BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13379
         (819 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|F84611|F84611 hypothetical protein At2g22350 [imported] - Ar...    61   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AB008264_1510376 Arabidopsis thaliana genomic DNA, chromosome...    62   5e-11   
gb:AP002032_1821492 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-10   
pir|H84677|H84677 hypothetical protein At2g27870 [imported] - Ar...    60   4e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AC007843_1536256 Arabidopsis thaliana chromosome I BAC F28G4 ...    55   7e-10   
pir|D86310|D86310 protein F1L3.4 [imported] - Arabidopsis thalia...    55   7e-10   Arabidopsis thaliana [mouse-ear cress]
pir|A96682|A96682 protein F1E22.12 [imported] - Arabidopsis thal...    55   5e-09   Arabidopsis thaliana [mouse-ear cress]
pir|G84429|G84429 hypothetical protein At2g01840 [imported] - Ar...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023132 Oryza sativa (japonica cultivar-group) chrom...    55   1e-06   
pir|B96652|B96652 protein F23N19.5 [imported] - Arabidopsis thal...    55   2e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T00599|T00599 probable reverse transcriptase At2g02650 [impo...    55   2e-06   Arabidopsis thaliana [mouse-ear cress]
pir|A84888|A84888 hypothetical protein At2g45230 [imported] - Ar...    54   5e-06   Arabidopsis thaliana [mouse-ear cress]
pir|H85088|H85088 hypothetical protein AT4g08830 [imported] - Ar...    42   6e-06   Arabidopsis thaliana [mouse-ear cress]
pir|C84488|C84488 hypothetical protein At2g07730 [imported] - Ar...    45   7e-06   Arabidopsis thaliana [mouse-ear cress]
pir|C84716|C84716 hypothetical protein At2g31080 [imported] - Ar...    44   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023451 Oryza sativa (japonica cultivar-group) chrom...    52   2e-05   
gb:AE016959_1021342 Oryza sativa (japonica cultivar-group) chrom...    52   2e-05   
gb:AB006696_1509817 Arabidopsis thaliana genomic DNA, chromosome...    51   2e-05   
gb:AC135559_1742523 Oryza sativa chromosome 3 BAC OSJNBa0030J19 ...    51   3e-05   
pir|A84742|A84742 probable polygalacturonase [imported] - Arabid...    50   5e-05   Arabidopsis thaliana [mouse-ear cress]
pir|C84528|C84528 hypothetical protein At2g15380 [imported] - Ar...    49   9e-05   Arabidopsis thaliana [mouse-ear cress]
pir|H86403|H86403 hypothetical protein F28L5.12 - Arabidopsis th...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY168997_1586429 Arabidopsis thaliana hypothetical protein (T...    49   1e-04   
pir|D84457|D84457 hypothetical protein At2g04420 [imported] - Ar...    48   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AB026647_1517210 Arabidopsis thaliana genomic DNA, chromosome...    48   3e-04   
gb:AP006168_1861241 Oryza sativa (japonica cultivar-group) genom...    47   6e-04   
gb:AE005173_894384 Arabidopsis thaliana chromosome 1, bottom arm...    47   6e-04   
gb:AP003770_1833342 Oryza sativa (japonica cultivar-group) genom...    46   0.001   
gb:AE016959_1022705 Oryza sativa (japonica cultivar-group) chrom...    45   0.001   
pir|G84512|G84512 hypothetical protein At2g13980 [imported] - Ar...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AP003766_1833202 Oryza sativa (japonica cultivar-group) genom...    45   0.002   
gb:AC087425_1734049 Oryza sativa (japonica cultivar-group) chrom...    45   0.002   
gb:AB026651_1517269 Arabidopsis thaliana genomic DNA, chromosome...    43   0.002   
gb:AE005173_892596 Arabidopsis thaliana chromosome 1, bottom arm...    39   0.004   
pir|T05150|T05150 hypothetical protein F18E5.40 - Arabidopsis th...    44   0.005   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00139_1695547 Oryza sativa genomic DNA, chromosome 4, BAC...    43   0.006   
pir|T00619|T00619 hypothetical protein T27I1.2 - Arabidopsis tha...    43   0.006   Arabidopsis thaliana [mouse-ear cress]
gb:AC099401_1737150 Oryza sativa (japonica cultivar-group) chrom...    43   0.008   
gb:AC092781_1735739 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    42   0.011   
gb:AE016959_1023432 Oryza sativa (japonica cultivar-group) chrom...    42   0.011   
gb:AC027033_1539761 Arabidopsis thaliana chromosome 1 BAC F21N10...    42   0.014   
gb:AC149288_1744910 Solanum demissum chromosome 5 clone PGEC446J...    41   0.031   
gb:AC145388_1744443 Oryza sativa chromosome 3 BAC OSJNBb0036M02 ...    41   0.031   
gb:AC133930_1741619 Oryza sativa chromosome 3 BAC OSJNBa0039O18 ...    41   0.031   
gb:AY730337_1625421 Solanum tuberosum strain P6/210 clone BAC BA...    41   0.031   
gb:AY333186_1600079 Oryza sativa (japonica cultivar-group) bZIP-...    41   0.031   
pir|T02320|T02320 hypothetical protein At2g34320 [imported] - Ar...    40   0.068   Arabidopsis thaliana [mouse-ear cress]
gb:AC135502_1742484 Oryza sativa chromosome 3 BAC OSJNBb0085A04 ...    39   0.15    
pir|B84497|B84497 hypothetical protein At2g11240 [imported] - Ar...    39   0.15    Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022853 Oryza sativa (japonica cultivar-group) chrom...    38   0.20    
pir|T04719|T04719 hypothetical protein F19F18.110 - Arabidopsis ...    38   0.20    Arabidopsis thaliana [mouse-ear cress]
gb:AC084404_1733566 Oryza sativa chromosome 3 BAC OSJNBa0026A15 ...    37   0.34    
gb:AP002033_1821517 Arabidopsis thaliana genomic DNA, chromosome...    37   0.44    
gb:AC112514_1738887 Oryza sativa chromosome 10 clone OSJNAb0023M...    37   0.44    
gb:AE016959_1022030 Oryza sativa (japonica cultivar-group) chrom...    37   0.44    
gb:OSJN00216_1696882 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.58    
gb:AC151801_1745090 Solanum demissum chromosome 11 clone PGEC591...    36   0.76    
pir|E86396|E86396 T2P11.14 protein - Arabidopsis thaliana>gb:AE0...    36   0.76    Arabidopsis thaliana [mouse-ear cress]
pir|T14595|T14595 polyprotein - maize retrotransposon Cinful-1>g...    36   0.76    Zea mays [maize]
pir|C84487|C84487 hypothetical protein At2g07650 [imported] - Ar...    36   0.76    Arabidopsis thaliana [mouse-ear cress]
gb:BC034328_1981238 Homo sapiens, clone IMAGE:4780414, mRNA, par...    36   0.99    
gb:OSJN00067_1694235 Oryza sativa genomic DNA, chromosome 4, BAC...    36   0.99    
gb:OSJN00055_1694002 Oryza sativa genomic DNA, chromosome 4, BAC...    36   0.99    
gb:OSJN00264_1190996 Oryza sativa (japonica cultivar-group) chro...    36   0.99    
gb:AJ621745_2501289 Gallus gallus partial FACL6 gene for fatty a...    35   1.3     
gb:AP002816_1822841 Oryza sativa (japonica cultivar-group) genom...    35   1.3     
gb:AC130730_1740946 Oryza sativa (japonica cultivar-group) chrom...    35   1.7     
gb:AC084406_1733633 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    35   1.7     
gb:AE016959_1022197 Oryza sativa (japonica cultivar-group) chrom...    35   2.2     
pir|I40894|I40894 3-deoxy-manno-octulosonate cytidylyltransferas...    35   2.2     Chlamydia trachomatis
sp|Q57440|KDTA_CHLTR|KDTA_CHLTR 3-deoxy-D-manno-octulosonic-acid transferas...    35   2.2     Chlamydia trachomatis
gb:AE005173_892649 Arabidopsis thaliana chromosome 1, bottom arm...    34   2.9     
pir|F71420|F71420 hypothetical protein - Arabidopsis thaliana>gb...    34   2.9     Arabidopsis thaliana [mouse-ear cress]
pir|I40898|I40898 3-deoxy-manno-octulosonate cytidylyltransferas...    34   2.9     Chlamydia trachomatis
gb:AF466646_1802320 Zea mays clone ZMMBBb_Z195D10 putative trans...    34   3.8     
gb:AE016959_1021943 Oryza sativa (japonica cultivar-group) chrom...    34   3.8     
gb:BX248358_762948 Corynebacterium diphtheriae gravis NCTC13129,...    34   3.8     
gb:AC132493_1741229 Oryza sativa (japonica cultivar-group) chrom...    33   4.9     
gb:AC130601_1740762 Oryza sativa (japonica cultivar-group) chrom...    33   4.9     
gb:AC090683_1734408 Oryza sativa chromosome 3 BAC OSJNBa0035I24 ...    33   4.9     
gb:OSJN00143_1695608 Oryza sativa genomic DNA, chromosome 4, BAC...    33   4.9     
gb:OSJN00094_1694801 Oryza sativa genomic DNA, chromosome 4, BAC...    33   4.9     
gb:OSJN00145_1190852 Oryza sativa (japonica cultivar-group) chro...    33   4.9     
gb:AE017269_422942 Bacillus cereus ATCC 10987, section 6 of 18 o...    33   4.9     
gb:AE017029_381798 Bacillus anthracis str. Ames section 6 of 18 ...    33   4.9     
pir|D84499|D84499 hypothetical protein At2g11830 [imported] - Ar...    33   4.9     Arabidopsis thaliana [mouse-ear cress]
gb:AP002804_1822804 Oryza sativa (japonica cultivar-group) genom...    33   6.4     
gb:AC145271_1744283 Oryza sativa (japonica cultivar-group) chrom...    33   6.4     
gb:AC135595_1742674 Oryza sativa chromosome 3 BAC OSJNBa0028F23 ...    33   6.4     
gb:AC133333_1741323 Oryza sativa chromosome 3 BAC OJ1785_A05 gen...    33   6.4     
gb:AC104272_1737354 Oryza sativa (japonica cultivar-group) chrom...    33   6.4     
gb:AC084296_1733473 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...    33   6.4     
gb:AC079357_1732549 Oryza sativa (japonica cultivar-group) chrom...    33   6.4     
gb:OSJN00242_1697254 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.4     
gb:OSJN00232_1697133 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.4     
gb:OSJN00208_1696724 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.4     
gb:OSJN00199_1696591 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.4     
gb:OSJN00168_1696086 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.4     
gb:OSJN00011_1693247 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.4     
gb:AC079021_1541694 Oryza sativa (japonica cultivar-group) chrom...    33   6.4     
gb:AE016959_1023257 Oryza sativa (japonica cultivar-group) chrom...    33   6.4     
gb:AE016959_1022207 Oryza sativa (japonica cultivar-group) chrom...    33   6.4     
gb:AE016959_1021691 Oryza sativa (japonica cultivar-group) chrom...    33   6.4     
pir|T01474|T01474 hypothetical protein T24H24.17 - Arabidopsis t...    33   6.4     Arabidopsis thaliana [mouse-ear cress]
pir|G85096|G85096 hypothetical protein AT4g09490 [imported] - Ar...    33   6.4     Arabidopsis thaliana [mouse-ear cress]
gb:BC083764_2108835 Rattus norvegicus similar to Peci protein, m...    33   8.4     
gb:AC145396_1744469 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AC135420_1742264 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AC134237_1741690 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AC120989_1740068 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AC120506_1739789 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AC113334_1738935 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AC097111_1736413 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:OSJN00296_1698136 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00190_1696476 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00160_1695916 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00144_1695628 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00140_1695565 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00107_1695050 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00097_1694853 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00077_1694429 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00076_1694414 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00069_1694273 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00049_1693882 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00041_1693758 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00031_1693563 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00027_1693535 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00020_1693418 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00019_1693390 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:OSJN00007_1693179 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.4     
gb:AC079038_1541792 Oryza sativa chromosome 7 clone OSJNBb0024A2...    33   8.4     
gb:OSJN00264_1191000 Oryza sativa (japonica cultivar-group) chro...    33   8.4     
gb:OSJN00223_1190899 Oryza sativa (japonica cultivar-group) chro...    33   8.4     
gb:OSJN00133_1190829 Oryza sativa (japonica cultivar-group) chro...    33   8.4     
gb:AE016959_1023331 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AE016959_1021434 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
gb:AE016959_1021152 Oryza sativa (japonica cultivar-group) chrom...    33   8.4     
pir|H84465|H84465 hypothetical protein At2g05200 [imported] - Ar...    33   8.4     Arabidopsis thaliana [mouse-ear cress]


>pir|F84611|F84611 hypothetical protein At2g22350 [imported] -
           Arabidopsis thaliana>gb:AC006592_1534578 Arabidopsis
           thaliana chromosome 2 clone F14M13 map mi238, complete
           sequence.
          Length = 321

 Score = 61.2 bits (147), Expect(2) = 1e-11
 Identities = 43/160 (26%), Positives = 63/160 (39%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAILK 397
           W  P +G VKLN D             G +RDHNG W  GF  +   C+   +E W +  
Sbjct: 153 WVSPEDGWVKLNTDGASRGNPGFATAGGVLRDHNGAWIGGFAVNIGVCSAPLAELWGVYY 212

Query: 396 GIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIPR 217
           G+ +          +E DS   V ++ +    S     +L  C   +      +   + R
Sbjct: 213 GLFIAWGRGARRVELEVDSKMVVGFLTTGIADSHPLSFLLRLCYDFLSKGWIVRISHVYR 272

Query: 216 EINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAG 97
           E N +AD LA  A   +     L   P    S+L +D AG
Sbjct: 273 EANRLADGLANYAFSLSLGLHLLESRPDVVSSILLDDVAG 312



 Score = 30.8 bits (68), Expect(2) = 1e-11
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = -2

Query: 761 IFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRAFARERG 618
           +F +A W  WKWR    F G  K    ++  I+  AE+++ A A  +G
Sbjct: 93  VFVMAVWWGWKWRCGNIFGGNGK-CRDRVKFIKDLAEEVAIANAFVKG 139



>gb:AB008264_1510376 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MBD2.
          Length = 308

 Score = 62.0 bits (149), Expect(2) = 5e-11
 Identities = 42/160 (26%), Positives = 63/160 (39%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAILK 397
           W  P  G VK+N D             G +RD  G W  GF  +   C+   +E W +  
Sbjct: 140 WVLPCVGWVKVNTDGASRGNPGLASAGGVLRDCEGAWCGGFSLNIGRCSAQHAELWGVYY 199

Query: 396 GIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIPR 217
           G+      K     +E DS   V ++ +    S     ++  C   ++     +  ++ R
Sbjct: 200 GLYFAWEKKVPRVELEVDSEAIVGFLKTGISDSHPLSFLVRLCHNFLQKDWLVRIVYVYR 259

Query: 216 EINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAG 97
           E NC+AD LA    L +  F +    P    SLL ED  G
Sbjct: 260 EANCLADGLANYTILLSLGFHSFDFVPDAMSSLLKEDTLG 299



 Score = 28.1 bits (61), Expect(2) = 5e-11
 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%)
 Frame = -2

Query: 788 NRRPCSD---NIIFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRA 636
           +R  C D   + IFAV  W  WKWR    F G   +   ++  ++    ++ RA
Sbjct: 68  DRSSCEDIPWSTIFAVIIWWGWKWRCSNIF-GENTKCRDRVKFVKEWVVEVYRA 120



>gb:AP002032_1821492 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MPH15.
          Length = 676

 Score = 62.0 bits (149), Expect(2) = 3e-10
 Identities = 44/167 (26%), Positives = 67/167 (40%)
 Frame = -1

Query: 597  MIWKQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFES 418
            ++ + + W KP EG V +N D             G IRD +G W  GF  +   C+   +
Sbjct: 501  LVERMIAWRKPAEGWVTMNTDGASHGNPGQATAGGVIRDEHGSWLVGFALNIGVCSAPLA 560

Query: 417  EAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFC 238
            E W +  G+ +     +    +E DSA  V ++ S    S     ++  C   +      
Sbjct: 561  ELWGVYYGLVVAWERGWRRVRLEVDSALVVGFLQSGIGDSHPLAFLVRLCHGFISKDWIV 620

Query: 237  QFKFIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAG 97
            +   + RE N +AD LA  A      F  L   P    S+L ED  G
Sbjct: 621  RITHVYREANRLADGLANYAFTLPFGFLLLDSCPEHVSSILLEDVMG 667



 Score = 25.4 bits (54), Expect(2) = 3e-10
 Identities = 12/48 (25%), Positives = 20/48 (41%)
 Frame = -2

Query: 761 IFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRAFARERG 618
           +FA+  W  WKWR    F G       ++  ++S   ++  A     G
Sbjct: 448 LFALTVWWGWKWRCGYVF-GEDSRCRDRVKFLKSAVAEVEAAHLAANG 494



>pir|H84677|H84677 hypothetical protein At2g27870 [imported] -
           Arabidopsis thaliana>gb:AC005824_1533025 Arabidopsis
           thaliana chromosome 2 clone F15K20 map B68, complete
           sequence.>gb:AC006929_1534809 Arabidopsis thaliana
           chromosome 2 clone T1E2 map mi54, complete sequence.
          Length = 314

 Score = 59.7 bits (143), Expect(2) = 4e-10
 Identities = 46/179 (25%), Positives = 72/179 (40%), Gaps = 4/179 (2%)
 Frame = -1

Query: 600 DMIWKQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFE 421
           + + + + W KP EG  KLN D             G +RD  G W+ GF  +   C+   
Sbjct: 138 ERVERLIAWSKPEEGWWKLNTDGASRGNPGLASAGGVLRDEEGAWRGGFALNIGVCSAPL 197

Query: 420 SEAWAILKGIQLLASMKYSHAIIESDSAEAVEY----INSTRIPSIAGHNILEACKREVR 253
           +E W +  G+ +    + +   IE DS   V +    IN     S     ++  C   + 
Sbjct: 198 AELWGVYYGLYIAWERRVTRLEIEVDSEIVVGFLKIGINEVHPLSF----LVRLCHDFIS 253

Query: 252 SFEFCQFKFIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAGFPVWRNM 76
                +   + RE N +AD LA  A      F +L   P   R +L +D +G  V R +
Sbjct: 254 RDWRVRISHVYREANRLADGLANYAFSLPLGFHSLSLVPDSLRFILLDDTSGATVSRQV 312



 Score = 27.3 bits (59), Expect(2) = 4e-10
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 2/70 (2%)
 Frame = -2

Query: 785 RRPCSD--NIIFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRAFARERGPH 612
           R+ C    + +FA++ W  WKWR    F G   +   ++  ++  A + S A       H
Sbjct: 75  RKTCESTWSTLFALSIWWAWKWRCGNIF-GVQDKCRDRVRFLKDLARETSMA-------H 126

Query: 611 SIERI*SGSN 582
            I R  SG +
Sbjct: 127 VIVRTLSGGH 136



>gb:AC007843_1536256 Arabidopsis thaliana chromosome I BAC F28G4
           genomic sequence, complete sequence.>gb:AY800584_1628532
           Arabidopsis thaliana clone H0000001086 hypothetical
           protein (AT1G17390) mRNA, complete cds.
          Length = 272

 Score = 55.1 bits (131), Expect(2) = 7e-10
 Identities = 41/169 (24%), Positives = 64/169 (37%)
 Frame = -1

Query: 582 LCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAI 403
           + W  PR G  KLN D             G +RD +G W  GF  +   C+   +E W  
Sbjct: 102 IAWSPPRVGWFKLNTDGASRGNPRLATAGGVVRDGDGNWCYGFSLNIGICSAPLAELWGA 161

Query: 402 LKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFI 223
             G+ +      +   +E DS   V ++ +    S     ++  C   +      +   +
Sbjct: 162 YYGLNIAWERGVTQLEMEIDSEMVVGFLRTGIDDSHPLSFLVRLCHGLLSKDWSVRISHV 221

Query: 222 PREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAGFPVWRNM 76
            RE N +AD LA  A      F      P    S++ +D AG    RN+
Sbjct: 222 YREANRLADGLANYAFFLPLGFHLFNSTPDIVMSIVHDDVAGSAYPRNV 270



 Score = 31.2 bits (69), Expect(2) = 7e-10
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = -2

Query: 776 CSDNIIFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRAFARERG 618
           C   + F+ A W  WKWR    F G  K+   ++  I+ +A D+ +A   + G
Sbjct: 39  CPWAVTFSQAIWWGWKWRYGNIF-GENKKCRDRVRFIKDRALDVWKAHVHKMG 90



>pir|D86310|D86310 protein F1L3.4 [imported] - Arabidopsis
           thaliana>gb:AE005172_890715 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC022492_1539033 Genomic sequence for
           Arabidopsis thaliana BAC F1L3 from chromosome I,
           complete sequence.
          Length = 253

 Score = 55.1 bits (131), Expect(2) = 7e-10
 Identities = 41/169 (24%), Positives = 64/169 (37%)
 Frame = -1

Query: 582 LCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAI 403
           + W  PR G  KLN D             G +RD +G W  GF  +   C+   +E W  
Sbjct: 83  IAWSPPRVGWFKLNTDGASRGNPRLATAGGVVRDGDGNWCYGFSLNIGICSAPLAELWGA 142

Query: 402 LKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFI 223
             G+ +      +   +E DS   V ++ +    S     ++  C   +      +   +
Sbjct: 143 YYGLNIAWERGVTQLEMEIDSEMVVGFLRTGIDDSHPLSFLVRLCHGLLSKDWSVRISHV 202

Query: 222 PREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAGFPVWRNM 76
            RE N +AD LA  A      F      P    S++ +D AG    RN+
Sbjct: 203 YREANRLADGLANYAFFLPLGFHLFNSTPDIVMSIVHDDVAGSAYPRNV 251



 Score = 31.2 bits (69), Expect(2) = 7e-10
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = -2

Query: 776 CSDNIIFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRAFARERG 618
           C   + F+ A W  WKWR    F G  K+   ++  I+ +A D+ +A   + G
Sbjct: 20  CPWAVTFSQAIWWGWKWRYGNIF-GENKKCRDRVRFIKDRALDVWKAHVHKMG 71



>pir|A96682|A96682 protein F1E22.12 [imported] - Arabidopsis
            thaliana>gb:AE005173_894225 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC007234_1535639 Genomic sequence for
            Arabidopsis thaliana BAC F1E22, complete sequence.
          Length = 1055

 Score = 54.7 bits (130), Expect(2) = 5e-09
 Identities = 41/164 (25%), Positives = 64/164 (39%)
 Frame = -1

Query: 588  KQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAW 409
            + + W  P  G VK+N D             G +RD  G W  GF  +   C+  ++E W
Sbjct: 557  RMIGWVSPCVGWVKVNTDGASRGNPGLASAGGVLRDCTGAWCGGFSLNIGRCSAPQAELW 616

Query: 408  AILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFK 229
             +  G+      K     +E DS   V ++ +    S     ++  C   ++     +  
Sbjct: 617  GVYYGLYFAWEKKVPRVELEVDSEVIVGFLKTGISDSHPLSFLVRLCHGFLQKDWLVRIV 676

Query: 228  FIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAG 97
             + RE N +AD LA  A   +  F +    P    SLL ED  G
Sbjct: 677  HVYREANRLADGLANYAFSLSLGFHSFDLVPDAMSSLLREDTLG 720



 Score = 28.5 bits (62), Expect(2) = 5e-09
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
 Frame = -2

Query: 788 NRRPCSD---NIIFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRA 636
           +R  C D   + IFAV  W  WKWR    F G   +   ++  ++  A ++ RA
Sbjct: 489 DRSGCEDIPWSTIFAVIIWWGWKWRCGNIF-GENTKCRDRVKFVKEWAVEVYRA 541



>pir|G84429|G84429 hypothetical protein At2g01840 [imported] -
            Arabidopsis thaliana>gb:AC007069_1535147 Arabidopsis
            thaliana chromosome 2 clone T23K3 map mi320, complete
            sequence.
          Length = 1715

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 40/152 (26%), Positives = 62/152 (40%), Gaps = 5/152 (3%)
 Frame = -1

Query: 576  WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASF-KSCTPFESEAWAIL 400
            W  P EG +K N D               +RD NGR      A   +S +  ++EA   L
Sbjct: 1556 WSSPPEGFLKCNFDSGYVQGRDYTSTGWILRDCNGRVLHSGCAKLQQSYSALQAEALGFL 1615

Query: 399  KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVR----SFEFCQF 232
              +Q++    Y +   E D+ E    IN T       H++LE    ++R       F   
Sbjct: 1616 HALQMVWIRGYCYVWFEGDNLELTNLINKTE-----DHHLLETLLYDIRFWMTKLPFSSI 1670

Query: 231  KFIPREINCVADCLARLARLQAASFQTLLDPP 136
             ++ RE N  AD L + A   ++ ++T   PP
Sbjct: 1671 GYVNRERNLAADKLTKYANSMSSLYETFHVPP 1702



>gb:AE016959_1023132 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC051632_1540133
           Oryza sativa chromosome 10 BAC OSJNBa0012L23 genomic
           sequence, complete sequence.>gb:AE017106_1752951 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           60 of 77 of the complete sequence.
          Length = 243

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 2/134 (1%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRW-KRGFLASFKSCTPFESEAWAIL 400
           W +P   ++K+NVD               IRD      + G  +S +    F +E  A +
Sbjct: 78  WTQPAAEVLKINVDGAFKHQLLLGGWGYVIRDVGAHVIQAGAGSSSRMQDAFHAEVMAGV 137

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTRIP-SIAGHNILEACKREVRSFEFCQFKFI 223
           KG+Q  A++  ++  +ESDS   ++ +       +  G  +LEA      SF  CQF + 
Sbjct: 138 KGLQAAANLGMANIQLESDSLTLIQALREENFRYAPLGGLLLEAKNIITSSFVSCQFSYC 197

Query: 222 PREINCVADCLARL 181
           PRE N VAD +A +
Sbjct: 198 PRECNKVADAIASI 211



>pir|B96652|B96652 protein F23N19.5 [imported] - Arabidopsis
           thaliana>gb:AE005173_893936 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007190_1535505 Genomic sequence for
           Arabidopsis thaliana BAC F23N19 from chromosome I,
           complete sequence.
          Length = 233

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 43/176 (24%), Positives = 68/176 (38%)
 Frame = -1

Query: 609 N*KDMIWKQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCT 430
           N +  + +Q+ W KP  G  KLN D             GA+R+  G W  GF  +   C 
Sbjct: 54  NSRSRMERQVRWSKPSLGWCKLNTDGASHGNPGLATAGGALRNEYGEWCFGFALNIGRCL 113

Query: 429 PFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRS 250
              +E W +  G+ +      +   +E DS   V ++ +    S     ++  C   +  
Sbjct: 114 APLAELWGVYYGLFMAWDRGITRLELEVDSEMVVGFLRTGIGSSHPLSFLVRMCHGFLSR 173

Query: 249 FEFCQFKFIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAGFPVWR 82
               +   + RE N +AD LA  A      +     PP    S+L +D  G  V R
Sbjct: 174 DWIVRIGHVYREANRLADGLANYAFDLPLGYHAFASPPNSLDSILRDDELGISVPR 229



>pir|T00599|T00599 probable reverse transcriptase At2g02650
           [imported] - Arabidopsis thaliana>gb:AC004136_1531450
           Arabidopsis thaliana chromosome 2 BAC T8K22 genomic
           sequence, complete sequence.
          Length = 365

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 42/149 (28%), Positives = 61/149 (40%), Gaps = 1/149 (0%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCT-PFESEAWAIL 400
           W  P EG VK N D               IR+ NG       A  +S T    +EA   L
Sbjct: 206 WNPPPEGWVKCNFDSGYTQGSPYTRSGWTIRECNGHIVLCGNAKLQSSTCSLHAEALGFL 265

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
             +Q++ +    +   ESDS   V  IN+    S+ G  I +  +  +    +C  +F+ 
Sbjct: 266 HALQVIWAHGLRYVWFESDSKSLVTLINNGEDHSLLGTLIYDI-RHWMLKLPYCSLEFVN 324

Query: 219 REINCVADCLARLARLQAASFQTLLDPPA 133
           RE N  AD LA     +   FQ+   PP+
Sbjct: 325 RERNSAADALASHVHARDPLFQSYTTPPS 353



>pir|A84888|A84888 hypothetical protein At2g45230 [imported] -
            Arabidopsis thaliana>gb:AC002387_1530599 Arabidopsis
            thaliana chromosome 2 clone F4L23 map CIC02E07, complete
            sequence.
          Length = 1374

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 44/134 (32%), Positives = 59/134 (44%), Gaps = 3/134 (2%)
 Frame = -1

Query: 576  WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGR--WKRGFLASFKSCTPFESEAWAI 403
            W+ P  G VK N D               +R+H GR  W  G  A     +  E+E  A+
Sbjct: 1215 WQPPSHGWVKCNTDGAWSKDLGNCGVGWVLRNHTGRLLW-LGLRALPSQQSVLETEVEAL 1273

Query: 402  LKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFEFCQFKF 226
               +  L+   Y   I ESDS   V  I N   IPS+A    ++  +  +R FE  +F+F
Sbjct: 1274 RWAVLSLSRFNYRRVIFESDSQYLVSLIQNEMDIPSLAPR--IQDIRNLLRHFEEVKFQF 1331

Query: 225  IPREINCVADCLAR 184
              RE N VAD  AR
Sbjct: 1332 TRREGNNVADRTAR 1345



>pir|H85088|H85088 hypothetical protein AT4g08830 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV25_1544599 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            25.>gb:ATT32A17_1555904 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T32A17 (ESSA project).
          Length = 947

 Score = 41.6 bits (96), Expect(2) = 6e-06
 Identities = 22/90 (24%), Positives = 37/90 (41%)
 Frame = -1

Query: 582  LCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAI 403
            + W+ P    VKLN D             G +RD  G W  GF      C+   +E W +
Sbjct: 839  VAWKPPDGEWVKLNTDGASRGNLGLATTGGVLRDGIGHWCGGFALDIGVCSAPLAELWGV 898

Query: 402  LKGIQLLASMKYSHAIIESDSAEAVEYINS 313
              G+ +    +++   +E DS   V ++ +
Sbjct: 899  YYGLYMAWERRFTRVELEVDSELVVGFLTT 928



 Score = 31.2 bits (69), Expect(2) = 6e-06
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = -2

Query: 761 IFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRAFA 630
           +FA+  W  WKWR    F G + +   ++   R  A ++S A A
Sbjct: 781 LFAIVVWWSWKWRCGYVF-GEVGKCRDRVKFFRDLAAEVSHAHA 823



>pir|C84488|C84488 hypothetical protein At2g07730 [imported] -
            Arabidopsis thaliana>gb:AC004483_1531774 Arabidopsis
            thaliana chromosome 2 clone T12J2 map mi421, complete
            sequence.
          Length = 970

 Score = 44.7 bits (104), Expect(2) = 7e-06
 Identities = 37/164 (22%), Positives = 60/164 (36%)
 Frame = -1

Query: 588  KQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAW 409
            + + W+ P +  VKL  D             GAI +  G W  GF  +  SC    +E W
Sbjct: 798  RMIRWKAPSDRWVKLTTDGASRGHQGLAAASGAILNLQGEWLGGFALNIGSCDAPLAELW 857

Query: 408  AILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFK 229
                G+ +     +    +  DS   V ++++    +     ++  C+         +  
Sbjct: 858  GAYYGLLIAWDKGFRRVELNLDSELVVGFLSTGISKAHPLSFLVRLCQGFFTRDWLVRVS 917

Query: 228  FIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAG 97
             + RE N +AD LA  A      F      P +    L EDA G
Sbjct: 918  HVYREANRLADGLANYAFFLPLGFHCFEICPEDVLLFLVEDANG 961



 Score = 27.7 bits (60), Expect(2) = 7e-06
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = -2

Query: 761 IFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRA 636
           +F++  W  WKWR    F G  K    ++  I+  AE++ +A
Sbjct: 742 LFSMGIWWAWKWRCGDVF-GERKLCRDRLKFIKDIAEEVRKA 782



>pir|C84716|C84716 hypothetical protein At2g31080 [imported] -
            Arabidopsis thaliana>gb:AC005311_1532509 Arabidopsis
            thaliana chromosome 2 clone T16B12 map m283, complete
            sequence.
          Length = 1231

 Score = 44.3 bits (103), Expect(2) = 1e-05
 Identities = 36/164 (21%), Positives = 60/164 (36%)
 Frame = -1

Query: 588  KQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAW 409
            + + W+ P +G VK+  D             GAIR+  G W  GF  +  SC    +E W
Sbjct: 1059 RMIRWQVPSDGWVKITTDGASRGNHGLAAAGGAIRNGQGEWLGGFALNIGSCAAPLAELW 1118

Query: 408  AILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFK 229
                G+ +     +    ++ D    V ++++    +     ++  C+         +  
Sbjct: 1119 GAYYGLLIAWDKGFRRVELDLDCKLVVGFLSTGVSNAHPLSFLVRLCQGFFTRDWLVRVS 1178

Query: 228  FIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAG 97
             + RE N +AD LA  A             P   R LL  D  G
Sbjct: 1179 HVYREANRLADGLANYAFTLPLGLHCFDACPEGVRLLLLADVNG 1222



 Score = 27.3 bits (59), Expect(2) = 1e-05
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = -2

Query: 761  IFAVAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISR 639
            +F +  W  WKWR    F G  K    ++  I+  AE++ R
Sbjct: 1003 LFGMGIWWAWKWRCCDVF-GERKICRDRLKFIKDMAEEVRR 1042



>gb:AE016959_1023451 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC025296_1539438 Oryza sativa
            chromosome 10 BAC OSJNBa0076F20 genomic sequence,
            complete sequence.>gb:AE017112_1753270 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 66 of 77
            of the complete sequence.
          Length = 791

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 37/138 (26%), Positives = 57/138 (41%), Gaps = 1/138 (0%)
 Frame = -1

Query: 585  QLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAW 409
            Q CWE+P++G +KLNVD               +R+  G          + C  P ESE  
Sbjct: 627  QPCWERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELR 686

Query: 408  AILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFK 229
            A ++G++L          +E+D A  V+ +  T        NI+   +  +        K
Sbjct: 687  ACVEGLKLAIHWTLLPIQVETDCASVVQLLQGTGRDFSVLANIIHEARHLLVGERVISIK 746

Query: 228  FIPREINCVADCLARLAR 175
             I R  NC++  LA  AR
Sbjct: 747  KICRSQNCISHHLANTAR 764



>gb:AE016959_1021342 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017066_1751161
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 20 of 77 of the complete sequence.
          Length = 493

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 37/138 (26%), Positives = 57/138 (41%), Gaps = 1/138 (0%)
 Frame = -1

Query: 585 QLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAW 409
           Q CWE+P++G +KLNVD               +R+  G          + C  P ESE  
Sbjct: 329 QPCWERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELR 388

Query: 408 AILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFK 229
           A ++G++L          +E+D A  V+ +  T        NI+   +  +        K
Sbjct: 389 ACVEGLKLAIHWTLLPIQVETDCASVVQLLQGTGRDFSVLANIIHEARHLLVGERVISIK 448

Query: 228 FIPREINCVADCLARLAR 175
            I R  NC++  LA  AR
Sbjct: 449 KICRSQNCISHHLANTAR 466



>gb:AB006696_1509817 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MAF19.
          Length = 657

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 37/157 (23%), Positives = 62/157 (39%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAILK 397
           W  P   +VKLN+              G +RD +G+W  G++   KS     +   AI +
Sbjct: 499 WTPP---LVKLNIQGTSNPLSDLTRSAGIVRDQSGKWVFGYIRCHKSIPEVVAGLLAIYQ 555

Query: 396 GIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIPR 217
           G++ L    +    +E+ S E +  + +          +L ACK  +     C    I +
Sbjct: 556 GLKYLWDSGFRRIHLETTSFEIINALTTKSSLFCKSKTLLGACKDMILKEWECDIYHISK 615

Query: 216 EINCVADCLARLARLQAASFQTLLDPPAETRSLLDED 106
           E N  A+ LA+ +  Q         PP      L++D
Sbjct: 616 EQNSCAEWLAKRSEEQPQELVFFEYPPRGLMDFLEKD 652



>gb:AC135559_1742523 Oryza sativa chromosome 3 BAC OSJNBa0030J19
            genomic sequence, complete sequence.
          Length = 818

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 40/163 (24%), Positives = 68/163 (41%), Gaps = 2/163 (1%)
 Frame = -1

Query: 588  KQLC-WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESE 415
            KQ C WE P EG  K+NVD               +RD  G        +   C +  ++E
Sbjct: 649  KQTCKWECPPEGFAKMNVDVVFLEESGLSSVGIIVRDCRGLVLLAAHKTLHRCNSVVQAE 708

Query: 414  AWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQ 235
            A A L+G++      +   I+E+D+A+  + +        +     +  +  ++ F+   
Sbjct: 709  ALACLEGLKTAMEWIHMPLILETDNAKVAKALKERTPIRSSWAATTDEARNAMQCFQSVH 768

Query: 234  FKFIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDED 106
               I RE N VA  LA +A    +  +  L  PA    LL+++
Sbjct: 769  VHNIKREANRVAHLLANMAMSSRSCMEWRLCAPARILDLLNQE 811



>pir|A84742|A84742 probable polygalacturonase [imported] -
           Arabidopsis thaliana>gb:AC002334_1530379 Arabidopsis
           thaliana chromosome 2 clone F25I18 map TEn5, complete
           sequence.
          Length = 664

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 40/133 (30%), Positives = 55/133 (41%), Gaps = 2/133 (1%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC--TPFESEAWAI 403
           W +P  G VK NVD               +RDHNGR++    A   +C     E E  A+
Sbjct: 503 WRRPTNGWVKCNVDGSFINGNIPGKGGWIVRDHNGRYEFAGQA-IGNCIDNALECEFQAL 561

Query: 402 LKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFI 223
           L  +Q   S  Y     E D+ E  + IN  ++      N +         FE  QF++ 
Sbjct: 562 LMAMQHCWSKGYRRICFEGDNKEMFDLINGLKM-HFGAFNWIRDILWWASKFEQTQFQWT 620

Query: 222 PREINCVADCLAR 184
            R+ N  AD LAR
Sbjct: 621 NRQNNKPADILAR 633



>pir|C84528|C84528 hypothetical protein At2g15380 [imported] -
            Arabidopsis thaliana>gb:AC006920_1534740 Arabidopsis
            thaliana chromosome 2 clone F26H6 map mi398, complete
            sequence.
          Length = 1311

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 36/103 (34%), Positives = 52/103 (50%), Gaps = 1/103 (0%)
 Frame = -1

Query: 483  DHNGR-WKRGFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTR 307
            D+N R + +G LA     +P  +EA A L  I++   +  +H    SDS   V+ +NS +
Sbjct: 1202 DNNERTFSKGSLAVAHVGSPLMAEALATLIAIRVAIGLALTHISFVSDSLTLVKALNS-K 1260

Query: 306  IPSIAGHNILEACKREVRSFEFCQFKFIPREINCVADCLARLA 178
            + S   H IL        +F  C F FIP+E N  AD LA+ A
Sbjct: 1261 LQSKELHGILHDILALSSTFTCCSFNFIPKENNRQADALAKAA 1303



>pir|H86403|H86403 hypothetical protein F28L5.12 - Arabidopsis
           thaliana>gb:AE005172_891670 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC079280_1732430 Arabidopsis thaliana
           chromosome 1 BAC F28L5 genomic sequence, complete
           sequence.
          Length = 213

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 36/132 (27%), Positives = 52/132 (39%), Gaps = 1/132 (0%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRW-KRGFLASFKSCTPFESEAWAIL 400
           W +P  G +K N D               +RD NG +   G     K     ESE  A++
Sbjct: 52  WRRPERGWIKCNFDGSFVNGDVKSKAGWVVRDSNGSYLLAGQAIGRKVDNALESEIQALI 111

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
             +Q   S  Y     E D+    + IN +++     HN +      +R FE   F +I 
Sbjct: 112 ISMQHCWSHGYKRVCFEGDNKMLFDLINGSKV-YFGVHNWIRDIHWWLRKFESIHFNWIR 170

Query: 219 REINCVADCLAR 184
           R  N  AD LA+
Sbjct: 171 RHHNTPADILAK 182



>gb:AY168997_1586429 Arabidopsis thaliana hypothetical protein
           (T1O3.17) mRNA, complete cds.
          Length = 221

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 44/141 (31%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAWAIL 400
           WE+P  G +K N D               IRD  G +K    A   +     ESE  A++
Sbjct: 63  WEQPPMGWIKCNYDGSFTYRTQQTNSGWLIRDDKGFYKGAAQAVGGTMNNALESELQALV 122

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
             +Q   S  Y   I E DS +  E +N  ++   A + I EA     R FE   F + P
Sbjct: 123 MAMQHTWSQGYRKVIFEGDSKQVEELLNRKQMHFGAFNWIREAWSWSKR-FEEVIFSWTP 181

Query: 219 REINCVADCLARLARLQAASF 157
           R  N  AD LA+    Q  SF
Sbjct: 182 RTNNQPADMLAKSHLPQDTSF 202



>pir|D84457|D84457 hypothetical protein At2g04420 [imported] -
           Arabidopsis thaliana>gb:AC006951_1534881 Arabidopsis
           thaliana chromosome 2 clone T1O3 map RNS1, complete
           sequence.>gb:AY649241_1620041 Arabidopsis thaliana
           hypothetical protein (At2g04420) gene, complete cds.
          Length = 221

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 44/141 (31%), Positives = 58/141 (41%), Gaps = 1/141 (0%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAWAIL 400
           WE+P  G +K N D               IRD  G +K    A   +     ESE  A++
Sbjct: 63  WEQPPMGWIKCNYDGSFNYRTQQTNSGWLIRDDKGFYKGAAQAVGGTMNNALESELQALV 122

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
             +Q   S  Y   I E DS +  E +N  ++   A + I EA     R FE   F + P
Sbjct: 123 MAMQHTWSQGYRKVIFEGDSKQVEELLNRKQMHFGAFNWIREAWSWSKR-FEEVIFSWTP 181

Query: 219 REINCVADCLARLARLQAASF 157
           R  N  AD LA+    Q  SF
Sbjct: 182 RTNNQPADMLAKSHLPQDTSF 202



>gb:AB026647_1517210 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJL12.
          Length = 343

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 42/158 (26%), Positives = 64/158 (40%), Gaps = 1/158 (0%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWK-RGFLASFKSCTPFESEAWAIL 400
           W++P    +K N D               +RD NG +   G      +    ESE  A++
Sbjct: 186 WQRPPSTWIKYNYDGAFNHQTRNAKAGWLMRDENGVYMGSGQAIGSTTSDSLESEFQALI 245

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
             +Q   S  Y   I E DS +  E +N+ ++ +    N +   +   + FE   FK++P
Sbjct: 246 IAMQHAWSQGYRKVIFEGDSKQVEELMNNEKL-NFGRFNWIREGRFWQKRFEEAVFKWVP 304

Query: 219 REINCVADCLARLARLQAASFQTLLDPPAETRSLLDED 106
           R  N  AD LA+       SF+     PA   S L  D
Sbjct: 305 RTNNQPADILAKHHLQPNQSFKFHYYVPAFITSTLYYD 342



>gb:AP006168_1861241 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1469H02.
          Length = 212

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 40/162 (24%), Positives = 59/162 (36%), Gaps = 4/162 (2%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAILK 397
           W KP  G +KLN D             G  RDH G +  G+       T   +E  A+ +
Sbjct: 51  WRKPEAGWIKLNFDGSSKHATKIASIGGVYRDHEGAFVLGYAERIGRATSSVAELAALRR 110

Query: 396 GIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRS----FEFCQFK 229
           G++L+    +     E DS   V+ +      ++     L  C RE+ +     +     
Sbjct: 111 GLELVVRNGWRRVWAEGDSKTVVDVVCDR--ANVRSEEDLRQC-REIAALLPLIDDMAVS 167

Query: 228 FIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDA 103
            + R  N VA   ARL             PP E    L +DA
Sbjct: 168 HVYRSGNKVAHGFARLGHKAVRPRVWRAAPPEEVLRFLQQDA 209



>gb:AE005173_894384 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC008113_1536538 Genomic sequence
            for Arabidopsis thaliana BAC F12A21 from chromosome I,
            complete sequence.
          Length = 803

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 33/131 (25%), Positives = 54/131 (41%)
 Frame = -1

Query: 489  IRDHNGRWKRGFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST 310
            IRD  G W  GF  +   C+   +E W +  G  L  +   +   +E DS   V ++ + 
Sbjct: 664  IRDGAGNWCGGFALNIGRCSAPLAELWGVYYGFYLAWTKALTRVELEVDSELVVGFLKTG 723

Query: 309  RIPSIAGHNILEACKREVRSFEFCQFKFIPREINCVADCLARLARLQAASFQTLLDPPAE 130
                     ++  C   +      +   + RE N +AD LA  A      F +L+D P +
Sbjct: 724  IGDQHPLSFLVRLCHGLLSKDWIVRITHVYREANRLADGLANYAFSLPLGFHSLIDVPDD 783

Query: 129  TRSLLDEDAAG 97
               +L ED+ G
Sbjct: 784  LEVILHEDSLG 794



>gb:AP003770_1833342 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0550B04.>gb:AP003771_1833354 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0622F03.
          Length = 217

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 51/173 (29%), Positives = 67/173 (38%), Gaps = 6/173 (3%)
 Frame = -1

Query: 576 WEKPREGIVKLNVD-XXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAIL 400
           W  PR G VKLN D              G IRD +GR    F       T    EA A++
Sbjct: 44  WTPPRHGWVKLNFDGSVHNDGSGRASIGGVIRDDHGRVLLAFAERTPHATIGVVEARALI 103

Query: 399 KGIQLLASMKYS-HAIIESDSAEAVEYI----NSTRIPSIAGHNILEACKREVRSFEFCQ 235
           +G+QL     ++   ++E D    V  +      TRIP     +IL      + SF  C+
Sbjct: 104 RGLQLALDHGWNDRLLVEGDDLTLVRLLRCESTHTRIPPAMLDDILWL----LDSFRVCE 159

Query: 234 FKFIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAGFPVWRNM 76
            +   RE N VAD L   A  +AA    L  P              FPVW  +
Sbjct: 160 VQHAYREGNQVADALCHEA-YKAAPAARLWTPGTA--------MVPFPVWEKL 203



>gb:AE016959_1022705 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017097_1752524
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 51 of 77 of the complete sequence.
          Length = 155

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 26/91 (28%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAWAIL 400
           WE P EG+ K+N+D               +RD  G            C +  ++EA A L
Sbjct: 30  WEPPPEGVAKVNIDAGFRKETGDACAGIIVRDCRGLVLLAACKKLPRCSSATQAEALACL 89

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTR 307
           +G++L  +  +   I+ESD+A+ V  +N T+
Sbjct: 90  EGVRLATNWIHMPIILESDNADVVAGLNITQ 120



>pir|G84512|G84512 hypothetical protein At2g13980 [imported] -
           Arabidopsis thaliana>gb:AC006528_1534354 Arabidopsis
           thaliana chromosome 2 clone F9B22 map mi398, complete
           sequence.
          Length = 171

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 38/137 (27%), Positives = 57/137 (41%), Gaps = 5/137 (3%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNG---RWKRGFLASFKSCTPFESEAWA 406
           W+ P +  +K N D               IR+H+G    W  G L    + TP E+E  A
Sbjct: 13  WKAPPDTHIKCNYDAGFNVQNLDSTARWIIRNHDGIAQHW--GSLQLDNTSTPLEAETKA 70

Query: 405 ILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGH--NILEACKREVRSFEFCQF 232
           +L  +Q      Y   I+E D       ++ +   S   H  N+L+  +   + F   QF
Sbjct: 71  LLAALQQTWIRGYLRVIMEGDCETLTNLVSGS---SSHNHLANLLDDIRIWAKKFSNVQF 127

Query: 231 KFIPREINCVADCLARL 181
            F+ R  N VA  LA+L
Sbjct: 128 SFVRRGGNKVAHELAKL 144



>gb:AP003766_1833202 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0009H10.
          Length = 240

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 24/86 (27%), Positives = 37/86 (43%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAILK 397
           W KP EG +KLN D             G  RDH+G +  G+     + T   +E  A+ +
Sbjct: 79  WRKPEEGWMKLNFDGSSKHSTGIASIGGVYRDHDGAFLLGYAERIGTATSSVAELAALRR 138

Query: 396 GIQLLASMKYSHAIIESDSAEAVEYI 319
           G++L     +     E DS   V+ +
Sbjct: 139 GLELAVRNGWRRVWAEGDSKAVVDVV 164



>gb:AC087425_1734049 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0676G05, complete sequence.>gb:AC087551_1734079
            Oryza sativa (japonica cultivar-group) chromosome 5 clone
            P0431G05, complete sequence.
          Length = 1936

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 34/140 (24%), Positives = 56/140 (40%), Gaps = 1/140 (0%)
 Frame = -1

Query: 576  WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCT-PFESEAWAIL 400
            WE+PR G +KLNVD               +R+  G        S  SC+ P E+E  A +
Sbjct: 1777 WERPRNGWMKLNVDGSFDINSEKGGIGMILRNCLGNVIFSSCRSLDSCSGPLEAELHACV 1836

Query: 399  KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
            +G+ L          +E+D +  ++ +N          NI +  K  +          + 
Sbjct: 1837 EGLHLALHWTLLPIQVETDCSSVIQLLNHPDKDRSVLANIAQEAKSLMAGDRQIAISKVQ 1896

Query: 219  REINCVADCLARLARLQAAS 160
            R  N ++  LA  AR ++ S
Sbjct: 1897 RSQNVISHFLANKARAESLS 1916



>gb:AB026651_1517269 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQD19.
          Length = 228

 Score = 42.7 bits (99), Expect(2) = 0.002
 Identities = 37/143 (25%), Positives = 61/143 (42%), Gaps = 3/143 (2%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKS-CTPFESEAWAIL 400
           W+KP  G +K N D               IRD NG +K    A+  +  + FE+E  +++
Sbjct: 69  WQKPHMGWIKCNYDGSFVNRVRGSTAAWIIRDDNGVFKGAAQATGATVSSAFEAECQSLI 128

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYIN--STRIPSIAGHNILEACKREVRSFEFCQFKF 226
             +Q L    +   I+E D    V  +N   +R  +I   N +   K     F+  +F +
Sbjct: 129 LTMQQLWIRGFRKVILEGDCKLLVNVLNGRGSRFDAI---NWIHEIKVWRNKFDAIKFTW 185

Query: 225 IPREINCVADCLARLARLQAASF 157
             R  N  AD LA+  +   +S+
Sbjct: 186 SHRSTNQPADILAKNQKHALSSY 208



 Score = 21.2 bits (43), Expect(2) = 0.002
 Identities = 10/32 (31%), Positives = 15/32 (46%)
 Frame = -2

Query: 743 WCIWKWRNEAXFNGTIKELNSKILSIRSQAED 648
           W IWK RN+  F     +    I    ++AE+
Sbjct: 11  WRIWKSRNKLVFQRKQNDWWRDIRDATNEAEE 42



>gb:AE005173_892596 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC022314_1538870 Genomic sequence
           for Arabidopsis thaliana BAC F9C16 from chromosome I,
           complete sequence.
          Length = 196

 Score = 39.3 bits (90), Expect(2) = 0.004
 Identities = 34/160 (21%), Positives = 49/160 (30%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAILK 397
           W  P EG +KLN D             G +RD  G W  GF  +    T   +E W + +
Sbjct: 58  WSVPSEGWLKLNTDGASRGNPTLSTAGGVLRDREGEWLGGFSLNIGRRTAPVAELWGVSE 117

Query: 396 GIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIPR 217
              L   ++  H  +  D    + ++                                 R
Sbjct: 118 RHPLSFLVRLCHGFLLKDWIVRISHVY--------------------------------R 145

Query: 216 EINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAG 97
           E N +AD LA  A L        +  P     L  +D  G
Sbjct: 146 EANRLADGLANYAFLLPIGIHVFVSVPDVVEPLFSDDVIG 185



 Score = 23.9 bits (50), Expect(2) = 0.004
 Identities = 12/45 (26%), Positives = 22/45 (48%)
 Frame = -2

Query: 752 VAAWCIWKWRNEAXFNGTIKELNSKILSIRSQAEDISRAFARERG 618
           +A W  WKWR +  F+   K    +   I+  A++++ A  +  G
Sbjct: 1   MAVWWAWKWRCDNEFDKRGK-CRDRTRLIKEAAKEVTLATNKMNG 44



>pir|T05150|T05150 hypothetical protein F18E5.40 - Arabidopsis
           thaliana>gb:ATCHRIV55_1545979 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 55.>gb:ATF18E5_1549114
           Arabidopsis thaliana DNA chromosome 4, BAC clone F18E5
           (ESSAII project).>gb:ATT6K22_1556407 Arabidopsis
           thaliana DNA chromosome 4, BAC clone T6K22 (ESSAII
           project).
          Length = 229

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 40/169 (23%), Positives = 68/169 (40%), Gaps = 1/169 (0%)
 Frame = -1

Query: 585 QLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWA 406
           ++ W+KP  G +KLN D             G  R+H   +  G+  S    T   +E  A
Sbjct: 60  KVVWKKPENGRIKLNFD-GSRGREGQASIGGVFRNHKAEFLLGYSESIGEATSTMAEFAA 118

Query: 405 ILKGIQLLASMKYSHAIIESDSAEAVEYINST-RIPSIAGHNILEACKREVRSFEFCQFK 229
           + +G++L      +   +E D+   ++ I+   R+     +  +   K  +     C   
Sbjct: 119 LKRGLELALENGLTDLWLEGDAKIIMDIISRRGRLRCEKTNKHVNYIKVVMPELNNCVLS 178

Query: 228 FIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDEDAAGFPVWR 82
            + RE N VAD LA+L           + PP     ++ +DA G  V R
Sbjct: 179 HVYREGNRVADKLAKLGHQFQDPKVWRVQPPEIVLPIMHDDAKGKIVLR 227



>gb:OSJN00139_1695547 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OJ991113_30, complete sequence.
          Length = 541

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 36/128 (28%), Positives = 54/128 (42%), Gaps = 1/128 (0%)
 Frame = -1

Query: 558 GIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAWAILKGIQLL 382
           G VK+NVD               IRDH G            C +  E+EA A  +G+ L 
Sbjct: 384 GWVKVNVDGSFIQSSEPASAGFVIRDHTGSVLLTSWRIISHCGSAEEAEATACWEGVNLA 443

Query: 381 ASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIPREINCV 202
           A       I+E+D A  V  + S+        ++L + K  +++    + + I RE N V
Sbjct: 444 AEWVKKPLILETDCANLVSMLTSSGFDRAQLCHVLRSIKLLLQALPDFRVQRIRRECNRV 503

Query: 201 ADCLARLA 178
           A  LA+ A
Sbjct: 504 AHDLAKFA 511



>pir|T00619|T00619 hypothetical protein T27I1.2 - Arabidopsis
           thaliana>gb:AE005172_890003 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC004122_1531386 Arabidopsis thaliana
           chromosome I BAC T27I1 genomic sequence, complete
           sequence.
          Length = 374

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 4/89 (4%)
 Frame = -1

Query: 432 TPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVR 253
           +P  +EAWAI   +     ++ S  ++ SDS   V+ +NS         N +     E+R
Sbjct: 203 SPLAAEAWAIKSAMLHALQLERSDLLVLSDSKSIVDALNSN-----VSLNEIFGLLVEIR 257

Query: 252 S----FEFCQFKFIPREINCVADCLARLA 178
           S    F    F+FIPR +N +AD  A+L+
Sbjct: 258 SIRNRFRSISFQFIPRLVNSIADAAAKLS 286



>gb:AC099401_1737150 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1134F05, complete sequence.
          Length = 210

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 25/89 (28%), Positives = 38/89 (42%), Gaps = 2/89 (2%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASF--KSCTPFESEAWAI 403
           W KP  G +KLN D             GA RDH G +  G+         + F +E  A+
Sbjct: 47  WRKPEVGWMKLNFDGSRNDATGAASIGGAFRDHEGAFVAGYAERMIVGGASSFTAELAAL 106

Query: 402 LKGIQLLASMKYSHAIIESDSAEAVEYIN 316
            +G++L A   +     E DS   V+ ++
Sbjct: 107 RRGLELAARYGWRRVWAEGDSRAVVDVVH 135



>gb:AC092781_1735739 Oryza sativa chromosome 3 BAC OSJNBb0094O03
           genomic sequence, complete sequence.
          Length = 208

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 26/102 (25%), Positives = 46/102 (45%)
 Frame = -1

Query: 411 WAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQF 232
           WA L+G+++     +   IIE D+   V  +N+T         I+   +  ++     Q 
Sbjct: 20  WACLEGVRIATEWVHMPMIIELDNGNVVADLNTTSASRAEWGGIISEVRAAMQCLVQVQV 79

Query: 231 KFIPREINCVADCLARLARLQAASFQTLLDPPAETRSLLDED 106
             I R+ N +A  LA++A       +  L  PAE   LL+++
Sbjct: 80  HNIKRDSNRIAHALAQMALRSGIDAEWKLSAPAEILDLLNQE 121



>gb:AE016959_1023432 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC068924_1540516 Oryza sativa
            chromosome 10 BAC OSJNBa0026L12 genomic sequence,
            complete sequence.>gb:AE017112_1753251 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 66 of 77
            of the complete sequence.
          Length = 1382

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 36/161 (22%), Positives = 62/161 (38%), Gaps = 2/161 (1%)
 Frame = -1

Query: 576  WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCT-PFESEAWAIL 400
            W+ P   +  +N D               IRD+ G+              P  +EA AI 
Sbjct: 1224 WQPPPASVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIR 1283

Query: 399  KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
            + + L       H ++ SD    +  I ++         ++E  K+   +F  C F  + 
Sbjct: 1284 RALGLAKEEGLEHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVN 1343

Query: 219  REINCVADCLARLARLQAAS-FQTLLDPPAETRSLLDEDAA 100
            R  N  A  LAR A L   + +++++  P   R +L +D A
Sbjct: 1344 RLSNLAAHSLARNAELSTCTVYRSVI--PDYIRDILCDDVA 1382



>gb:AC027033_1539761 Arabidopsis thaliana chromosome 1 BAC F21N10
           genomic sequence, complete sequence.
          Length = 256

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 31/130 (23%), Positives = 50/130 (38%)
 Frame = -1

Query: 486 RDHNGRWKRGFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTR 307
           R+H G W  GF  S   C+  ++E W +  G+ +      +   +E DS   V ++ +  
Sbjct: 37  REHQGNWCGGFSVSIGICSAPQAELWGVYYGLYIAWEKWVTRVELEVDSEIVVGFLKTGI 96

Query: 306 IPSIAGHNILEACKREVRSFEFCQFKFIPREINCVADCLARLARLQAASFQTLLDPPAET 127
             S     +   C   +      +   + RE N +AD LA  A      F      P   
Sbjct: 97  GDSHPLSFLARLCYGFISKDWIVRISHVYREANRLADGLANYAFTLPLGFHFFHSSPDVV 156

Query: 126 RSLLDEDAAG 97
            S+  ED +G
Sbjct: 157 DSVRLEDTSG 166



>gb:AC149288_1744910 Solanum demissum chromosome 5 clone PGEC446J10
           map MAP_LOC, complete sequence.
          Length = 722

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 34/138 (24%), Positives = 53/138 (38%)
 Frame = -1

Query: 591 WKQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEA 412
           WK + W  P    VK+N D               +RDH  R    F       +   +EA
Sbjct: 361 WKIVHWNTPNINCVKINTD--GSFSSGNAGLGWIVRDHTRRMIMAFSIPSSCSSNNLAEA 418

Query: 411 WAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQF 232
            A   GI       + +  +E DS   V+ + + +  ++    ++E   + V     C+ 
Sbjct: 419 LAARFGILWCLQQGFHNCYLELDSKLVVDMVRNGQATNLKIKGVVEDIIQVVAKMN-CEV 477

Query: 231 KFIPREINCVADCLARLA 178
               RE N VAD LA+ A
Sbjct: 478 NHCYREANQVADALAKHA 495



>gb:AC145388_1744443 Oryza sativa chromosome 3 BAC OSJNBb0036M02
            genomic sequence, complete sequence.
          Length = 855

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 36/161 (22%), Positives = 62/161 (38%), Gaps = 2/161 (1%)
 Frame = -1

Query: 576  WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCT-PFESEAWAIL 400
            W+    G+  +N D               IRD+ G+              P  +EA AI 
Sbjct: 697  WQPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIR 756

Query: 399  KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
            + + L       H ++ SD    +  I ++         ++E  K+   +F  C F  + 
Sbjct: 757  RALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVN 816

Query: 219  REINCVADCLARLARLQAAS-FQTLLDPPAETRSLLDEDAA 100
            R  N  A  LAR A L   + +++++  P   R +L +D A
Sbjct: 817  RLSNLAAHSLARNAELSTCTVYRSVI--PDYIRDILCDDVA 855



>gb:AC133930_1741619 Oryza sativa chromosome 3 BAC OSJNBa0039O18
           genomic sequence, complete sequence.
          Length = 404

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 36/161 (22%), Positives = 62/161 (38%), Gaps = 2/161 (1%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCT-PFESEAWAIL 400
           W+    G+  +N D               IRD+ G+              P  +EA AI 
Sbjct: 246 WQPLPAGVWMINSDAAIFSSSRTMGVGALIRDNTGKCLVACSEMISDVVLPELAEALAIR 305

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIP 220
           + + L       H ++ SD    +  I ++         ++E  K+   +F  C F  + 
Sbjct: 306 RALGLAKEEGLQHIVMASDCLTVIRRIQTSGRDRSGVGCVIEDIKKLASTFVLCSFMHVN 365

Query: 219 REINCVADCLARLARLQAAS-FQTLLDPPAETRSLLDEDAA 100
           R  N  A  LAR A L   + +++++  P   R +L +D A
Sbjct: 366 RLSNLAAHSLARNAELSTCTVYRSVI--PDYIRDILCDDVA 404



>gb:AY730337_1625421 Solanum tuberosum strain P6/210 clone BAC
           BA27c1, complete sequence.
          Length = 1095

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 34/138 (24%), Positives = 53/138 (38%)
 Frame = -1

Query: 591 WKQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEA 412
           WK + W  P    VK+N D               +RDH  R    F       +   +EA
Sbjct: 539 WKIVHWNTPNINCVKINTD--GSFSSGNAGLGWIVRDHTRRMIMAFSIPSSCSSNNLAEA 596

Query: 411 WAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQF 232
            A   GI       + +  +E DS   V+ + + +  ++    ++E   + V     C+ 
Sbjct: 597 LAARFGILWCLQQGFHNCYLELDSKLVVDMVRNGQATNLKIKGVVEDIIQVVAKMN-CEV 655

Query: 231 KFIPREINCVADCLARLA 178
               RE N VAD LA+ A
Sbjct: 656 NHCYREANQVADALAKHA 673



>gb:AY333186_1600079 Oryza sativa (japonica cultivar-group) bZIP-like
            protein mRNA, complete cds.
          Length = 2367

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 1/90 (1%)
 Frame = -1

Query: 585  QLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAW 409
            Q CWE+P++G +KLNVD               +R+  G          + C  P ESE  
Sbjct: 1951 QPCWERPKDGWMKLNVDGSFDASSGKGGLGMILRNSAGDIIFTSCKPLERCNNPLESELR 2010

Query: 408  AILKGIQLLASMKYSHAIIESDSAEAVEYI 319
            A ++G++L          +E+D A  V+ +
Sbjct: 2011 ACVEGLKLAIHWTLLPIQVETDCASVVQLL 2040



>pir|T02320|T02320 hypothetical protein At2g34320 [imported] -
           Arabidopsis thaliana>gb:AC004481_1531733 Arabidopsis
           thaliana chromosome 2 clone F13P17 map ve016, complete
           sequence.
          Length = 292

 Score = 39.7 bits (91), Expect = 0.068
 Identities = 37/134 (27%), Positives = 58/134 (43%), Gaps = 3/134 (2%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGR--WKRGFLASFKSCTPFESEAWAI 403
           W+ P    VK N D               +R+ +G   W  G  A  ++    E+E  A+
Sbjct: 137 WKAPPYQWVKCNTDATWQLENPRCGIGWILRNESGGVLWM-GARALPRTKNVLEAELEAL 195

Query: 402 LKGIQLLASMKYSHAIIESDSAEAVEYINSTRI-PSIAGHNILEACKREVRSFEFCQFKF 226
              +  ++   Y   I ESD+   V  +NS    P++     LE  ++ +  FE  +F+F
Sbjct: 196 RWAVLTMSRFNYKRIIFESDAQALVNLLNSDDFWPTL--QPALEDIQQLLHHFEEVKFEF 253

Query: 225 IPREINCVADCLAR 184
            PR  N VAD +AR
Sbjct: 254 TPRGGNKVADRIAR 267



>gb:AC135502_1742484 Oryza sativa chromosome 3 BAC OSJNBb0085A04
           genomic sequence, complete sequence.
          Length = 174

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 26/81 (32%), Positives = 39/81 (48%)
 Frame = -1

Query: 423 ESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFE 244
           ++EA A L+GIQL         I+ESD+A  V  +N+T +       I+   K  +    
Sbjct: 2   QAEALACLEGIQLATEWVNMPLILESDNASVVAELNATNVSRADWSGIILDVKAAMLCLV 61

Query: 243 FCQFKFIPREINCVADCLARL 181
             Q   I R+ N +A  LA+L
Sbjct: 62  QVQVHKIKRDSNKIAHALAQL 82



>pir|B84497|B84497 hypothetical protein At2g11240 [imported] -
            Arabidopsis thaliana>gb:AC006136_1533503 Arabidopsis
            thaliana chromosome 2 clone T13H18 map GPC6, complete
            sequence.
          Length = 1044

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 27/87 (31%), Positives = 43/87 (49%)
 Frame = -1

Query: 432  TPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVR 253
            +P  ++A A+   IQ  A + +   ++ SDS + V+ +N    P +  H I+        
Sbjct: 950  SPLLAKASALSLAIQHAADLGFKKLVVASDSQQLVKVLNGEPHP-MELHGIVFDISVLSL 1008

Query: 252  SFEFCQFKFIPREINCVADCLARLARL 172
            +FE   F F+ RE N  AD LA+ A L
Sbjct: 1009 NFEENSFSFVKRENNSKADALAKAALL 1035



>gb:AE016959_1022853 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017100_1752672
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 54 of 77 of the complete sequence.
          Length = 325

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 27/94 (28%), Positives = 44/94 (46%), Gaps = 3/94 (3%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSC-TPFESEAWAIL 400
           W  P EG  K+NVD               I D  G        + KSC T  ++EA A L
Sbjct: 218 WHAPPEGSAKVNVDAGFIEDTGVSAAGIIITDCRGLVLFAAQKTLKSCATAVQAEALACL 277

Query: 399 KGIQLLASMKYSH--AIIESDSAEAVEYINSTRI 304
           +G++  A+M++ H   I+E+D+ E  + ++   +
Sbjct: 278 EGLR--AAMEWIHMPIILETDNIEVFKALSQQEL 309



>pir|T04719|T04719 hypothetical protein F19F18.110 - Arabidopsis
           thaliana>gb:ATCHRIV87_1547716 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           87.>gb:ATF19F18_1549302 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19F18 (ESSA project).
          Length = 132

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 27/87 (31%), Positives = 41/87 (47%)
 Frame = -1

Query: 420 SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEF 241
           +EA A+L  +Q    + ++   I SDS + ++ I S R P    H IL           F
Sbjct: 37  AEALAMLLALQQAKDLGFTSLSIASDSQQLIKAITS-RTPLTELHGILHDILLLASEIGF 95

Query: 240 CQFKFIPREINCVADCLARLARLQAAS 160
            +F  IPR  N +AD L++L     +S
Sbjct: 96  VRFHSIPRNENRLADALSKLGLASISS 122



>gb:AC084404_1733566 Oryza sativa chromosome 3 BAC OSJNBa0026A15
           genomic sequence, complete sequence.
          Length = 674

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 37/130 (28%), Positives = 58/130 (44%), Gaps = 9/130 (6%)
 Frame = -1

Query: 456 FLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNIL 277
           F+A +   T   +E   +L G++  A M   H ++  DS   V   N            +
Sbjct: 201 FIAEWTPATNNMAEYEGLLAGLRAAARMGIRHLLVLGDSQLVV---NQVPKEYQCTDQQM 257

Query: 276 EACKREVR----SFEFCQFKFIPREINCVADCLARLARLQA----ASF-QTLLDPPAETR 124
           EA  REVR    +F+  + + +P+  N VAD L+R+A  +A     +F + L  P A   
Sbjct: 258 EAYVREVRRMERNFDGLELRHVPQRDNTVADELSRVASARAPLPPGTFEERLAQPSARPS 317

Query: 123 SLLDEDAAGF 94
            L D + A F
Sbjct: 318 PLRDPNDAPF 327



>gb:AP002033_1821517 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone: F1M23.
          Length = 228

 Score = 37.0 bits (84), Expect = 0.44
 Identities = 22/91 (24%), Positives = 38/91 (41%), Gaps = 1/91 (1%)
 Frame = -1

Query: 576 WEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCT-PFESEAWAIL 400
           W +P+E  VK N D               IRD NG ++    +  + C+   E+E  A++
Sbjct: 105 WTRPKEDFVKCNFDCKFSKNNNVSQAGWIIRDSNGVFQAAGRSKGQHCSMSMEAELQALV 164

Query: 399 KGIQLLASMKYSHAIIESDSAEAVEYINSTR 307
             +Q + S  Y   I E D+     ++   +
Sbjct: 165 MAMQHVWSKGYKKVIFEGDNLRLSSFLRKIK 195



>gb:AC112514_1738887 Oryza sativa chromosome 10 clone OSJNAb0023M11,
           complete sequence.
          Length = 281

 Score = 37.0 bits (84), Expect = 0.44
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 3/94 (3%)
 Frame = -1

Query: 447 SFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEAC 268
           S  + TP  +EA  +   +Q+   ++    I  SD++E V  + +       GH  L   
Sbjct: 140 SLNAGTPLLAEAEGLFLAMQIARHLQLQDPIFLSDNSEIVNVVQNEDYIQNPGHWSLRPI 199

Query: 267 KREVRSF---EFCQFKFIPREINCVADCLARLAR 175
              +++F   +  +  +I RE+N VAD LA+ AR
Sbjct: 200 LSRIKNFLQDQQVRIIWISRELNKVADGLAKSAR 233



>gb:AE016959_1022030 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC092749_1735619 Genomic
            sequence for Oryza sativa (japonica cultivar-group)
            cultivar Nipponbare clone OSJNBb0023M11, from chromosome
            10, complete sequence.>gb:AE017081_1751849 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 35 of 77
            of the complete sequence.
          Length = 1739

 Score = 37.0 bits (84), Expect = 0.44
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 3/94 (3%)
 Frame = -1

Query: 447  SFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEAC 268
            S  + TP  +EA  +   +Q+   ++    I  SD++E V  + +       GH  L   
Sbjct: 1598 SLNAGTPLLAEAEGLFLAMQIARHLQLQDPIFLSDNSEIVNVVQNEDYIQNPGHWSLRPI 1657

Query: 267  KREVRSF---EFCQFKFIPREINCVADCLARLAR 175
               +++F   +  +  +I RE+N VAD LA+ AR
Sbjct: 1658 LSRIKNFLQDQQVRIIWISRELNKVADGLAKSAR 1691



>gb:OSJN00216_1696882 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0076A22, complete sequence.
          Length = 693

 Score = 36.6 bits (83), Expect = 0.58
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 3/94 (3%)
 Frame = -1

Query: 447 SFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEAC 268
           S  + TP  +EA  +   +Q+   ++    I  SD++E V  + +       GH  L   
Sbjct: 554 SLNAGTPLLAEAEGLFLAMQIARHLQLQDPIFLSDNSEIVNAVQNEDYIQNPGHWSLRPI 613

Query: 267 KREVRSF---EFCQFKFIPREINCVADCLARLAR 175
              +++F   +  +  +I RE+N VAD LA+ AR
Sbjct: 614 LSRIKNFLQDQQVRIIWISRELNKVADGLAKSAR 647



>gb:AC151801_1745090 Solanum demissum chromosome 11 clone PGEC591C22
           map MAP_LOC, complete sequence.
          Length = 1784

 Score = 36.2 bits (82), Expect = 0.76
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 5/104 (4%)
 Frame = -1

Query: 435 CTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINS---TRIPSIAG--HNILEA 271
           CT   SE  A + G++L A M     ++  DS   V  I     TR P +    H + + 
Sbjct: 321 CTNNMSEYEACILGLRLAADMGIQELLVLGDSDLLVHQIQGEWETRDPKLIPYQHCLQDL 380

Query: 270 CKREVRSFEFCQFKFIPREINCVADCLARLARLQAASFQTLLDP 139
           C+R    F   +F+ I R  N +AD LA L+ +     +  +DP
Sbjct: 381 CRR----FVSIKFRHISRVHNEIADALATLSSMLQHPDEAHIDP 420



>pir|E86396|E86396 T2P11.14 protein - Arabidopsis
           thaliana>gb:AE005172_891572 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC005508_1532802 Arabidopsis thaliana
           chromosome I BAC T2P11 genomic sequence, complete
           sequence.
          Length = 158

 Score = 36.2 bits (82), Expect = 0.76
 Identities = 31/132 (23%), Positives = 50/132 (37%)
 Frame = -1

Query: 492 AIRDHNGRWKRGFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINS 313
           A+RD  G W+  F  +   CT   +E W +  G+ +      +   +E DS     ++ +
Sbjct: 18  ALRDEYGDWRGSFALNLGRCTAPLAELWGVYYGLVIAWEKGITRLELEVDSKLVAGFLTT 77

Query: 312 TRIPSIAGHNILEACKREVRSFEFCQFKFIPREINCVADCLARLARLQAASFQTLLDPPA 133
               S     ++  C          +   + RE N  AD LA  A      F +      
Sbjct: 78  GIEDSHLLSFLVRLCYGFSSKDWIVRVSHVYREANRFADELANYAFSLLLGFLSFDSGLP 137

Query: 132 ETRSLLDEDAAG 97
              S++ EDAAG
Sbjct: 138 FVDSIMREDAAG 149



>pir|T14595|T14595 polyprotein - maize retrotransposon
            Cinful-1>gb:AF049110_1764010 Zea mays retrotransposon
            Cinful-1, complete sequence.
          Length = 1317

 Score = 36.2 bits (82), Expect = 0.76
 Identities = 29/88 (32%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -1

Query: 438  SCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYIN-STRIPSIAGHNILEACKR 262
            SCT   +E  A+L G++ L +M    A++++DS     +I+ S +         L+  +R
Sbjct: 784  SCTNNIAEYEALLLGLRKLKAMGIRRAVLKTDSQVVSGHIDKSCKAKDPKLEKYLDMVRR 843

Query: 261  EVRSFEFCQFKFIPREINCVADCLARLA 178
               SFE    K IPR  N  AD LA+ A
Sbjct: 844  VEASFEGFSVKNIPRGQNEHADLLAKSA 871



>pir|C84487|C84487 hypothetical protein At2g07650 [imported] -
           Arabidopsis thaliana>gb:AC007730_1536161 Arabidopsis
           thaliana chromosome 2 BAC T5M2 genomic sequence,
           complete sequence.
          Length = 732

 Score = 36.2 bits (82), Expect = 0.76
 Identities = 19/47 (40%), Positives = 23/47 (48%)
 Frame = -1

Query: 588 KQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLA 448
           +Q+ W KP EG VKLN D             GA+RD   R   GFL+
Sbjct: 660 RQVSWRKPNEGWVKLNTDGASHGNPGEATAGGALRDEEVRLCYGFLS 706



>gb:BC034328_1981238 Homo sapiens, clone IMAGE:4780414, mRNA,
           partial cds.
          Length = 162

 Score = 35.8 bits (81), Expect = 0.99
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = +2

Query: 65  GELHMLRQTGKPAASSSKRDLVSAGGSSKVWKLAACNLARRARQSATQLISRG 223
           G+ H   + G+PA  +S+R  VS GGS + ++ AA +  RR R+S T L + G
Sbjct: 52  GDCH---KPGQPAPLASRRGGVSTGGSGRAFRPAALSGRRRRRRSQTGLSAAG 101



>gb:OSJN00067_1694235 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0056F09, complete sequence.
          Length = 1751

 Score = 35.8 bits (81), Expect = 0.99
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 8/118 (6%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST---RIPSIAGHNILEACKREVRS 250
            +E   +L G+++ A +   H ++  DS   V  ++       P +  +  +   +R  R 
Sbjct: 1377 AEYEGLLAGLRVAAGLGIRHLLVLGDSQLVVNQVSKEYQCSDPQMDAY--VRQVRRMERH 1434

Query: 249  FEFCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
            F+  + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1435 FDGIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1492



>gb:OSJN00055_1694002 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0017B10, complete sequence.
          Length = 1814

 Score = 35.8 bits (81), Expect = 0.99
 Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1343 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1402

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA G P
Sbjct: 1403 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPGRP 1458



>gb:OSJN00264_1190996 Oryza sativa (japonica cultivar-group)
            chromosome 4 clone OSJNBa0094P09, *** SEQUENCING IN
            PROGRESS ***, 7 ordered pieces.
          Length = 2027

 Score = 35.8 bits (81), Expect = 0.99
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +   H ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRHLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AJ621745_2501289 Gallus gallus partial FACL6 gene for fatty acid
           Coenzyme A ligase, long chain 6, exons 10-20, BAC
           bCHORI92M14 clone, contig 6.
          Length = 402

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = +2

Query: 335 SAESLSIIAWEYFIDASSWIPLRIAQASDSNGVQDLKDARKPLFHLPLWSLIAP 496
           ++E+L    W +  D   W+P+RI  +   NG   + D +K +F L     IAP
Sbjct: 221 TSEALDQEGWLHTGDIGKWLPVRIQMSGACNGTLKIIDRKKHIFKLAQGEYIAP 274



>gb:AP002816_1822841 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0695A04.>gb:AP002836_1822975 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0512G09.
          Length = 250

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 29/98 (29%), Positives = 37/98 (37%), Gaps = 1/98 (1%)
 Frame = -1

Query: 627 RKRSPFN*KDMIWKQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLA 448
           R  SP N +      + W  P  G VK NVD               IRDH G        
Sbjct: 104 RLSSPDNHERNHTTTMGWTPPPMGWVKANVDGSFIQCSEAASAGIVIRDHTGSVLLTSWR 163

Query: 447 SFKSC-TPFESEAWAILKGIQLLASMKYSHAIIESDSA 337
               C +  E+EA A  +G+ L A       I+E+D A
Sbjct: 164 IISHCGSAEEAEATACWEGVNLAAEWVKKPLILETDCA 201



>gb:AC130730_1740946 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0681D04, complete sequence.
          Length = 1970

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R   +     +   +R  R F+
Sbjct: 1421 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCEEYRCSDLQMDAYVRQVRRMERHFD 1480

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1481 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1536



>gb:AC084406_1733633 Oryza sativa chromosome 3 BAC OSJNBa0067E01
            genomic sequence, complete sequence.
          Length = 1901

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST-RIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  ++   R         +   +R  R F+
Sbjct: 1352 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVSKEYRCSDPQMDAYVRQVRRMERHFD 1411

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1412 LIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1467



>gb:AE016959_1022197 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC107314_1738427 Oryza sativa
            (japonica cultivar-group) cultivar Nipponbare clone
            OJ1208D02 from chromosome 10, complete
            sequence.>gb:AE017084_1752016 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 38 of 77 of the
            complete sequence.
          Length = 1783

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1270 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKDYRCSDPQMDAYVRQVRRMERHFD 1329

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L+ P A    L + DA   P
Sbjct: 1330 GIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLVQPSARPNPLGETDAPERP 1385



>pir|I40894|I40894 3-deoxy-manno-octulosonate cytidylyltransferase
           (EC 2.7.7.38) 1 [similarity] - Chlamydia trachomatis
           (strain Apa-2 and strain TW-5/OT)>gb:CTGSEAA_119529
           C.trachomatis gseA gene.>gb:CTGSEAB_119530 C.trachomatis
           gseA gene.>gb:CTGSEAC_119531 C.trachomatis gseA gene.
          Length = 431

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 22/73 (30%), Positives = 33/73 (45%)
 Frame = -1

Query: 474 GRWKRGFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSI 295
           G W +G  ASF+       +A  +LK I                SA  + ++  T  PS+
Sbjct: 296 GLWSQG--ASFRQYNSLIMDAMGVLKDIY---------------SAADIAFVGGTFDPSV 338

Query: 294 AGHNILEACKREV 256
            GHN+LE  ++EV
Sbjct: 339 GGHNLLEPLQKEV 351



>sp|Q57440|KDTA_CHLTR 3-deoxy-D-manno-octulosonic-acid transferase
           (EC 2.-.-.-) (KDO transferase).>pir|I40897|I40897
           3-deoxy-manno-octulosonate cytidylyltransferase (EC
           2.7.7.38) 4 [similarity] - Chlamydia trachomatis
           (serotype D, strain UW3/Cx)>gb:AE001294_34135 Chlamydia
           trachomatis D/UW-3/CX section 21 of 87 of the complete
           genome.>gb:CTGSEAD_119532 C.trachomatis gseA
           gene.>gb:AE001273_1098161 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 431

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 22/73 (30%), Positives = 33/73 (45%)
 Frame = -1

Query: 474 GRWKRGFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSI 295
           G W +G  ASF+       +A  +LK I                SA  + ++  T  PS+
Sbjct: 296 GLWSQG--ASFRQYNSLIMDAMGVLKDIY---------------SAADIAFVGGTFDPSV 338

Query: 294 AGHNILEACKREV 256
            GHN+LE  ++EV
Sbjct: 339 GGHNLLEPLQKEV 351



>gb:AE005173_892649 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007915_1536339 Genomic sequence
           for Arabidopsis thaliana BAC F27F5 from chromosome I,
           complete sequence.
          Length = 205

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 36/150 (24%), Positives = 53/150 (35%)
 Frame = -1

Query: 555 IVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGFLASFKSCTPFESEAWAILKGIQLLAS 376
           +VK   D             G IRD  G W  GF  +   C+   +E W +  G+ L   
Sbjct: 57  VVKARYDWSFHKNPVLTTAGGLIRDATGSWCGGFALNIGVCSAPLAELWGVYYGLYLTWE 116

Query: 375 MKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEFCQFKFIPREINCVAD 196
              +   +E DS   V +++      I+  + L        SF       + RE N +AD
Sbjct: 117 RHITRLEVEVDSELVVGFLSK----GISDSHPL--------SFVIVWTSHVYREANRLAD 164

Query: 195 CLARLARLQAASFQTLLDPPAETRSLLDED 106
            L   A     +F  L   P       D+D
Sbjct: 165 ELENYAFTLPLTFHMLKVVPHVETIFQDDD 194



>pir|F71420|F71420 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV42_1545360 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 42.>gb:ATFCA4_1551608
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 4.
          Length = 559

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 16/45 (35%), Positives = 21/45 (46%)
 Frame = -1

Query: 588 KQLCWEKPREGIVKLNVDXXXXXXXXXXXXXGAIRDHNGRWKRGF 454
           + + W KP EG VK++ D             G IRD +G W  GF
Sbjct: 24  RHIAWTKPPEGWVKVSTDGASRGNPGPAAAGGVIRDEDGLWVGGF 68



>pir|I40898|I40898 3-deoxy-manno-octulosonate cytidylyltransferase
           (EC 2.7.7.38) 5 [similarity] - Chlamydia
           trachomatis>gb:CTGSEAE_119533 C.trachomatis gseA gene.
          Length = 431

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = -1

Query: 474 GRWKRGFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSI 295
           G W +G  ASF+       +A  +LK +                SA  + ++  T  PS+
Sbjct: 296 GLWSQG--ASFRQYNSLIMDAMGVLKDVY---------------SAADIAFVGGTFDPSV 338

Query: 294 AGHNILEACKREV 256
            GHN+LE  ++EV
Sbjct: 339 GGHNLLEPLQKEV 351



>gb:AF466646_1802320 Zea mays clone ZMMBBb_Z195D10 putative
            transposase gene, partial cds; glycyl-tRNA synthetase,
            ornithine carbamoyltransferase, putative gag protein,
            putative SET-domain transcriptional regulator, putative
            oxysterol-binding protein, putative polyprotein, putative
            oxysterol-binding protein, putative gag-pol polyprotein,
            putative phosphatidylinositol-4-phosphate-5-kinase,
            hypothetical protein, putative gag-pol polyprotein,
            putative polyprotein, putative retrotransposon protein,
            and prpol genes, complete cds; and putative teosinte
            branched2; TB2 gene, partial cds.
          Length = 1317

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 28/88 (31%), Positives = 44/88 (50%), Gaps = 1/88 (1%)
 Frame = -1

Query: 438  SCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYIN-STRIPSIAGHNILEACKR 262
            +CT   +E  A++ G++ L +M    AI+++DS     +I+ S +         L+  +R
Sbjct: 784  NCTNNIAEYEALVLGLRKLKAMGIRRAILKTDSQVVSGHIDKSCKAKDPKLEKYLDMVRR 843

Query: 261  EVRSFEFCQFKFIPREINCVADCLARLA 178
               SFE    K IPR  N  AD LA+ A
Sbjct: 844  IEASFEGFSVKNIPRGQNEHADLLAKSA 871



>gb:AE016959_1021943 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC119148_1739581 Oryza sativa
            (japonica cultivar-group) chromosome 10 clone
            OSJNBa0035F15, complete sequence.>gb:AE017079_1751762
            Oryza sativa (japonica cultivar-group) chromosome 10,
            section 33 of 77 of the complete sequence.
          Length = 1627

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1324 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1383

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A+   L + DA   P
Sbjct: 1384 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSAQPDPLGETDAPDRP 1439



>gb:BX248358_762948 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 5/8.
          Length = 377

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 33/120 (27%), Positives = 51/120 (42%), Gaps = 8/120 (6%)
 Frame = -1

Query: 420 SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST-RIPSIAGHNILEACKREVRSFE 244
           +E   +L G++  A +  +   +  DS   VE ++   +I       +   CK+   S  
Sbjct: 48  AEYHGLLNGLRGAAELGATEVSVRMDSKLVVEQMSGRWKIKHPDMKELALECKKVASSIG 107

Query: 243 FCQFKFIPREINCVADCLAR-----LARLQAASFQTLLDPPAETRS--LLDEDAAGFPVW 85
              +++IPR  N  AD LA      LA   A  F  L +P A+T S   + E A    VW
Sbjct: 108 SVSYEWIPRSENSHADALANKAMDALAEGAAVGFLELEEPAAKTDSEEKVVETATSPAVW 167



>gb:AC132493_1741229 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0636E04, complete sequence.
          Length = 1974

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G++L A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1472 AEYEGLLAGLRLAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERYFD 1531

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1532 GIELRHVPRRDNTIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1587



>gb:AC130601_1740762 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBb0108E17, complete sequence.
          Length = 1943

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1408 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDTYVRQVRRMKRHFD 1467

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1468 GIELRHVPRRDNTIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1523



>gb:AC090683_1734408 Oryza sativa chromosome 3 BAC OSJNBa0035I24
            genomic sequence, complete sequence.>gb:AC116369_1739288
            Oryza sativa chromosome 3 BAC OSJNBb0113I20 genomic
            sequence, complete sequence.
          Length = 2028

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1479 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1538

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1539 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLEETDAPDRP 1594



>gb:OSJN00143_1695608 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0013J13, complete sequence.
          Length = 1836

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 5/64 (7%)
 Frame = -1

Query: 267  KREVRSFEFCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDA 103
            +R  R F+  + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA
Sbjct: 1339 RRMERHFDGIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDA 1398

Query: 102  AGFP 91
             G P
Sbjct: 1399 PGRP 1402



>gb:OSJN00094_1694801 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0003B01, complete sequence.
          Length = 2030

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST-RIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  ++   R         +   +R  R F+
Sbjct: 1481 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVSKEYRCSDPQMDAYVRQVRRMERHFD 1540

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1541 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1596



>gb:OSJN00145_1190852 Oryza sativa (japonica cultivar-group)
            chromosome 4 clone OSJNBa0096F01, *** SEQUENCING IN
            PROGRESS ***, 2 ordered pieces.>gb:OSJN00137_1695494
            Oryza sativa genomic DNA, chromosome 4, BAC clone:
            OSJNBa0052P16, complete sequence.
          Length = 1384

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 31/116 (26%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 835  AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 894

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + IPR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 895  GIELRHIPRRDNMVADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 950



>gb:AE017269_422942 Bacillus cereus ATCC 10987, section 6 of 18 of
           the complete genome.>gb:AE017194_1061361 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 128

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 24/85 (28%), Positives = 38/85 (44%)
 Frame = -1

Query: 423 ESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFE 244
           E+E  A+L  ++      Y+     +DS      +      +     +LE   + ++SF+
Sbjct: 43  EAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKEYAKNKMFAPLLEEALQYIKSFD 102

Query: 243 FCQFKFIPREINCVADCLARLARLQ 169
               K+IP   N VAD LAR A LQ
Sbjct: 103 LFFIKWIPSSQNKVADELARKAILQ 127



>gb:AE017029_381798 Bacillus anthracis str. Ames section 6 of 18 of
           the complete genome.>gb:AE017225_406901 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_451646 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_462787 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_852084 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1011503 Bacillus anthracis str. Ames
           complete genome.
          Length = 128

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 24/85 (28%), Positives = 38/85 (44%)
 Frame = -1

Query: 423 ESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFE 244
           E+E  A+L  ++      Y+     +DS      +      +     +LE   + ++SF+
Sbjct: 43  EAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKEYAKNKMFAPLLEEALQYIKSFD 102

Query: 243 FCQFKFIPREINCVADCLARLARLQ 169
               K+IP   N VAD LAR A LQ
Sbjct: 103 LFFIKWIPSSQNKVADELARKAILQ 127



>pir|D84499|D84499 hypothetical protein At2g11830 [imported] -
           Arabidopsis thaliana>gb:AC007187_1535491 Arabidopsis
           thaliana chromosome 2 clone F7E22 map mi421, complete
           sequence.
          Length = 156

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 24/95 (25%), Positives = 46/95 (48%)
 Frame = -1

Query: 459 GFLASFKSCTPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNI 280
           G  ++ +S +P  +E  ++L  ++ + S+  +     SD  + +  I++     I     
Sbjct: 55  GLKSARRSLSPLHAEFDSLLWAMECMTSIGNTSGAFASDCLDLIFIIDNQEDWLIFTAE- 113

Query: 279 LEACKREVRSFEFCQFKFIPREINCVADCLARLAR 175
           L + +  V  F + + +F PR  N  ADCLA+ AR
Sbjct: 114 LASYRSLVCFFPYFRIRFFPRSSNTRADCLAKKAR 148



>gb:AP002804_1822804 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0021A04.>gb:AP002862_1823261 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:OSJNBa0036E02.
          Length = 1473

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 955  AEYKGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1014

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1015 GIELRHVPRRDNAVADELSRLASSRAQTPLGAFEERLAQPSARPDPLGETDAPERP 1070



>gb:AC145271_1744283 Oryza sativa (japonica cultivar-group) chromosome
            5 clone B1140B01, complete sequence.
          Length = 1796

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 9/119 (7%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRS--- 250
            +E   +L G+++ A +     ++  DS   V   N  R         ++A  R+VR    
Sbjct: 1247 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVV---NQVRKEYQCSDPQMDAYVRQVRRMER 1303

Query: 249  -FEFCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
             F+  + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1304 HFDGIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1362



>gb:AC135595_1742674 Oryza sativa chromosome 3 BAC OSJNBa0028F23
            genomic sequence, complete sequence.
          Length = 2010

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1461 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1520

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1521 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1576



>gb:AC133333_1741323 Oryza sativa chromosome 3 BAC OJ1785_A05 genomic
            sequence, complete sequence.
          Length = 2002

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1453 AEYEGLLAGLRVAAGLGIRRLMVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1512

Query: 243  FCQFKFIPREINCVADCLARLARLQAASF-----QTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A +      + L  P A    L + DA   P
Sbjct: 1513 GIELRHVPRRDNAVADELSRLASSRAQTLPGAFEERLAQPSARPDPLGETDAPERP 1568



>gb:AC104272_1737354 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1045_C06, complete sequence.
          Length = 1207

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 8/119 (6%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST---RIPSIAGHNILEACKREVRS 250
            +E   +L G+++ A +     ++  DS   V  ++       P +  +  +   +R  R 
Sbjct: 667  AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVSKEYQCSDPQMDAY--VRQVRRMERH 724

Query: 249  FEFCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFPV 88
            F+  + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P+
Sbjct: 725  FDGIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERPL 783



>gb:AC084296_1733473 Oryza sativa chromosome 3 BAC OSJNBb0024J04
            genomic sequence, complete sequence.
          Length = 1980

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  I    R         +   +R  R F+
Sbjct: 1446 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQICKEYRCSDPQMDAYVRQVRRMERHFD 1505

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1506 GIELRHVPRRDNTIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1561



>gb:AC079357_1732549 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0033D06, complete sequence.
          Length = 1823

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1274 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1333

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1334 GIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1389



>gb:OSJN00242_1697254 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0036B17, complete sequence.
          Length = 982

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420 SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
           +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 433 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 492

Query: 243 FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
             + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 493 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 548



>gb:OSJN00232_1697133 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0022H21, complete sequence.
          Length = 1993

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1444 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1503

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1504 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1559



>gb:OSJN00208_1696724 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0062H02, complete sequence.
          Length = 2001

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMVADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:OSJN00199_1696591 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0026I12, complete sequence.
          Length = 2009

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1464 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1523

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1524 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1579



>gb:OSJN00168_1696086 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0035M09, complete sequence.
          Length = 1297

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1110 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1169

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1170 GIELRHVPRRDNMVADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1225



>gb:OSJN00011_1693247 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0022F23, complete sequence.
          Length = 1612

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1274 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1333

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1334 GIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1389



>gb:AC079021_1541694 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0008A07, complete sequence.
          Length = 2027

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMEAYVRQIRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GVELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1593



>gb:AE016959_1023257 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC068923_1540506 Oryza sativa
            chromosome 10 BAC OSJNBa0017E08 genomic sequence,
            complete sequence.>gb:AE017109_1753076 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 63 of 77
            of the complete sequence.
          Length = 1501

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 952  AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1011

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1012 GIELRHVPRRDNMIADELSRLASTRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1067



>gb:AE016959_1022207 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC134516_1741795 Oryza sativa
            (japonica cultivar-group) chromosome 10 clone OJA1208D02,
            complete sequence.>gb:AE017085_1752026 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 39 of 77
            of the complete sequence.
          Length = 2027

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYKGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMVADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AE016959_1021691 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC051624_1540049 Genomic
            Sequence for Oryza sativa, Nipponbare strain, clone
            OSJNBb0036B06, from Chromosome 10, complete
            sequence.>gb:AE017073_1751510 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 27 of 77 of the
            complete sequence.
          Length = 1963

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1414 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1473

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1474 GIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1529



>pir|T01474|T01474 hypothetical protein T24H24.17 - Arabidopsis
            thaliana>gb:ATCHRIV11_1544244 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 11.>gb:T24H24_1723884
            Arabidopsis thaliana BAC T24H24.
          Length = 1077

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 25/85 (29%), Positives = 36/85 (42%)
 Frame = -1

Query: 432  TPFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVR 253
            +P  +E    L  +++            SDS   V+ +N  ++     H IL        
Sbjct: 987  SPLIAETLVTLADVRVACESDIKAISFASDSQIIVKALNQ-KLQVKELHGILHDILSLSS 1045

Query: 252  SFEFCQFKFIPREINCVADCLARLA 178
            SF+ C F FI RE N  AD LA+ A
Sbjct: 1046 SFDACTFTFINREFNHQADALAKRA 1070



>pir|G85096|G85096 hypothetical protein AT4g09490 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV27_1544663 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 27.
          Length = 170

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 25/82 (30%), Positives = 37/82 (45%)
 Frame = -1

Query: 429 PFESEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRS 250
           P  +EA A+   +Q   S+  +   + SDS + +  I S   PS   + I+         
Sbjct: 73  PLMAEAIALFLALQYAQSIGITKLSMASDSQQLITAITSES-PSTEFYGIIFDILNLSLG 131

Query: 249 FEFCQFKFIPREINCVADCLAR 184
           F    F F+PR  N VAD LA+
Sbjct: 132 FADVSFSFVPRSENRVADELAK 153



>gb:BC083764_2108835 Rattus norvegicus similar to Peci protein, mRNA
           (cDNA clone MGC:94706 IMAGE:7193133), complete cds.
          Length = 391

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 2/76 (2%)
 Frame = -1

Query: 468 WKRGFLASFKSCTPFESEAWAILKGIQLLA--SMKYSHAIIESDSAEAVEYINSTRIPSI 295
           W +G +      + FE+E W  LK    L   SM+ S  +I  +  E +  +N     ++
Sbjct: 309 WAQGLVTEVFPESTFETEVWTRLKTYAKLPPNSMRISKELIRKNEKEKLHAVNEEECTTL 368

Query: 294 AGHNILEACKREVRSF 247
               + E C   + SF
Sbjct: 369 RARWLSEECINAIMSF 384



>gb:AC145396_1744469 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0042F15, complete sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AC135420_1742264 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0060G17, complete sequence.
          Length = 1221

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 672  AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 731

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 732  GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 787



>gb:AC134237_1741690 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBa0090O10, complete sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AC120989_1740068 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0032D15, complete sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGLRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AC120506_1739789 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OSJNBb0006O08 map S15179S, complete sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AC113334_1738935 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1123_F01, complete sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AC097111_1736413 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1014_C08, complete
            sequence.>gb:AC121365_1740199 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone OSJNBa0053E05,
            complete sequence.
          Length = 2026

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1477 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1536

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1537 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1592



>gb:OSJN00296_1698136 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: B1248C03, complete sequence.>gb:OSJN00298_1698170
            Oryza sativa genomic DNA, chromosome 4, BAC clone:
            B1340F09, complete sequence.
          Length = 1958

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1440 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1499

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1500 GIELRHVPRRDNTVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGEMDAPDRP 1555



>gb:OSJN00190_1696476 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0091C12, complete sequence.
          Length = 1992

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1443 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1502

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1503 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1558



>gb:OSJN00160_1695916 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0019G23, complete sequence.
          Length = 1938

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1389 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1448

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1449 EIELRHVPRRDNTIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1504



>gb:OSJN00144_1695628 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0115I21, complete sequence.
          Length = 1938

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1389 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1448

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1449 EIELRHVPRRDNTIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1504



>gb:OSJN00140_1695565 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0027G07, complete sequence.
          Length = 1031

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420 SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
           +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 482 AEYEGLLAGLRVAAGLGILRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 541

Query: 243 FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
             + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 542 GIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 597



>gb:OSJN00107_1695050 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0062B06, complete sequence.
          Length = 1737

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 31/119 (26%), Positives = 52/119 (43%), Gaps = 9/119 (7%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRS--- 250
            +E   +L G+++ A +     ++  DS   V              N+++A  R+VR    
Sbjct: 1402 AEYAGLLAGLRVAARLGIRRLLVLGDSQLVV--------------NLMDAYVRQVRRMER 1447

Query: 249  -FEFCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
             F+  + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1448 HFDGIELRHVPRRDNTIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1506



>gb:OSJN00097_1694853 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0015D13, complete sequence.
          Length = 1814

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1414 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDSQMDAYVRQVRRMERHFD 1473

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1474 GIELRHVPRRDNMMADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPNRP 1529



>gb:OSJN00077_1694429 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0041A02, complete
            sequence.>gb:OSJN00089_1694708 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBa0083N12, complete
            sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  ++L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEESLTRPSARPDPLGETDAPDRP 1593



>gb:OSJN00076_1694414 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0039K24, complete sequence.
          Length = 1881

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1409 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1468

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1469 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1524



>gb:OSJN00069_1694273 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0050O03, complete sequence.
          Length = 2030

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1481 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1540

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1541 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 1596



>gb:OSJN00049_1693882 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0089E12, complete sequence.
          Length = 1370

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 821  AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 880

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 881  GIELRHVPRRDNTIADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPDRP 936



>gb:OSJN00041_1693758 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0046P18, complete
            sequence.>gb:OSJN00229_1697072 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBa0017P10, complete
            sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPLGAFEERLAQPSARPDPLGETDAPDRP 1593



>gb:OSJN00031_1693563 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0052O21, complete sequence.
          Length = 1888

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1339 AEYEGLLAGLRVAAGLGIRRLLVLGDSLLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1398

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1399 GIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPVPLGETDAPERP 1454



>gb:OSJN00027_1693535 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0067G20, complete sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:OSJN00020_1693418 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0091D06, complete sequence.
          Length = 1910

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 8/118 (6%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST---RIPSIAGHNILEACKREVRS 250
            +E   +L G+++ A +     ++  DS   V  ++       P +  +  +   +R  R 
Sbjct: 1415 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVSKEYQCSDPQMDAY--VRQVRRMERH 1472

Query: 249  FEFCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
            F+  + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1473 FDGIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1530



>gb:OSJN00019_1693390 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 2028

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1479 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1538

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1539 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1594



>gb:OSJN00007_1693179 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OJ000114_01, complete sequence.
          Length = 1916

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 5/115 (4%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINSTRIPSIAGHNILEACKREVRSFEF 241
            +E   +L G+++ A +     ++  DS   V  +++           +   +R  R F+ 
Sbjct: 1421 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQMDA----------YVRQVRRMERHFDG 1470

Query: 240  CQFKFIPREINCVADCLARLARLQAAS-----FQTLLDPPAETRSLLDEDAAGFP 91
             + + +PR  N VAD L+RLA  +A +      + L  P A    L + DA   P
Sbjct: 1471 IELRHVPRRDNTVADELSRLASSRAQTPPGVFEERLAQPSARPDPLGETDAPNRP 1525



>gb:AC079038_1541792 Oryza sativa chromosome 7 clone OSJNBb0024A20,
            complete sequence.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:OSJN00264_1191000 Oryza sativa (japonica cultivar-group)
            chromosome 4 clone OSJNBa0094P09, *** SEQUENCING IN
            PROGRESS ***, 7 ordered pieces.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:OSJN00223_1190899 Oryza sativa (japonica cultivar-group)
            chromosome 4 clone OSJNBa0009K15, *** SEQUENCING IN
            PROGRESS ***, 2 ordered pieces.
          Length = 1869

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 8/118 (6%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST---RIPSIAGHNILEACKREVRS 250
            +E   +L G+++ A +     ++  DS   V  ++       P +  +  +   +R  R 
Sbjct: 1320 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVSKEYQCSDPQMDAY--VRQVRRMERH 1377

Query: 249  FEFCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
            F+  + + +PR  N VAD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1378 FDGIELRHVPRRDNAVADELSRLASSRAQTPPGAFEERLAQPSARPDPLGETDAPERP 1435



>gb:OSJN00133_1190829 Oryza sativa (japonica cultivar-group)
            chromosome 4 clone OSJNBa0029C04, *** SEQUENCING IN
            PROGRESS ***, 3 ordered pieces.
          Length = 2027

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1478 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1537

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1538 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1593



>gb:AE016959_1023331 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC084023_1733331
           Oryza sativa chromosome 10 BAC OSJNBa0062C05 genomic
           sequence, complete sequence.>gb:AE017110_1753150 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           64 of 77 of the complete sequence.
          Length = 969

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420 SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
           +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 420 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 479

Query: 243 FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
             + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 480 GIELRHVPRRDNMIADELSRLASSRAQIPPGAFEERLAQPSARPDPLGETDAPDRP 535



>gb:AE016959_1021434 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC093612_1736077 Oryza sativa
            chromosome 10 BAC OSJNBa0003P07 genomic sequence,
            complete sequence.>gb:AE017068_1751253 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 22 of 77
            of the complete sequence.
          Length = 2025

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 6/116 (5%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFE 244
            +E   +L G+++ A +     ++  DS   V  +    R         +   +R  R F+
Sbjct: 1476 AEYEGLLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPQMDAYVRQVRRMERHFD 1535

Query: 243  FCQFKFIPREINCVADCLARLARLQA-----ASFQTLLDPPAETRSLLDEDAAGFP 91
              + + +PR  N +AD L+RLA  +A     A  + L  P A    L + DA   P
Sbjct: 1536 GIELRHVPRRDNMIADELSRLASSRAQTPPGAFEERLTQPSARPDPLGETDAPDRP 1591



>gb:AE016959_1021152 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC074355_1541384 Oryza sativa
            (japonica cultivar-group) chromosome 10 clone
            OSJNBa0071I20, complete sequence.>gb:AE017062_1750971
            Oryza sativa (japonica cultivar-group) chromosome 10,
            section 16 of 77 of the complete sequence.
          Length = 1233

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 28/107 (26%), Positives = 46/107 (42%), Gaps = 5/107 (4%)
 Frame = -1

Query: 405  ILKGIQLLASMKYSHAIIESDSAEAVEYI-NSTRIPSIAGHNILEACKREVRSFEFCQFK 229
            +L G+++ A +     ++  DS   V  +    R         +   +R  R F+  + +
Sbjct: 766  LLAGLRVAAGLGIRRLLVLGDSQLVVNQVCKEYRCSDPEMDAYVRQVRRMERHFDGIELR 825

Query: 228  FIPREINCVADCLARLARLQA----ASFQTLLDPPAETRSLLDEDAA 100
             +PR  N VAD L+RLA  +A     SF+  L  P+     L E  A
Sbjct: 826  HVPRRDNAVADELSRLASSRAQTPPGSFEERLAQPSARPDPLGETDA 872



>pir|H84465|H84465 hypothetical protein At2g05200 [imported] -
            Arabidopsis thaliana>gb:AC007018_1534982 Arabidopsis
            thaliana chromosome 2 clone F5G3 map RNS1, complete
            sequence.
          Length = 1229

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = -1

Query: 420  SEAWAILKGIQLLASMKYSHAIIESDSAEAVEYINST-RIPSIAGHNILEACKREVRSFE 244
            +EAWAI   +     +  +  ++ SDS   V+ + S   I  I G  +L   +    SF 
Sbjct: 1132 AEAWAIKSALLHALQLGRTDLMVLSDSKSVVDALTSNISINEIYG--LLMEIRALRVSFH 1189

Query: 243  FCQFKFIPREINCVADCLARLA 178
               F FI R  N +AD  A+L+
Sbjct: 1190 SLCFNFISRSANAIADATAKLS 1211


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 879,051,602
Number of Sequences: 1806583
Number of extensions: 18097396
Number of successful extensions: 40023
Number of sequences better than 10.0: 138
Number of HSP's better than 10.0 without gapping: 38536
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39998
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 53596531634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)