BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13406
         (908 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY091003_1574235 Arabidopsis thaliana unknown protein (At3g05...   264   2e-69   
gb:AY084926_1570008 Arabidopsis thaliana clone 121720 mRNA, comp...   264   2e-69   
gb:AP004570_1841746 Oryza sativa (japonica cultivar-group) genom...   213   3e-54   
gb:AP000391_1819968 Oryza sativa (japonica cultivar-group) genom...   194   2e-48   
pir|T01895|T01895 hypothetical protein F8M12.23 - Arabidopsis th...   180   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AP003755_1832956 Oryza sativa (japonica cultivar-group) genom...    50   6e-05   
pir|F96663|F96663 hypothetical protein T12P18.13 [imported] - Ar...    48   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00058_1694072 Oryza sativa genomic DNA, chromosome 4, BAC...    46   0.001   
gb:AY085733_1570800 Arabidopsis thaliana clone 17483 mRNA, compl...    46   0.001   
gb:AK117606_1815631 Arabidopsis thaliana At2g13710 mRNA for puta...    45   0.003   
gb:AC006436_1534238 Arabidopsis thaliana chromosome 2 clone F13J...    45   0.003   
pir|H84509|H84509 hypothetical protein At2g13690 [imported] - Ar...    45   0.003   Arabidopsis thaliana [mouse-ear cress]
gb:AF315734_1785430 Arabidopsis thaliana PRLI-interacting factor...    44   0.006   
gb:AC137997_1743907 Oryza sativa chromosome 3 BAC OJ1499_D04 gen...    41   0.028   
gb:OSJN00223_1190897 Oryza sativa (japonica cultivar-group) chro...    41   0.028   
pir|T08399|T08399 hypothetical protein F18B3.60 - Arabidopsis th...    40   0.048   Arabidopsis thaliana [mouse-ear cress]
gb:BT005361_1638301 Arabidopsis thaliana At3g19920 mRNA, complet...    40   0.081   
gb:AB025631_1516568 Arabidopsis thaliana genomic DNA, chromosome...    40   0.081   
gb:CR382123_1656105 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.14    
gb:BA000038_724762 Vibrio vulnificus YJ016 DNA, chromosome II, c...    38   0.24    
gb:AE016808_337928 Vibrio vulnificus CMCP6 chromosome II section...    38   0.24    
gb:AC107207_1738362 Oryza sativa chromosome 3 BAC OSJNBb0106M04 ...    37   0.69    
gb:AY094902_1298076 Drosophila melanogaster RH08189 full insert ...    35   2.6     
gb:AE014297_1138689 Drosophila melanogaster chromosome 3R, compl...    34   3.4     
sp|Q8NKQ0|MR11_SULAC|MR11_SULAC DNA double-strand break repair protein mre1...    34   3.4     Sulfolobus acidocaldarius
gb:AE005674_71181 Shigella flexneri 2a str. 301, complete genome...    33   7.6     
gb:AE016776_330132 Pseudomonas putida KT2440 section 3 of 21 of ...    33   10.0    
gb:AE005674_72441 Shigella flexneri 2a str. 301, complete genome...    33   10.0    


>gb:AY091003_1574235 Arabidopsis thaliana unknown protein
           (At3g05675) mRNA, complete cds.
          Length = 441

 Score =  264 bits (674), Expect = 2e-69
 Identities = 140/239 (58%), Positives = 175/239 (73%), Gaps = 5/239 (2%)
 Frame = -3

Query: 906 EYMVVEDDDAPLLTADNEIKLEVVQCIKRLLDRFSQLVESLLCDVQES--ISEDGKLQLF 733
           EYM+ EDDDAPLL AD E+KLEV QC+K L  RF Q +E +     ES  I++ G    F
Sbjct: 201 EYMITEDDDAPLLIADEEVKLEVKQCVKSLFVRFFQCLEEITLKPVESEVINKKGS---F 257

Query: 732 KSCLSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEA-ETIGTKLKVLEVAA 556
           +  LSD+ W  QILTK+E++RDFV  W +IS K++KVV+QL     E +  ++KV+EV A
Sbjct: 258 RMVLSDMCWVFQILTKMEVVRDFVITWADISEKLVKVVEQLETTVVEAVEIRVKVIEVTA 317

Query: 555 KVLEAIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDS-VTADSDDDLIP-KIDGDLWQS 382
           KV+EAIGYGTVILP  KRL M K+WLPFVR  KPL DS V  D ++D +  KIDG++WQ+
Sbjct: 318 KVIEAIGYGTVILPTAKRLQMVKLWLPFVRNTKPLVDSPVREDEENDTVRYKIDGEIWQA 377

Query: 381 LEASFVSMILTLPSADQAEILTEWWTNQHVQYPDLTEAFEAWCYRSKAAKRRLAMLEGD 205
           LE+SFVS+IL LPSADQAEILTEW +   + YPDLTEAFE WCYRSK AKRRL ++ G+
Sbjct: 378 LESSFVSIILALPSADQAEILTEWLSKNGL-YPDLTEAFEVWCYRSKVAKRRLGLVGGE 435



>gb:AY084926_1570008 Arabidopsis thaliana clone 121720 mRNA,
           complete sequence.
          Length = 441

 Score =  264 bits (674), Expect = 2e-69
 Identities = 140/239 (58%), Positives = 175/239 (73%), Gaps = 5/239 (2%)
 Frame = -3

Query: 906 EYMVVEDDDAPLLTADNEIKLEVVQCIKRLLDRFSQLVESLLCDVQES--ISEDGKLQLF 733
           EYM+ EDDDAPLL AD E+KLEV QC+K L  RF Q +E +     ES  I++ G    F
Sbjct: 201 EYMITEDDDAPLLIADEEVKLEVKQCVKSLFVRFFQCLEEITLKPVESEVINKKGS---F 257

Query: 732 KSCLSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEA-ETIGTKLKVLEVAA 556
           +  LSD+ W  QILTK+E++RDFV  W +IS K++KVV+QL     E +  ++KV+EV A
Sbjct: 258 RMVLSDMCWVFQILTKMEVVRDFVITWADISEKLVKVVEQLETTVVEAVEIRVKVIEVTA 317

Query: 555 KVLEAIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDS-VTADSDDDLIP-KIDGDLWQS 382
           KV+EAIGYGTVILP  KRL M K+WLPFVR  KPL DS V  D ++D +  KIDG++WQ+
Sbjct: 318 KVIEAIGYGTVILPTAKRLQMVKLWLPFVRNTKPLVDSPVREDEENDTVRYKIDGEIWQA 377

Query: 381 LEASFVSMILTLPSADQAEILTEWWTNQHVQYPDLTEAFEAWCYRSKAAKRRLAMLEGD 205
           LE+SFVS+IL LPSADQAEILTEW +   + YPDLTEAFE WCYRSK AKRRL ++ G+
Sbjct: 378 LESSFVSIILALPSADQAEILTEWLSKNGL-YPDLTEAFEVWCYRSKVAKRRLGLVGGE 435



>gb:AP004570_1841746 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0625E02.
          Length = 439

 Score =  213 bits (543), Expect = 3e-54
 Identities = 113/239 (47%), Positives = 155/239 (64%), Gaps = 8/239 (3%)
 Frame = -3

Query: 906 EYMVVEDDDAPLLTADNEI-KLEVVQCIKRLLDRFSQLVESLLCDVQESISEDGKLQL-- 736
           EYM+ EDDDAPLL  D++I + +V  C+  LL RFS    S+L +  E+    G  ++  
Sbjct: 194 EYMLTEDDDAPLLAFDDDIVRSQVKDCVAALLSRFSGFTSSILMEQGEAPLGHGDAEVQQ 253

Query: 735 -FKSCLSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVA 559
              S +SD+SW CQIL+KLE+M+  V  W  +S  +++ V +       + T+LKV+EV+
Sbjct: 254 ELHSLVSDISWVCQILSKLEMMKCVVVYWIGVSSDVVEAVDKACGGISCLKTRLKVIEVS 313

Query: 558 AKVLEAIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDD--LIPKI--DGDL 391
           AKVLEAI +G ++LP  KR     VW+ F R  KPL      D DD     PKI  D ++
Sbjct: 314 AKVLEAIAFGNIVLPTEKRCDAVNVWIGFARRTKPLVGHPEHDDDDGDAEAPKINLDSEV 373

Query: 390 WQSLEASFVSMILTLPSADQAEILTEWWTNQHVQYPDLTEAFEAWCYRSKAAKRRLAML 214
           WQSLE++ VS++LTLPS  QA+IL++W  ++H +YPDLTEAFE WCYRSKAAKRRL+ L
Sbjct: 374 WQSLESAIVSIVLTLPSNSQADILSDWLQSKHAKYPDLTEAFEVWCYRSKAAKRRLSFL 432



>gb:AP000391_1819968 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0538C01.
          Length = 433

 Score =  194 bits (494), Expect = 2e-48
 Identities = 103/245 (42%), Positives = 155/245 (63%), Gaps = 1/245 (0%)
 Frame = -3

Query: 906 EYMVVEDDDAPLLTADNEIKLEVVQCIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKS 727
           ++M+ EDDD  L+T D +++  V + +K+L     ++   LL    E + E  + ++  S
Sbjct: 196 DFMLHEDDDTALVTMDEDVRSVVREGLKKLFSTL-KIGLDLLTSEYEQLPEQAEQRVLCS 254

Query: 726 CLSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVL 547
            L+D+ W   +LTK+E+M +FV  W+EIS  ++ VVQ     +     K K++EV  K  
Sbjct: 255 -LADIDWMANVLTKIEMMNEFVSGWSEISGYVLSVVQDKKYSSGLWLVKAKLIEVTGKAF 313

Query: 546 EAIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASF 367
           +A+GYG+V+ PA+ R+H  ++WLPF++  K L D     S DD IP++D DL+Q++E + 
Sbjct: 314 DAVGYGSVVFPASSRVHFLRMWLPFMQTTKRLLDE---KSKDDAIPQMDADLFQNIEGAI 370

Query: 366 VSMILTLPSADQAEILTEWWTN-QHVQYPDLTEAFEAWCYRSKAAKRRLAMLEGDHSTAN 190
           VS++L LPS DQA+IL EW  N +  +YPDLTEAFE WCYRSK AKRRL  + G + + N
Sbjct: 371 VSLVLALPSGDQADILGEWMKNAEQFRYPDLTEAFEVWCYRSKTAKRRL--VGGLNGSGN 428

Query: 189 PV*SL 175
           P  SL
Sbjct: 429 PTVSL 433



>pir|T01895|T01895 hypothetical protein F8M12.23 - Arabidopsis
           thaliana>gb:ATCHRIV30_1544845 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           30.>gb:ATF25I24_1550017 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F25I24 (ESSA
           project).>gb:AY065352_1566464 Arabidopsis thaliana
           unknown protein (At4g10800) mRNA, complete
           cds.>gb:AY117178_1579219 Arabidopsis thaliana unknown
           protein (At4g10800) mRNA, complete cds.>gb:F8M12_1678660
           Arabidopsis thaliana BAC F8M12.
          Length = 283

 Score =  180 bits (457), Expect = 3e-44
 Identities = 95/235 (40%), Positives = 149/235 (63%), Gaps = 7/235 (2%)
 Frame = -3

Query: 906 EYMVVEDDDAPLLTADNEIK----LEVVQCIKRLLDRFSQLVESLLCDVQESISEDGKLQ 739
           E+M+ ED++  LL ++ E+K    L +   I  LLDR S L+  L         E  +  
Sbjct: 48  EFMLSEDEEVRLLISEEEVKSVVRLGISNVISMLLDRLSSLLVIL--------PECTEFS 99

Query: 738 LFKSCLSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVA 559
           + K+ L D+ W C++L ++E+M+D V +WT+ S +I+ + Q+   ++  +G K+K++EV 
Sbjct: 100 VLKT-LYDIEWLCKVLPRMELMKDLVVKWTDASSEILVIAQKCELDSRILGVKVKLVEVT 158

Query: 558 AKVLEAIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDLWQSL 379
            K+LEA+GYG VI+P+  R  + K+WLPF+R +K L D+   + +     ++D DL + +
Sbjct: 159 GKILEAVGYGIVIVPSKSRTCLLKIWLPFIRRLKTLVDAEGCEYE----YRMDEDLCEFI 214

Query: 378 EASFVSMILTLPSADQAEILTEWWTN---QHVQYPDLTEAFEAWCYRSKAAKRRL 223
           E S VS++LTLPS DQAE+  EW      + V++PDL+EAFE WCYRSK+AKRRL
Sbjct: 215 EGSMVSLVLTLPSNDQAEVFGEWMRGIGLEGVKFPDLSEAFEVWCYRSKSAKRRL 269



>gb:AP003755_1832956 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1354_H07.>gb:AP003756_1832967 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1370_E02.
          Length = 564

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 45/201 (22%), Positives = 85/201 (42%), Gaps = 5/201 (2%)
 Frame = -3

Query: 831 CIKRLLDRFSQLVESLLCDVQESISEDGK--LQLFKSCLSDLSWACQILTKLEIMRDFVH 658
           C+  L+D + +  E+     Q  + +  K  ++       +L+W   IL  +++  +FV 
Sbjct: 372 CLNSLVDLYDEATEATNHTAQALVIKGSKPFIERISQQTENLNWLLDILVNIDMAEEFVE 431

Query: 657 RWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAIGYGTVILPATKRLHMAKVWL 478
            W +   ++I++ +Q SP       + ++  ++A V  A+G G V      R  +   W 
Sbjct: 432 LWAK-QDRLIRIHEQASPM-----MRYELSRISASVFIALGKGKVQCRGELRSLLFYGW- 484

Query: 477 PFVRAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASFVSMILTLPSADQAEILTEW---W 307
            F   +             D+         +SLE +    +LTLP   Q  +  EW   +
Sbjct: 485 -FSPMLLDFGWLQRCSKGLDV---------RSLEENLGQALLTLPLKQQQCLFEEWFQCF 534

Query: 306 TNQHVQYPDLTEAFEAWCYRS 244
            ++  + P+LT AF+ W  RS
Sbjct: 535 ASKGSECPNLTRAFQVWWRRS 555



>pir|F96663|F96663 hypothetical protein T12P18.13 [imported] -
           Arabidopsis thaliana>gb:AE005173_894047 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010852_1537134 Arabidopsis thaliana
           chromosome 1 BAC T12P18 genomic sequence, complete
           sequence.
          Length = 548

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 50/207 (24%), Positives = 79/207 (38%), Gaps = 11/207 (5%)
 Frame = -3

Query: 831 CIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSCLSDLSWACQILTKLEIMRDFVHRW 652
           C+ +L  +F Q  ES L +V +   +            +L W   IL   +I  DF+  W
Sbjct: 353 CLHKLKRQFLQAAESDLENVDQIARQ----------ADNLHWILDILIDRQIAEDFIVMW 402

Query: 651 TEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAIGYGTVILPATKRLHMAKVWL-P 475
             +S   +  V    P    +  + ++  V A++   IG G ++ P   R  + + WL P
Sbjct: 403 ASLSE--LSEVHSKVP----VVHRFEISRVTARIFVGIGKGQILTPKEVRCLLLRNWLTP 456

Query: 474 FV-------RAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASFVSMILTLPSADQAEILT 316
           F        RA K L   +                   +E    + ILTLP A Q E   
Sbjct: 457 FYDDFGWMRRASKGLDRYL-------------------IEDGLSNTILTLPLAWQQEFFL 497

Query: 315 EW---WTNQHVQYPDLTEAFEAWCYRS 244
            W   + N +   P++   FE W  R+
Sbjct: 498 AWFDRFLNSNEDCPNIQRGFEVWWRRA 524



>gb:OSJN00058_1694072 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0011J08, complete
           sequence.>gb:OSJN00086_1694635 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0064M23, complete
           sequence.
          Length = 533

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 40/162 (24%), Positives = 68/162 (41%), Gaps = 4/162 (2%)
 Frame = -3

Query: 717 DLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAI 538
           +L W   IL + +I  DF+  W  + +++     +L  +   I  + +V  V A++   +
Sbjct: 367 NLHWMLDILVERQIAEDFLRTWA-MQIELA----ELHGKVPAIH-RYEVSRVTARLFVGV 420

Query: 537 GYGTVILPATKRLHMAKVWL-PFVRAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASFVS 361
           G G +++    R  +   WL PF      +  +            +D  L   +E    +
Sbjct: 421 GKGQILVSKEVRCQLLSTWLEPFYEDFGWMRRACKG---------LDRHL---IEDGLAN 468

Query: 360 MILTLPSADQAEILTEWWT---NQHVQYPDLTEAFEAWCYRS 244
            ILTLP A Q EIL  W+    N     P++   FE W  R+
Sbjct: 469 TILTLPLATQQEILLAWFNRFLNSGEDCPNIQRGFEVWWRRA 510



>gb:AY085733_1570800 Arabidopsis thaliana clone 17483 mRNA, complete
           sequence.
          Length = 543

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 47/209 (22%), Positives = 94/209 (44%), Gaps = 7/209 (3%)
 Frame = -3

Query: 849 KLEVVQCIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSC---LSDLSWACQILTKLE 679
           K ++ +  K  +D  ++L E    +   S S + +  L +S    + +++W  +I+   E
Sbjct: 346 KEDIYRAGKCCVDSLAKLFE----EGSSSSSSNKEKPLIESISREVENINWLLEIMIDRE 401

Query: 678 IMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAIGYGTVILPATKRL 499
           I  +FV  W +   +++++ +++SP       + +V  V   +  A+G   V      R 
Sbjct: 402 IAEEFVEIWGK-QRRLVEMHERVSPMV-----RYEVSRVTGAIFIAMGKRRVQCGGEARA 455

Query: 498 HMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDL-WQSLEASFVSMILTLPSADQAEI 322
            + +VW       KP+        D   + +    L  + +E      +LTLP   Q ++
Sbjct: 456 GLVEVWF------KPML------VDFGWLQRCKKGLDMREVEEGMGQTLLTLPVKQQYQV 503

Query: 321 LTEW--WTNQH-VQYPDLTEAFEAWCYRS 244
             EW  W ++H  + P+L++AF+ W  RS
Sbjct: 504 FMEWFRWFSKHGTECPNLSKAFQIWWRRS 532



>gb:AK117606_1815631 Arabidopsis thaliana At2g13710 mRNA for
           putative f13j11 PRLI-interacting factor G, complete cds,
           clone: RAFL17-26-C14.
          Length = 544

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 37/164 (22%), Positives = 75/164 (45%), Gaps = 4/164 (2%)
 Frame = -3

Query: 723 LSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLE 544
           + +++W  +I+   EI  +FV  W +   +++++ +++SP       + +V  V   +  
Sbjct: 388 VENINWLLEIMIDREIAEEFVEIWGK-QRRLVEMHERVSPMV-----RYEVSRVTGAIFI 441

Query: 543 AIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDL-WQSLEASF 367
           A+G   V      R  + + W       KP+        D   + +    L  + +E   
Sbjct: 442 AMGKRRVQCGGEARAGLVEAWF------KPML------VDFGWLQRCKKGLDMREVEEGM 489

Query: 366 VSMILTLPSADQAEILTEW--WTNQH-VQYPDLTEAFEAWCYRS 244
              +LTLP  +Q ++  EW  W ++H  + P+L++AF+ W  RS
Sbjct: 490 GQTLLTLPVKEQYQVFMEWFRWFSKHGTECPNLSKAFQIWWRRS 533



>gb:AC006436_1534238 Arabidopsis thaliana chromosome 2 clone F13J11
           map mi398, complete sequence.>gb:AC007063_1535118
           Arabidopsis thaliana chromosome 2 clone T10F5 map PR1,
           complete sequence.
          Length = 544

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 37/164 (22%), Positives = 75/164 (45%), Gaps = 4/164 (2%)
 Frame = -3

Query: 723 LSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLE 544
           + +++W  +I+   EI  +FV  W +   +++++ +++SP       + +V  V   +  
Sbjct: 388 VENINWLLEIMIDREIAEEFVEIWGK-QRRLVEMHERVSPMV-----RYEVSRVTGAIFI 441

Query: 543 AIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDL-WQSLEASF 367
           A+G   V      R  + + W       KP+        D   + +    L  + +E   
Sbjct: 442 AMGKRRVQCGGEARAGLVEAWF------KPML------VDFGWLQRCKKGLDMREVEEGM 489

Query: 366 VSMILTLPSADQAEILTEW--WTNQH-VQYPDLTEAFEAWCYRS 244
              +LTLP  +Q ++  EW  W ++H  + P+L++AF+ W  RS
Sbjct: 490 GQTLLTLPVKEQYQVFMEWFRWFSKHGTECPNLSKAFQIWWRRS 533



>pir|H84509|H84509 hypothetical protein At2g13690 [imported] -
           Arabidopsis thaliana
          Length = 542

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 37/164 (22%), Positives = 75/164 (45%), Gaps = 4/164 (2%)
 Frame = -3

Query: 723 LSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLE 544
           + +++W  +I+   EI  +FV  W +   +++++ +++SP       + +V  V   +  
Sbjct: 386 VENINWLLEIMIDREIAEEFVEIWGK-QRRLVEMHERVSPMV-----RYEVSRVTGAIFI 439

Query: 543 AIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDL-WQSLEASF 367
           A+G   V      R  + + W       KP+        D   + +    L  + +E   
Sbjct: 440 AMGKRRVQCGGEARAGLVEAWF------KPML------VDFGWLQRCKKGLDMREVEEGM 487

Query: 366 VSMILTLPSADQAEILTEW--WTNQH-VQYPDLTEAFEAWCYRS 244
              +LTLP  +Q ++  EW  W ++H  + P+L++AF+ W  RS
Sbjct: 488 GQTLLTLPVKEQYQVFMEWFRWFSKHGTECPNLSKAFQIWWRRS 531



>gb:AF315734_1785430 Arabidopsis thaliana PRLI-interacting factor G
           mRNA, partial cds.
          Length = 223

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 37/164 (22%), Positives = 74/164 (45%), Gaps = 4/164 (2%)
 Frame = -3

Query: 723 LSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLE 544
           + +++W  +I+   EI  +FV  W +   +++++ +++SP       + +V  V   +  
Sbjct: 67  VENINWLLEIMIDREIAEEFVEIWGK-QRRLVEMHERVSPMV-----RYEVSRVTGAIFI 120

Query: 543 AIGYGTVILPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDL-WQSLEASF 367
           A+G   V      R  + + W       KP+        D   + +    L  + +E   
Sbjct: 121 AMGKRRVQCGGEARAGLVEAWF------KPML------VDFGWLQRCKKGLDMREVEEGM 168

Query: 366 VSMILTLPSADQAEILTEW--WTNQH-VQYPDLTEAFEAWCYRS 244
              +LTLP  +Q ++  EW  W  +H  + P+L++AF+ W  RS
Sbjct: 169 GQTLLTLPVKEQYQVFMEWFRWFPKHGTECPNLSKAFQIWWRRS 212



>gb:AC137997_1743907 Oryza sativa chromosome 3 BAC OJ1499_D04
           genomic sequence, complete sequence.>gb:AC146936_1744635
           Oryza sativa chromosome 3 B1154F06 genomic sequence,
           complete sequence.
          Length = 478

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 45/218 (20%), Positives = 89/218 (40%), Gaps = 10/218 (4%)
 Frame = -3

Query: 858 NEIKLEVVQCIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSCLS--DLSWACQILTK 685
           +E  L  ++ +K L+ +++     +  D  E  +   +L L  + L+   L W  + + +
Sbjct: 265 DEAFLSRLETVKELMGKYASPDFRVAVDSDERDAIQ-RLNLQSAVLNVRHLLWLIERMVE 323

Query: 684 LEIMRDFVHRWTEISVKIIKVVQQLSPEAE-----TIGTKLKVLEVAAKVLEAIGYGTVI 520
           + +  + V  W+E    +   +Q+L  + +     T G  + V     +   ++  G  I
Sbjct: 324 MRVAGNAVKLWSE-QAALTADLQKLLNDVDMWKNITPGLPVLVTRCTLRFANSVVNGETI 382

Query: 519 LPATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASFVSMILTLPS 340
           +P   R  + + WLP +   + +   +                 Q LE +F+ +I TLP 
Sbjct: 383 VPRQVRTKLVRSWLPVLNVCRNMVQPMQCG--------YKSPNCQELEETFLQIISTLPV 434

Query: 339 ADQAEILTE---WWTNQHVQYPDLTEAFEAWCYRSKAA 235
            D  E+L +   + T      P L  AF+ W  R+  A
Sbjct: 435 PDAQELLQQCLGFSTRNVDDCPHLIAAFKTWFRRAGRA 472



>gb:OSJN00223_1190897 Oryza sativa (japonica cultivar-group)
           chromosome 4 clone OSJNBa0009K15, *** SEQUENCING IN
           PROGRESS ***, 2 ordered pieces.
          Length = 561

 Score = 41.2 bits (95), Expect = 0.028
 Identities = 45/202 (22%), Positives = 84/202 (41%), Gaps = 6/202 (2%)
 Frame = -3

Query: 831 CIKRLLDRFSQLVESLLCDVQESISEDGK--LQLFKSCLSDLSWACQILTKLEIMRDFVH 658
           C+  L++ F++     LC   + I  D K  ++       +L+W   IL   ++  +FV 
Sbjct: 374 CLNSLVEHFTED----LCS--DKIVRDSKPMIERVSKQTENLNWLFDILVNNDMAEEFVE 427

Query: 657 RWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAIGYGTVILPATKRLHMAKVWL 478
            W +    +I +  Q S        + ++  ++A V   +G G V  P+  R  +   W 
Sbjct: 428 LWAK-QEDLISMHGQASAMF-----RYELSRISANVFIVLGKGKVQCPSDLRSQLFYGWF 481

Query: 477 PFVRAIKPLSDSVTADSDDDLIPKIDGDL-WQSLEASFVSMILTLPSADQAEILTEW--- 310
                 +P+        D   + +    L  + LE +    +LTLP   Q  +  EW   
Sbjct: 482 ------RPML------MDFGWLQRCSKGLDMRMLEENLGQALLTLPLQQQQSLFEEWFQC 529

Query: 309 WTNQHVQYPDLTEAFEAWCYRS 244
           + ++  + P+L+ AF+ W  RS
Sbjct: 530 FASRGTECPNLSRAFQVWWRRS 551



>pir|T08399|T08399 hypothetical protein F18B3.60 - Arabidopsis
           thaliana>gb:ATF18B3_1549082 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F18B3.>gb:BT002970_1636553
           Arabidopsis thaliana clone RAFL15-22-E11 (R20469)
           unknown protein (At3g50780) mRNA, complete
           cds.>gb:BT005113_1638059 Arabidopsis thaliana clone
           U20469 unknown protein (At3g50780) mRNA, complete cds.
          Length = 520

 Score = 40.4 bits (93), Expect = 0.048
 Identities = 40/162 (24%), Positives = 65/162 (40%), Gaps = 4/162 (2%)
 Frame = -3

Query: 717 DLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAI 538
           +L+W   +L + +   +F   W   + K + ++ +  P    + ++  +  V +++   I
Sbjct: 354 NLTWLLDVLAERQAAEEFSVTWA--NQKELALLHEKLP----LMSRYHISRVTSRLFIGI 407

Query: 537 GYGTVILPATKRLHMAKVWL-PFVRAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASFVS 361
           G G ++     RL +   WL P       L     +          DG L   +E     
Sbjct: 408 GRGELLPSKDTRLLLLTTWLQPLFNDYNWLQHGCRS---------FDGKL---VEEGIGR 455

Query: 360 MILTLPSADQAEILTEW---WTNQHVQYPDLTEAFEAWCYRS 244
            ILTLP  DQ  IL  W   + N     P+L  AFE W  RS
Sbjct: 456 TILTLPLEDQQSILLSWLGSFLNGGDGCPNLQRAFEVWWRRS 497



>gb:BT005361_1638301 Arabidopsis thaliana At3g19920 mRNA, complete
           cds.>gb:AK118477_1816450 Arabidopsis thaliana At3g19920
           mRNA for unknown protein, complete cds, clone:
           RAFL19-71-E21.
          Length = 416

 Score = 39.7 bits (91), Expect = 0.081
 Identities = 33/163 (20%), Positives = 71/163 (43%), Gaps = 4/163 (2%)
 Frame = -3

Query: 717 DLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAI 538
           +L W  + L +   + + + RW+  S  +  +    +P  + +     +++++A ++  +
Sbjct: 267 ELLWMTEKLRRYGAVAEGIKRWSYAS-GLASLSLTAAPRVQGL-----MVKISALLIGEL 320

Query: 537 GYGTVILPATKRLHMAKVWLP-FVRAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASFVS 361
              +  +P      +   WLP F  A   L+            P + G     +E +   
Sbjct: 321 ARDSTQVPGQVAFRLLANWLPLFSHARNGLA-----------FPVLTGYERVEVERAIDK 369

Query: 360 MILTLPSADQAEILTEWWTNQHV---QYPDLTEAFEAWCYRSK 241
            I TLP+ DQ  +LT W  +  V   ++P+L  A++ WC+ ++
Sbjct: 370 AISTLPALDQEILLTNWLQDFSVSASEWPNLQPAYDRWCHSTR 412



>gb:AB025631_1516568 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPN9.
          Length = 416

 Score = 39.7 bits (91), Expect = 0.081
 Identities = 33/163 (20%), Positives = 71/163 (43%), Gaps = 4/163 (2%)
 Frame = -3

Query: 717 DLSWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAI 538
           +L W  + L +   + + + RW+  S  +  +    +P  + +     +++++A ++  +
Sbjct: 267 ELLWMTEKLRRYGAVAEGIKRWSYAS-GLASLSLTAAPRVQGL-----MVKISALLIGEL 320

Query: 537 GYGTVILPATKRLHMAKVWLP-FVRAIKPLSDSVTADSDDDLIPKIDGDLWQSLEASFVS 361
              +  +P      +   WLP F  A   L+            P + G     +E +   
Sbjct: 321 ARDSTQVPGQVTFRLLANWLPLFSHARNGLA-----------FPVLTGYERVEVERAIDK 369

Query: 360 MILTLPSADQAEILTEWWTNQHV---QYPDLTEAFEAWCYRSK 241
            I TLP+ DQ  +LT W  +  V   ++P+L  A++ WC+ ++
Sbjct: 370 AISTLPALDQEILLTNWLQDFSVSASEWPNLQPAYDRWCHSTR 412



>gb:CR382123_1656105 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 1518

 Score = 38.9 bits (89), Expect = 0.14
 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 10/104 (9%)
 Frame = -3

Query: 885 DDAPLLTADNEIKLEVVQCIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSCLSDLSW 706
           D  P+L       L++  C K LL R +   E  L D+   I +D KL +F+  +  LSW
Sbjct: 30  DGLPILQNVQSTDLQL--CFKSLLKRANTTKEKALNDLLSFIQDDDKLSIFQDDMFILSW 87

Query: 705 ACQILTKL-----EIMRDFVHRWT-----EISVKIIKVVQQLSP 604
            CQI  KL     + +R   H++T     +   ++ K +++L P
Sbjct: 88  -CQIYAKLISSDSKTIRIQAHQFTATLIAKFGKRVSKFLKELIP 130



>gb:BA000038_724762 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 542

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = -3

Query: 894 VEDDDAPLLTADNEIKLEVV---QCIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSC 724
           +E     LLT DN   L+     Q I   L ++S L ESLL    ESI  +  + LFK  
Sbjct: 418 IEQAFTQLLTGDNAFILQRFREKQGIANPLVQWSALSESLLLHALESIPRESLVALFKIQ 477

Query: 723 LSDLSWACQILTKLEIMRDFVHRWTEI 643
           LSDL      +  L   +D  ++W E+
Sbjct: 478 LSDLKLYRNGMPDLIAFKDGEYQWIEV 504



>gb:AE016808_337928 Vibrio vulnificus CMCP6 chromosome II section 1
           of 6 of the complete sequence.>gb:AE016796_1047652
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 542

 Score = 38.1 bits (87), Expect = 0.24
 Identities = 30/87 (34%), Positives = 41/87 (47%), Gaps = 3/87 (3%)
 Frame = -3

Query: 894 VEDDDAPLLTADNEIKLEVV---QCIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSC 724
           +E     LLT DN   L+     Q I   L ++S L ESLL    ESI  +  + LFK  
Sbjct: 418 IEQAFTQLLTGDNAFILQRFREKQGIANPLVQWSALSESLLLHALESIPRESLVALFKIQ 477

Query: 723 LSDLSWACQILTKLEIMRDFVHRWTEI 643
           LSDL      +  L   +D  ++W E+
Sbjct: 478 LSDLKLYRNGMPDLIAFKDGEYQWIEV 504



>gb:AC107207_1738362 Oryza sativa chromosome 3 BAC OSJNBb0106M04
           genomic sequence, complete sequence.>gb:AC133450_1741474
           Oryza sativa chromosome 3 BAC OSJNBa0072F13 genomic
           sequence, complete sequence.
          Length = 522

 Score = 36.6 bits (83), Expect = 0.69
 Identities = 50/206 (24%), Positives = 75/206 (36%), Gaps = 10/206 (4%)
 Frame = -3

Query: 831 CIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSCLSDLSWACQILTKLEIMRDFVHRW 652
           C++ LL  F Q       +    + E    Q+      +L W  +IL       +F   W
Sbjct: 325 CLESLLTLFRQATADDFAEQSLDLKEPVFRQIALEA-DNLLWLTEILADRNAAGEFAVMW 383

Query: 651 TEISVKIIKVVQQLSPEAETIGTKLKVLE--VAAKVLEAIGYGTVILPATKRLHMAKVWL 478
           +           +L+     + TK + L   V A++  AIG G ++     R  +  VWL
Sbjct: 384 SNQG--------ELAELHSKLPTKSRHLVSCVTARLFVAIGKGDMLPSKDTRKLLLDVWL 435

Query: 477 PFVRAIKPLSDSVT-----ADSDDDLIPKIDGDLWQSLEASFVSMILTLPSADQAEILTE 313
                 +PL D          S D  +          +E      ILTLP  DQ  IL  
Sbjct: 436 ------QPLMDDYNWLQHGCRSFDRKV----------VEEGIGRTILTLPLEDQQTILLS 479

Query: 312 W---WTNQHVQYPDLTEAFEAWCYRS 244
           W   +       P+L +AFE W  R+
Sbjct: 480 WLGSFLKVGDSCPNLQKAFEVWWKRT 505



>gb:AY094902_1298076 Drosophila melanogaster RH08189 full insert cDNA.
          Length = 751

 Score = 34.7 bits (78), Expect = 2.6
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 7/146 (4%)
 Frame = -3

Query: 627  KVVQQLSPEAET--IGTKLKVLEVAAKVLEAIGYGTVILPATKRLHMAKVWLPFVR---- 466
            K+++ ++PE     IGT     E   K+L+++    + +P      M+  W   +     
Sbjct: 582  KLIKNIAPEDRVVFIGTSNLPWEADQKLLQSVYNRFIYIPRPDYGAMSHAWKTLLHDYSG 641

Query: 465  AIKPLSDSVTAD-SDDDLIPKIDGDLWQSLEASFVSMILTLPSADQAEILTEWWTNQHVQ 289
             I  L  S  A  SD   I  ID  L + + +     + T P  + AE++    +   V 
Sbjct: 642  GISNLDTSAMAKISDGYTIGSIDACLKEVMTSKRKLQLRTQPLTN-AELINVLCSRDPV- 699

Query: 288  YPDLTEAFEAWCYRSKAAKRRLAMLE 211
            Y +  EAFE+W  ++   +RR   LE
Sbjct: 700  YREEEEAFESWWSKTPLGRRRQRFLE 725



>gb:AE014297_1138689 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003683_1220682 Drosophila melanogaster
            chromosome 3R, section 21 of 118 of the complete
            sequence.
          Length = 793

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 37/146 (25%), Positives = 62/146 (42%), Gaps = 7/146 (4%)
 Frame = -3

Query: 627  KVVQQLSPEAET--IGTKLKVLEVAAKVLEAIGYGTVILPATKRLHMAKVWLPFVR---- 466
            K+++ ++PE     IGT     E   K+L+++    + +P      M+  W   +     
Sbjct: 624  KLIKNIAPEDRVVFIGTSNLPWEADQKLLQSVYNRFIYIPRPDYGAMSHAWKTLLHDYSG 683

Query: 465  AIKPLSDSVTAD-SDDDLIPKIDGDLWQSLEASFVSMILTLPSADQAEILTEWWTNQHVQ 289
             I  L  S  A  SD   I  ID  L + +       + T P  + AE++    +   V 
Sbjct: 684  GISNLDTSAMAKISDGYTIGSIDACLKEVMTCKRKLQLRTQPLTN-AELINVLCSRDPV- 741

Query: 288  YPDLTEAFEAWCYRSKAAKRRLAMLE 211
            Y +  EAFE+W  ++   +RR   LE
Sbjct: 742  YREEEEAFESWWSKTPLGRRRQRFLE 767



>sp|Q8NKQ0|MR11_SULAC DNA double-strand break repair protein
           mre11.>gb:SAC437617_169362 Sulfolobus acidocaldarius
           mre11 gene, rad5O gene and nurA gene.
          Length = 382

 Score = 34.3 bits (77), Expect = 3.4
 Identities = 26/101 (25%), Positives = 48/101 (47%), Gaps = 6/101 (5%)
 Frame = -3

Query: 816 LDRFSQLVESLLCDVQESISEDGKLQLFKSCLSDLSWACQIL-TKLEIMRDFVHRWTEIS 640
           +D+  Q +ES++  ++E++  D K  L       +     +L TKL+ +RD+V  +    
Sbjct: 255 VDKIEQSIESVIQKLKENVKNDKKPILHIELEGTVPIRKDVLMTKLQALRDYVEHYRIYK 314

Query: 639 VKIIKVVQQLSPEAETIGTKLKVL-----EVAAKVLEAIGY 532
             I+ +      + E + TKLK       ++ A  L+ IGY
Sbjct: 315 NNIVSI------KEENLKTKLKTTYSSLNDIIADYLKGIGY 349



>gb:AE005674_71181 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016983_371521 Shigella flexneri 2a str.
           2457T section 6 of 16 of the complete
           genome.>gb:AE014073_996271 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 329

 Score = 33.1 bits (74), Expect = 7.6
 Identities = 30/135 (22%), Positives = 51/135 (37%)
 Frame = -3

Query: 891 EDDDAPLLTADNEIKLEVVQCIKRLLDRFSQLVESLLCDVQESISEDGKLQLFKSCLSDL 712
           E  D  ++  ++++K       K+       +V+ L  D+     ED  + +     + L
Sbjct: 203 EVSDYGIIAHESQLKALSRLAAKQGFSGEDAIVDMLGTDIAYYNGEDKGVFMLAKRFTAL 262

Query: 711 SWACQILTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAIGY 532
           S+ C           F H    I+V + +     S + E +G    V E A  +    G 
Sbjct: 263 SFGC-----------FRHDGENITVVLSRDGDSQSHDLEILGKVFVVAEAATTIKMGTGS 311

Query: 531 GTVILPATKRLHMAK 487
            T +LP  KRL   K
Sbjct: 312 ATAVLPVVKRLKFTK 326



>gb:AE016776_330132 Pseudomonas putida KT2440 section 3 of 21 of the
           complete genome.>gb:AE015451_945209 Pseudomonas putida
           KT2440 complete genome.
          Length = 943

 Score = 32.7 bits (73), Expect = 10.0
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 2/108 (1%)
 Frame = -3

Query: 693 LTKLEIMRDFVHRWTEISVKIIKVVQQLSPEAETIGTKLKVLEVAAKVLEAIGYGTVILP 514
           L++LE  +D + R ++      + VQQLS + + +G +L  LE   + LE       +LP
Sbjct: 550 LSQLEAAQDELKRSSDA---FTERVQQLSAKLQLVGRQLGDLESKQRTLEDALRRRQLLP 606

Query: 513 ATKRLHMAKVWLPFVRAIKPLSDSVTADSDDDLIPKIDG--DLWQSLE 376
           A           P++ AI         DS D+L+P ++   D WQSL+
Sbjct: 607 AD-----LPYGTPYMEAID--------DSMDNLLPLLNDYQDSWQSLQ 641



>gb:AE005674_72441 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016988_372618 Shigella flexneri 2a str.
           2457T section 11 of 16 of the complete
           genome.>gb:AE014073_997368 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 329

 Score = 32.7 bits (73), Expect = 10.0
 Identities = 27/104 (25%), Positives = 40/104 (38%)
 Frame = -3

Query: 798 LVESLLCDVQESISEDGKLQLFKSCLSDLSWACQILTKLEIMRDFVHRWTEISVKIIKVV 619
           +V+ L  DV     ED  + +     + LS+ C           F H    I+V + +  
Sbjct: 234 IVDMLGTDVAYYNGEDRGVFMMAKRFTALSFGC-----------FRHDGESITVVLSRDG 282

Query: 618 QQLSPEAETIGTKLKVLEVAAKVLEAIGYGTVILPATKRLHMAK 487
              S + E +G    V E A  +    G  T +LP  KRL   K
Sbjct: 283 DSQSHDLEILGKVFVVAEAATTIKMGTGSATAVLPVVKRLSFTK 326


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 952,844,784
Number of Sequences: 1806583
Number of extensions: 19695004
Number of successful extensions: 49113
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 47437
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49059
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 63706499574
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)