S + D   +N+ N    N  ++   N+     NN N+    
Sbjct: 265 TEGSNNNNENNIINNNENISRDDDNSNSNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 324

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQS 294
           NN   G + K  ++    S D VN++      +  +  N S +++  +S+ S
Sbjct: 325 NNNNSGEKEKEISSFFS-SDDNVNNSEVLFFNSTNSDTNSSANSIETVSVTS 375



>gb:AC117176_1208020 Dictyostelium discoideum chromosome 2 map
           5018074-5200947 strain AX4, complete sequence.
          Length = 740

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 23/97 (23%), Positives = 38/97 (39%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           NIS+  ++ N +N     N ++   +    N+ N    N  ++   N+     NN N   
Sbjct: 406 NISNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNINNSTNNNN--- 462

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGK 345
             NN    N    NTN     ++  N+ NE    N +
Sbjct: 463 --NNSNTNNNTNTNTNNNNNKNNNNNNNNEIENNNNE 497



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 18/80 (22%), Positives = 34/80 (42%)
 Frame = -2

Query: 560 DTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKV 381
           + +  N+ N    N  ++   N+     NN N+    NN    N    N N+   +++  
Sbjct: 405 NNISNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN--NNNNNNNNNNNNNNNINNSTNNNN 462

Query: 380 NSANEFRRQNGKTKYNHSKS 321
           N++N     N  T  N++K+
Sbjct: 463 NNSNTNNNTNTNTNNNNNKN 482



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 17/85 (20%), Positives = 36/85 (42%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
           N ++  ++ N +N     N ++   +    N+ N    N+ +S   N+     NN  +  
Sbjct: 415 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNINNSTNNNNNNSNTNNNTNTN 474

Query: 455 MKNNFRKGNRRKYNTNLERLSSDKV 381
             NN  K N    N  +E  +++++
Sbjct: 475 TNNNNNKNNNNNNNNEIENNNNEEL 499



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 16/75 (21%), Positives = 30/75 (40%)
 Frame = -2

Query: 551 KTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSA 372
           + N+ N    N++++   N+     NN N+    NN    N    N N    +++  N  
Sbjct: 396 QNNNFNNNNNNISNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNIN 455

Query: 371 NEFRRQNGKTKYNHS 327
           N     N  +  N++
Sbjct: 456 NSTNNNNNNSNTNNN 470



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 20/99 (20%), Positives = 39/99 (39%), Gaps = 1/99 (1%)
 Frame = -2

Query: 608 NEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGN 429
           N +N     N ++   +    N+ N    N  ++   N+     NN N+    NN    N
Sbjct: 402 NNNNNISNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNINNSTNNN 461

Query: 428 RRKYNTNLE-RLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
               NTN     +++  N+ N     N + + N+++  +
Sbjct: 462 NNNSNTNNNTNTNTNNNNNKNNNNNNNNEIENNNNEELI 500



>gb:AC116984_1207362 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 349

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 27/119 (22%), Positives = 50/119 (42%), Gaps = 4/119 (3%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNK--SSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNN 471
           K +   +  +  +  N+   +NK  S    D+   N+ N  E N  ++   N+     NN
Sbjct: 124 KEKEFRNKLNTNSNSNKNKNKNKIPSLDTTDSNNNNNTNNEENNNNNNNNNNNN----NN 179

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV--FDMSL 300
            N+    NN    N    N N    +++  N+ N+   +  K + N SK+    +D+S+
Sbjct: 180 NNNNNNNNNNNNNNNNNNNNNYNNNNNNNNNNNNKEEIKEEKEEINESKNIFVNYDISI 238



>gb:AC116963_1206896 Dictyostelium discoideum chromosome 2 map
           4657875-4914984 strain AX4, complete sequence.
          Length = 748

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 20/91 (21%), Positives = 37/91 (40%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           + N  N + G   S+   + V  N  N    N  ++   N+     NN N+    NN   
Sbjct: 655 NNNSLNNSKGNEISTNSGEIVNNNISNDNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 714

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKT 342
            N    N N E L    +++++++   + K+
Sbjct: 715 NNNNNNNNNNEELQEIDIDTSSQYTINSNKS 745



 Score = 35.0 bits (79), Expect = 3.2
 Identities = 25/102 (24%), Positives = 42/102 (41%), Gaps = 2/102 (1%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERN--VTHSGEQNSKGMPYNN 471
           K +    G  + N D+  +  + S    +T   NSLN  + N   T+SGE  +  +  +N
Sbjct: 624 KSKGFKKGDYENNIDDIDIPTSSSMCRRNTSNNNSLNNSKGNEISTNSGEIVNNNISNDN 683

Query: 470 KNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGK 345
            N+    NN    N    N N    +++  N+ N     N +
Sbjct: 684 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNE 725



>gb:AC116957_1206699 Dictyostelium discoideum chromosome 2 map
           1685067-2090751 strain AX4, complete sequence.
          Length = 436

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 20/100 (20%), Positives = 40/100 (40%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRK 435
           ++N +N  +  N ++   +    N++N    N  ++   N+     NN N+    NN   
Sbjct: 27  NKNNNNNNINNNNNNNINNINNINNVNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN 86

Query: 434 GNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAV 315
            N    N N   ++   +N+ N+ +  N        + AV
Sbjct: 87  INNNNNNINNNNINKKNINNINKNKINNNNNNEIGEEKAV 126



>gb:AC116305_1206202 Dictyostelium discoideum chromosome 2 map
           1005175-1418323 strain AX4, complete sequence.
          Length = 638

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 22/109 (20%), Positives = 43/109 (39%), Gaps = 4/109 (3%)
 Frame = -2

Query: 635 NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKG----MPYNNK 468
           N ++  ++ N +N     N ++        N+ N    N  H+   N+      +P+NN 
Sbjct: 499 NSNNSINNNNNNNNNNNNNNNN------NNNNNNNNNNNNNHNNINNNYNPPIPIPFNNN 552

Query: 467 NDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           N+    NN    N    N N    ++++ N+      QN     N++ +
Sbjct: 553 NNNYNNNNNNHNNNNNNNNNQNNNNNNQNNNNQNNSNQNNNNNNNNNNN 601



 Score = 35.8 bits (81), Expect = 1.8
 Identities = 22/113 (19%), Positives = 41/113 (36%), Gaps = 6/113 (5%)
 Frame = -2

Query: 641 VENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQ------NSKGMP 480
           + N S+   + N +N     N ++   +    N+ N    N+ ++         N+    
Sbjct: 496 INNNSNNSINNNNNNNNNNNNNNNNNNNNNNNNNNNNNHNNINNNYNPPIPIPFNNNNNN 555

Query: 479 YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKS 321
           YNN N+    NN    N+   N N    + +  N  N     N     N++ +
Sbjct: 556 YNNNNNNHNNNNNNNNNQNNNNNNQNNNNQNNSNQNNNNNNNNNNNNNNNNNN 608



>gb:PFMAL8P1_1192297 Plasmodium falciparum 3D7 chromosome 8, ***
            SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 1245

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 22/96 (22%), Positives = 38/96 (39%), Gaps = 5/96 (5%)
 Frame = -2

Query: 536  NRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKY-----NTNLERLSSDKVNSA 372
            NR ++N+ ++ E N+    YN   D   K N  + N  KY     N N   +  D  N  
Sbjct: 730  NRNKKNMDNTYEDNNNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKY 789

Query: 371  NEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQTEN 264
            N     N K   +   +  +++   ++  Y    +N
Sbjct: 790  NVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDN 825



 Score = 34.3 bits (77), Expect = 5.4
 Identities = 30/133 (22%), Positives = 45/133 (33%), Gaps = 6/133 (4%)
 Frame = -2

Query: 644  KVENISD-GFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNK 468
            K+EN +    D+  EDN     N + +  D    N  N  E N             YN  
Sbjct: 727  KLENRNKKNMDNTYEDNN----NNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVD 782

Query: 467  NDKVMKNNFRKGNRRKY-----NTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMS 303
             D   K N  + N  KY     N N   +  D  N  N     N K   +   +  +++ 
Sbjct: 783  EDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVDEDNNNKYNVD 842

Query: 302  LQSDGSYEFQTEN 264
              ++  Y    +N
Sbjct: 843  EDNNNKYNVDEDN 855



>gb:PFMAL7P1_1191959 Plasmodium falciparum 3D7 chromosome 7, ***
            SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 2041

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 25/109 (22%), Positives = 44/109 (40%)
 Frame = -2

Query: 635  NISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKV 456
            N+    +D+  D+     +K S  +     N+ N    N  ++   N+    YNN N   
Sbjct: 718  NLGYKTNDKGHDHYDENLSKMS-PFHKFNDNNNNNNNNNNNNNNNYNNNNNNYNNNN--- 773

Query: 455  MKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFD 309
              NN+   N   YN N    ++ K    N+    NG+  +  + + +FD
Sbjct: 774  --NNYNNNNNYNYNNNYINENNLKHFEQNKIGANNGRNSFLKNSNFLFD 820



>gb:PFMAL13_1191644 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 2049

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 8/97 (8%)
 Frame = -2

Query: 617  DDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHS-GEQ-------NSKGMPYNNKND 462
            D  N D  T     ++ E + +  N++     NV H+ GE        NSK    NNK  
Sbjct: 1035 DANNNDGATTTTTDNASEKNVINHNNIYDTNLNVEHNKGEDSSNTKNNNSKNFNNNNKKK 1094

Query: 461  KVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQN 351
               KN  +  ++ K N N E   + K +++N    +N
Sbjct: 1095 NKNKNKNKNKDKHKKNNNQENSVNSKSSNSNNTINEN 1131



>gb:PFMAL13_1191553 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 305

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 28/105 (26%), Positives = 43/105 (40%), Gaps = 9/105 (8%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRT---LGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYN 474
           K  N ++  +  N DN     +G NK   E    K N+ N    N  H+   N+     N
Sbjct: 111 KKNNNNNNINSTNNDNNLSLGIGNNKKIQENHKKKNNNHNNNHNNNNHNNNHNNNNHNNN 170

Query: 473 ----NKNDKVMKNNFRKGNRRKYNTNLERLSSDKV--NSANEFRR 357
               NKN    KN+  K +    N   E+L   K+  ++ +E R+
Sbjct: 171 HNNNNKNTLFTKNSTMKNDLNDKNLYKEKLKEKKIFMDTVHEIRK 215



>gb:PFMAL13_1191214 Plasmodium falciparum 3D7 chromosome 13, ***
            SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 2518

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 19/69 (27%), Positives = 34/69 (49%)
 Frame = -2

Query: 584  RNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMKNNFRKGNRRKYNTNL 405
            +NKS+   +  K N  N    N+ ++   N+     NN N+K   +N ++ N R  N N 
Sbjct: 1311 KNKSNKNNNNKKKNKNNYNNNNINNNNNNNNNNNINNNNNNKCKLSNSKRYNIRNNNNNK 1370

Query: 404  ERLSSDKVN 378
            +  +++K N
Sbjct: 1371 KAKNNEKNN 1379



>gb:PFMAL13_1191200 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1192

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 31/139 (22%), Positives = 55/139 (39%), Gaps = 17/139 (12%)
 Frame = -2

Query: 629 SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           ++  ++ N +N     + S   +     NS N+   N  +S   N KG+  NNKN   M 
Sbjct: 72  NNDMNNNNNNNNMNNSDNSKLSFSRNFKNSFNKG-MNRNNSVTGNIKGI--NNKNYNYMN 128

Query: 449 NNFRKGNRRK-------------YNTNLERLSS----DKVNSANEFRRQNGKTKYNHSKS 321
           NN   G                 +N N   L++      +N  N+F + N +   N++ +
Sbjct: 129 NNQENGTNNNDMNVNDQNNYSGIFNNNFTNLNNKAFYKNMNKNNKFNKTNNRNNNNNNNN 188

Query: 320 AVFDMSLQSDGSYEFQTEN 264
              + +   DG+  +Q  N
Sbjct: 189 NNKNNNNNDDGNINYQNTN 207



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 27/122 (22%), Positives = 51/122 (41%), Gaps = 3/122 (2%)
 Frame = -2

Query: 620 FDDENEDN-RTLGRNKSSFEWD--TVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
           F+  N DN +    N +++ +D  TV  N+        + +   N+  +  NN  +  + 
Sbjct: 534 FEQTNNDNMKRENNNMNNYGYDDNTVHVNNNTPSTDFFSRAVGYNNNYLNNNNNMNSAVN 593

Query: 449 NNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSLQSDGSYEFQT 270
           NN   GN  K   +  +  +D  +S N    +N     N ++S   + +L ++  Y  Q 
Sbjct: 594 NNSSNGNNMKNENSENKNVADNNDSLN--NNKNNNNNINMNESINNNNTLNNNNEYNNQN 651

Query: 269 EN 264
            N
Sbjct: 652 NN 653



>gb:AE014298_1124154 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003426_1209336 Drosophila melanogaster
           chromosome X, section 10 of 74 of the complete sequence.
          Length = 172

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 27/108 (25%), Positives = 47/108 (43%), Gaps = 5/108 (4%)
 Frame = -2

Query: 647 GKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSL-----NRRERNVTHSGEQNSKGM 483
           G   ++ DG DD+ +         S  ++DT  T  +     NR++ N       N++  
Sbjct: 74  GSSSDVDDGSDDDTDSG-------SDTDYDTPTTAPVVKKRANRKKANNNKKRASNNRKK 126

Query: 482 PYNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTK 339
             NN N+K   N+     RR  N N ++ +S+     N  RR+N  ++
Sbjct: 127 ANNNNNNKKRANSNNNRKRRASNNNNKKKASN-----NNNRRRNNNSR 169



>gb:AE014188_968208 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014851_1229600 Plasmodium
           falciparum 3D7 chromosome 12, section 8 of 9 of the
           complete sequence.
          Length = 676

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 2/120 (1%)
 Frame = -2

Query: 644 KVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKN 465
           K E++    D  N+DN       +       KT +    E + ++  E+N K +   NK 
Sbjct: 320 KGEDVKYKDDFYNKDNVNYEEKNNHLSECVNKTQNEYPVEEHTSNEVEKNKKDIDSTNKT 379

Query: 464 DKVMKNNFRKGNRRKYNTN-LERLSSDKVNS-ANEFRRQNGKTKYNHSKSAVFDMSLQSD 291
                 N+   N   Y+T+    +SS K N  ++E+   N  + YN   S V  MS   D
Sbjct: 380 KYPSNRNYYSDNYINYDTDENSNISSSKENDISDEYSSYNNDSLYNSDNSEVEKMSSSMD 439



>gb:AE014188_968201 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014850_1229593 Plasmodium
           falciparum 3D7 chromosome 12, section 7 of 9 of the
           complete sequence.
          Length = 2309

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 6/100 (6%)
 Frame = -2

Query: 614 DENEDNRTLGRNKSSFEWDTVKTNSLNRRERN------VTHSGEQNSKGMPYNNKNDKVM 453
           + N +N+TLG+++ S      + N  N  + N      +T +   N+    YNN N+KV 
Sbjct: 373 NNNNNNKTLGKSEISGNEIICQENITNNHKINKMNNTIITTTTTINNNSNNYNNNNNKVN 432

Query: 452 KNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYN 333
           +N F      K + N E   + ++N+      QN   K++
Sbjct: 433 RNLFSNNYFVKNSPNHEDFLNKELNNFFISHNQNKNNKHS 472



 Score = 33.5 bits (75), Expect = 9.2
 Identities = 25/91 (27%), Positives = 38/91 (41%)
 Frame = -2

Query: 629  SDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMPYNNKNDKVMK 450
            SD  +D N  N T   N S+   DT   NS N  + N +++   ++     NN N+    
Sbjct: 2161 SDYSNDTNNSNDTNNSNNSN---DT--NNSNNSNDSNNSNNSNNSNNSNNSNNSNNSNNS 2215

Query: 449  NNFRKGNRRKYNTNLERLSSDKVNSANEFRR 357
            NN    N    N +L +   +   SA  F +
Sbjct: 2216 NNSNNSNSNSPNDDLSKNQLNDDISAKNFNK 2246



>gb:AE014188_968148 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014849_1229540 Plasmodium
           falciparum 3D7 chromosome 12, section 6 of 9 of the
           complete sequence.
          Length = 1662

 Score = 37.0 bits (84), Expect = 0.83
 Identities = 27/131 (20%), Positives = 53/131 (40%)
 Frame = -2

Query: 659 IKPYGKVENISDGFDDENEDNRTLGRNKSSFEWDTVKTNSLNRRERNVTHSGEQNSKGMP 480
           IK     +N SD  ++ N +N  + R  +++  + +   ++N        +   N+    
Sbjct: 187 IKKQKSNKNKSDNNNNNNNNNNNINRGDNNY-MNNINLTNMNEMNNINDMNNINNNNNDD 245

Query: 479 YNNKNDKVMKNNFRKGNRRKYNTNLERLSSDKVNSANEFRRQNGKTKYNHSKSAVFDMSL 300
            NN ND    NN    N    N N    +++  N+ N     N    Y +  S  ++ + 
Sbjct: 246 NNNNND----NNNNDNNNDNDNNNDNNNNNNNNNNNNNNNNNNNNNNYYYYISNNYNNNY 301

Query: 299 QSDGSYEFQTE 267
            S GS  ++++
Sbjct: 302 SSSGSLLYRSD 312


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,310,298,319
Number of Sequences: 1806583
Number of extensions: 29537864
Number of successful extensions: 126602
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 86764
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 105773
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 100104869256
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)