BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13375
         (806 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP005260_1849763 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:AP002071_1821955 Oryza sativa (japonica cultivar-group) genom...    57   5e-07   
gb:AY054519_1563173 Arabidopsis thaliana Unknown protein (At1g07...    52   2e-05   
pir|F86208|F86208 protein F22G5.30 [imported] - Arabidopsis thal...    52   2e-05   Arabidopsis thaliana [mouse-ear cress]
pir|A84698|A84698 probable RNA-binding protein [imported] - Arab...    50   7e-05   Arabidopsis thaliana [mouse-ear cress]
pir|G84283|G84283 TRK potassium uptake system protein [imported]...    34   2.8     Halobacterium salinarum
pir|S54157|S54157 extensin-like protein - cowpea (fragment)            34   3.7     Vigna unguiculata
gb:BX294155_772123 Pirellula sp. strain 1 complete genome; segme...    33   4.8     


>gb:AP005260_1849763 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0557D09.
          Length = 486

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 43/109 (39%), Positives = 48/109 (44%), Gaps = 10/109 (9%)
 Frame = -3

Query: 804 GXPQAXKXEXEIXDEARQQATVAHSGLLPRAVIXXXXXXXXXX--XXXXQDQXXXXXXXX 631
           G PQA K E    DEA +Q  VAH G+LPRAVI                Q Q        
Sbjct: 299 GKPQAPKPEE---DEAGRQGHVAHGGMLPRAVISQQQSGDQPQPPGMEGQQQPASASYYF 355

Query: 630 XXXXXXXPDRALYPSMDPQRMGAVVPSHEG--------AASGSGENRSG 508
                   +R LYPSMDPQRMGA+V S EG        A  G   + SG
Sbjct: 356 NIPAPPAAERTLYPSMDPQRMGALVESQEGDGKPGPQQAGQGQASSSSG 404



>gb:AP002071_1821955 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0675A05.
          Length = 482

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 39/90 (43%), Positives = 43/90 (47%), Gaps = 2/90 (2%)
 Frame = -3

Query: 804 GXPQAXKXEXEIXDEARQQATVAHSGLLPRAVIXXXXXXXXXX--XXXXQDQXXXXXXXX 631
           G PQA K E    DEA +Q  VAH G+LPRAVI                Q Q        
Sbjct: 299 GKPQAPKPED---DEAGRQGHVAHGGMLPRAVISQQQSGDQPQPPGMEGQQQAPSGSYYF 355

Query: 630 XXXXXXXPDRALYPSMDPQRMGAVVPSHEG 541
                   +R LYPSMDPQRMGA+V S EG
Sbjct: 356 NIPAPPGAERTLYPSMDPQRMGALVKSQEG 385



>gb:AY054519_1563173 Arabidopsis thaliana Unknown protein
           (At1g07360; F22G5.30) mRNA, complete
           cds.>gb:AY114632_1578674 Arabidopsis thaliana unknown
           protein (At1g07360) mRNA, complete cds.
          Length = 481

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 33/83 (39%), Positives = 38/83 (45%)
 Frame = -3

Query: 765 DEARQQATVAHSGLLPRAVIXXXXXXXXXXXXXXQDQXXXXXXXXXXXXXXXPDRALYPS 586
           D A QQ  VAHSGLLPRAVI               +Q                D+  YPS
Sbjct: 306 DGANQQGGVAHSGLLPRAVISQQH-----------NQPPPMQQYYMHPPPANQDKPYYPS 354

Query: 585 MDPQRMGAVVPSHEGAASGSGEN 517
           MDPQRMGAV+ + E   S +  N
Sbjct: 355 MDPQRMGAVISTQEAGGSSTENN 377



>pir|F86208|F86208 protein F22G5.30 [imported] - Arabidopsis
           thaliana>gb:AE005172_889738 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC022464_1539021 Genomic sequence for
           Arabidopsis thaliana BAC F22G5 from chromosome I,
           complete sequence.
          Length = 481

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 33/83 (39%), Positives = 38/83 (45%)
 Frame = -3

Query: 765 DEARQQATVAHSGLLPRAVIXXXXXXXXXXXXXXQDQXXXXXXXXXXXXXXXPDRALYPS 586
           D A QQ  VAHSGLLPRAVI               +Q                D+  YPS
Sbjct: 306 DGANQQGGVAHSGLLPRAVISQQH-----------NQPPPMQQYYMHPPPANQDKPYYPS 354

Query: 585 MDPQRMGAVVPSHEGAASGSGEN 517
           MDPQRMGAV+ + E   S +  N
Sbjct: 355 MDPQRMGAVISTQEAGGSSTENN 377



>pir|A84698|A84698 probable RNA-binding protein [imported] -
           Arabidopsis thaliana>gb:AC004561_1531867 Arabidopsis
           thaliana chromosome 2 clone F16P2 map ve014, complete
           sequence.>gb:BT002621_1636224 Arabidopsis thaliana
           At2g29580/F16P2.4 gene, complete
           cds.>gb:AF428354_1799284 Arabidopsis thaliana
           At2g29580/F16P2.4 mRNA, complete cds.
          Length = 483

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 39/97 (40%), Positives = 44/97 (45%)
 Frame = -3

Query: 804 GXPQAXKXEXEIXDEARQQATVAHSGLLPRAVIXXXXXXXXXXXXXXQDQXXXXXXXXXX 625
           G PQ  K +    D + QQ +VAHSGLLPRAVI                           
Sbjct: 299 GRPQVPKPDQ---DGSNQQGSVAHSGLLPRAVISQQQNQP--------PPMLQYYMHPPP 347

Query: 624 XXXXXPDRALYPSMDPQRMGAVVPSHEGAASGSGENR 514
                 DR  YPSMDPQRMGAV  S E  +S S +NR
Sbjct: 348 PQPPHQDRPFYPSMDPQRMGAVSSSKESGSSTS-DNR 383



>pir|G84283|G84283 TRK potassium uptake system protein [imported] -
           Halobacterium sp. NRC-1>gb:AE005052_62795 Halobacterium
           sp. NRC-1 section 83 of 170 of the complete
           genome.>gb:AE004437_887714 Halobacterium sp. NRC-1
           complete genome.
          Length = 537

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 21/60 (35%), Positives = 31/60 (51%)
 Frame = +1

Query: 445 LGWWWPRRISKMVSMWGLLIRTTSIFARP*SSTFM*WNNGSHSLRIHRRIQCPVRLRHWW 624
           L WW  R   + V   G+++ TT+I ARP S +   + + + S +IH  I   VR   WW
Sbjct: 156 LQWW--RSFIEWVGGVGVIVLTTAILARPGSGSLTLYESEARSEKIHPSIVSTVR-TIWW 212



>pir|S54157|S54157 extensin-like protein - cowpea (fragment)
          Length = 279

 Score = 33.9 bits (76), Expect = 3.7
 Identities = 31/106 (29%), Positives = 43/106 (40%), Gaps = 6/106 (5%)
 Frame = -1

Query: 650 HHLC--LTSTFHQCLSRTGHCILLWILKEWEPLFHHMKVLLQGRAKIEVVLISNPHMDTI 477
           HHL   L    H C+SR  H + +        L HH   +      + + L+ + HM   
Sbjct: 110 HHLLHLLPHHLHMCISRHHHHLPMSTSPHHHHLLHHHLPMSTSHPLLHL-LLHHLHMC-- 166

Query: 476 LLIRLGHHHPRANFTHLIIHTMGISHL----PHRLINSTLLHLIRL 351
               + HHH   +  HL + T    HL    PH L   T LHL+ L
Sbjct: 167 ----ISHHHH--HLLHLRLPTFTSPHLLHLLPHHLPMFTSLHLLHL 206



>gb:BX294155_772123 Pirellula sp. strain 1 complete genome; segment
           23/24.
          Length = 382

 Score = 33.5 bits (75), Expect = 4.8
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = -1

Query: 590 LLWILKEWEPLFHHMKVLLQGRAKIEVVLISNPHMDTILLIRLGHHHPRANFT--HLIIH 417
           L WI    +P+     ++LQ   K+ V    + H+  +  ++L    P AN T  HL+ H
Sbjct: 110 LFWIASMTKPITGACVLMLQDEGKLSVDDPISKHLPMMKHLKLADGTP-ANITIRHLMTH 168

Query: 416 TMGISHLP 393
           T G+S LP
Sbjct: 169 TSGMSELP 176


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 643,515,454
Number of Sequences: 1806583
Number of extensions: 10807446
Number of successful extensions: 30454
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 29503
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30439
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 52781167954
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)