BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13374
         (812 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY099590_1576615 Arabidopsis thaliana putative transport prot...   159   6e-38   
gb:AB012247_1511830 Arabidopsis thaliana genomic DNA, chromosome...   159   6e-38   
gb:AY058204_1564338 Arabidopsis thaliana At1g52190/F9I5_4 mRNA, ...   159   8e-38   
pir|H96561|H96561 probable peptide transporter [imported] - Arab...   159   8e-38   Arabidopsis thaliana [mouse-ear cress]
gb:AF377946_1793296 Oryza sativa (japonica cultivar-group) chrom...   108   9e-23   
gb:AB067652_1522599 Oryza sativa (japonica cultivar-group) OsPTR...   108   9e-23   
gb:AP003256_1826467 Oryza sativa (japonica cultivar-group) genom...   107   2e-22   
pir|T48516|T48516 probable oligopeptide transporter protein - Ar...   107   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP003436_1829384 Oryza sativa (japonica cultivar-group) genom...   105   1e-21   
gb:AB052785_1521244 Glycine max mRNA for nitrate transporter NRT...   104   2e-21   
gb:AB020751_1514667 Arabidopsis thaliana genomic DNA, chromosome...   103   4e-21   
gb:AP003256_1826468 Oryza sativa (japonica cultivar-group) genom...   103   5e-21   
gb:BT005728_1638663 Arabidopsis thaliana clone RAFL15-01-K12 (R2...    99   7e-20   
pir|T45958|T45958 oligopeptide transporter-like protein - Arabid...    99   7e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC092779_1735702 Oryza sativa chromosome 3 BAC OSJNBb0024N19 ...    99   9e-20   
gb:AB052784_1521243 Glycine max mRNA for nitrate transporter NRT...    99   1e-19   
gb:AP004993_1846907 Oryza sativa (japonica cultivar-group) genom...    98   2e-19   
gb:AP005173_1848761 Oryza sativa (japonica cultivar-group) genom...    97   3e-19   
pir|T04378|T04378 peptide transport protein - barley>gb:AF023472...    96   8e-19   Hordeum vulgare [barley]
pir|T47573|T47573 peptide transport-like protein - Arabidopsis t...    96   8e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY090257_1574009 Arabidopsis thaliana At1g69870/T17F3_10 mRNA...    96   1e-18   
pir|S46236|S46236 histidine transport protein - Arabidopsis thal...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
pir|A96721|A96721 probable peptide transporter T17F3.10 [importe...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
sp|P46032|PT2B_ARATH|PT2B_ARATH Peptide transporter PTR2-B (Histidine trans...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AF428467_1799397 Arabidopsis thaliana AT3g47960/T17F15_170 mR...    95   1e-18   
gb:AF370202_1792090 Arabidopsis thaliana putative peptide transp...    95   1e-18   
pir|T06687|T06687 probable peptide transport protein T17F15.170 ...    95   1e-18   Arabidopsis thaliana [mouse-ear cress]
pir|T51439|T51439 oligopeptide transporter-like protein - Arabid...    95   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AY570975_1178672 Xerophyta humilis clone HC323 nitrate transp...    94   2e-18   
gb:AB052788_1521247 Glycine max mRNA for nitrate transporter NRT...    94   3e-18   
gb:AP003791_1833396 Oryza sativa (japonica cultivar-group) genom...    93   5e-18   
gb:AF016713_1761512 Lycopersicon esculentum oligopeptide transpo...    93   5e-18   
gb:OSJN00056_1694025 Oryza sativa genomic DNA, chromosome 4, BAC...    93   5e-18   
gb:AP003621_1831571 Oryza sativa (japonica cultivar-group) genom...    93   7e-18   
gb:AP002483_1822204 Oryza sativa (japonica cultivar-group) genom...    92   2e-17   
gb:AY587264_1616474 Triticum aestivum low affinity nitrate trans...    92   2e-17   
gb:OSJN00099_1694893 Oryza sativa genomic DNA, chromosome 4, BAC...    91   2e-17   
gb:AE016959_1020655 Oryza sativa (japonica cultivar-group) chrom...    91   2e-17   
gb:AP005869_1859325 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AY090354_1574104 Arabidopsis thaliana At1g72130/F28P5.1 mRNA,...    91   3e-17   
pir|F96744|F96744 probable peptide transporter PTR2-B T9N14.15 [...    91   3e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AP003791_1833395 Oryza sativa (japonica cultivar-group) genom...    90   4e-17   
gb:AF140606_1771555 Oryza sativa nitrate transporter (NRT1) mRNA...    90   4e-17   
gb:AK175547_1817535 Arabidopsis thaliana mRNA for putative pepti...    89   8e-17   
gb:AY065020_1566183 Arabidopsis thaliana At1g72120/F28P5_2 mRNA,...    89   8e-17   
pir|G96744|G96744 probable peptide transporter PTR2-B, T9N14.16 ...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC010676_1543134 Arabidopsis thaliana chromosome III BAC T2...    89   1e-16   
pir|E96744|E96744 probable oligopeptide transporter F28P5.2 [imp...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
pir|F86358|F86358 Similar to peptide transporter [imported] - Ar...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AK117678_1815699 Arabidopsis thaliana At1g72130 mRNA for puta...    88   2e-16   
gb:AY058836_1564373 Arabidopsis thaliana At1g62200/F19K23_13 mRN...    88   2e-16   
pir|E96648|E96648 hypothetical protein F19K23.13 [imported] - Ar...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003566_1830922 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:AP003235_1825912 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
pir|B86359|B86359 protein Similar to LeOPT1 [Lycopersicon escule...    88   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003235_1825917 Oryza sativa (japonica cultivar-group) genom...    87   3e-16   
gb:AE016959_1020640 Oryza sativa (japonica cultivar-group) chrom...    87   5e-16   
pir|A84432|A84432 probable peptide/amino acid transporter [impor...    87   5e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP004047_1836888 Oryza sativa (japonica cultivar-group) genom...    86   6e-16   
gb:AP004096_1837679 Oryza sativa (japonica cultivar-group) genom...    86   8e-16   
gb:AP003235_1825914 Oryza sativa (japonica cultivar-group) genom...    86   8e-16   
pir|G86322|G86322 hypothetical protein F6A14.2 - Arabidopsis tha...    86   1e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AY289622_1594949 Vicia faba peptide transporter 1 (PTR1) mRNA...    85   2e-15   
pir|G86449|G86449 F5D14.23 protein - Arabidopsis thaliana>gb:AE0...    85   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP002818_1822868 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:BT004638_1637672 Arabidopsis thaliana At1g22550 gene, complet...    84   2e-15   
pir|G86358|G86358 protein Similar to LeOPT1 [Lycopersicon escule...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AB102806_1526337 Nicotiana tabacum NtNRT1.1-t mRNA for nitrat...    84   3e-15   
gb:AE016959_1020653 Oryza sativa (japonica cultivar-group) chrom...    84   3e-15   
gb:AP003566_1830926 Oryza sativa (japonica cultivar-group) genom...    84   4e-15   
gb:AP003235_1825915 Oryza sativa (japonica cultivar-group) genom...    84   4e-15   
gb:AY084539_1569628 Arabidopsis thaliana clone 111089 mRNA, comp...    84   4e-15   
gb:ATH131464_1551986 Arabidopsis thaliana mRNA for nitrate trans...    84   4e-15   
gb:AB019232_1514187 Arabidopsis thaliana genomic DNA, chromosome...    84   4e-15   
pir|T52585|T52585 probable nitrate transporter ntp3 [imported] -...    84   4e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AP003857_1834399 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP003621_1831570 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP003566_1830923 Oryza sativa (japonica cultivar-group) genom...    83   5e-15   
gb:AP003905_1835020 Oryza sativa (japonica cultivar-group) genom...    83   7e-15   
gb:AC130729_1740927 Oryza sativa (japonica cultivar-group) chrom...    83   7e-15   
gb:BT020275_1642670 Arabidopsis thaliana At3g54450 mRNA, complet...    82   9e-15   
gb:AC069273_1540772 Arabidopsis thaliana chromosome 1 BAC F28P5 ...    82   9e-15   
gb:AE016959_1023995 Oryza sativa (japonica cultivar-group) chrom...    82   9e-15   
pir|T47604|T47604 oligopeptide transporter-like protein - Arabid...    82   9e-15   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00129_1695377 Oryza sativa genomic DNA, chromosome 4, BAC...    82   1e-14   
pir|B86458|B86458 probable protein nitrate transporter NTL1 5408...    82   1e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP004669_1843009 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AP003566_1830928 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AY587265_1616475 Triticum aestivum low affinity nitrate trans...    82   2e-14   
gb:AY305030_1597541 Oryza sativa (japonica cultivar-group) nitra...    82   2e-14   
gb:AE016959_1020657 Oryza sativa (japonica cultivar-group) chrom...    82   2e-14   
pir|A96710|A96710 hypothetical protein F24J5.19 [imported] - Ara...    82   2e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AY064057_1565995 Arabidopsis thaliana putative peptide transp...    81   2e-14   
gb:AK118142_1816136 Arabidopsis thaliana At4g21680 mRNA for puta...    81   3e-14   
gb:AB006698_1509861 Arabidopsis thaliana genomic DNA, chromosome...    81   3e-14   
pir|T05843|T05843 peptide transport protein homolog F17L22.140 -...    81   3e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP003566_1830921 Oryza sativa (japonica cultivar-group) genom...    80   3e-14   
gb:AP003235_1825911 Oryza sativa (japonica cultivar-group) genom...    80   3e-14   
gb:AB128925_1528356 Prunus persica PpNRT1 gene for nitrate trans...    80   3e-14   
gb:AB102805_1526336 Nicotiana tabacum NtNRT1.1-s mRNA for nitrat...    80   3e-14   
gb:AB089677_1524914 Prunus persica PpNRT1 mRNA for nitrate trans...    80   3e-14   
gb:AB006698_1509860 Arabidopsis thaliana genomic DNA, chromosome...    80   3e-14   
pir|E86397|E86397 protein T7N9.14 [imported] - Arabidopsis thali...    80   3e-14   Arabidopsis thaliana [mouse-ear cress]
gb:NPL277084_1691078 Nicotiana plumbaginifolia mRNA for putative...    80   5e-14   
pir|G84829|G84829 probable PTR2 family peptide transporter [impo...    80   5e-14   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00129_1695376 Oryza sativa genomic DNA, chromosome 4, BAC...    80   6e-14   
gb:AY063897_1565844 Arabidopsis thaliana putative PTR2 family pe...    79   8e-14   
gb:AC130729_1740923 Oryza sativa (japonica cultivar-group) chrom...    79   1e-13   
gb:AC108502_1738512 Oryza sativa (japonica cultivar-group) chrom...    79   1e-13   
gb:AC105769_1738202 Oryza sativa (japonica cultivar-group) chrom...    78   2e-13   
gb:OSJN00129_1695375 Oryza sativa genomic DNA, chromosome 4, BAC...    78   2e-13   
gb:AP005175_1848772 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:AP003999_1836131 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:AE016959_1020642 Oryza sativa (japonica cultivar-group) chrom...    77   3e-13   
gb:AF361587_1791333 Arabidopsis thaliana AT3g53960/F5K20_260 mRN...    77   4e-13   
pir|T45936|T45936 transporter-like protein - Arabidopsis thalian...    77   4e-13   Arabidopsis thaliana [mouse-ear cress]
pir|T48587|T48587 peptide transporter-like protein - Arabidopsis...    77   4e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1020652 Oryza sativa (japonica cultivar-group) chrom...    76   7e-13   
pir|T52608|T52608 probable nitrate transporter [imported] - Arab...    76   7e-13   Arabidopsis thaliana [mouse-ear cress]
pir|F84663|F84663 probable nitrate transporter [imported] - Arab...    76   7e-13   Arabidopsis thaliana [mouse-ear cress]
gb:CSNITR1_1674000 Cucumis sativus mRNA for nitrite transporter ...    76   9e-13   
gb:AB102807_1526338 Nicotiana tabacum NtNRT1.2-s mRNA for nitrat...    76   9e-13   
gb:AE016959_1022199 Oryza sativa (japonica cultivar-group) chrom...    76   9e-13   
pir|T10255|T10255 nitrite transport protein, chloroplast - cucumber    76   9e-13   Cucumis sativus [cucumbers]
gb:AY035037_1559815 Arabidopsis thaliana putative oligopeptide t...    75   1e-12   
gb:AE016959_1023039 Oryza sativa (japonica cultivar-group) chrom...    75   1e-12   
pir|C96621|C96621 hypothetical protein F23H11.6 [imported] - Ara...    75   1e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AY099800_1576825 Arabidopsis thaliana putative nitrate transp...    75   1e-12   
gb:AB102808_1526339 Nicotiana tabacum NtNRT1.2-t mRNA for nitrat...    75   2e-12   
gb:NPL277085_1691079 Nicotiana plumbaginifolia mRNA for putative...    74   3e-12   
gb:AC130729_1740928 Oryza sativa (japonica cultivar-group) chrom...    74   3e-12   
gb:AJ843128_1814513 Plantago major mRNA for putative peptide tra...    74   4e-12   
gb:OSJN00292_1698070 Oryza sativa genomic DNA, chromosome 4, BAC...    73   6e-12   
gb:OSJN00175_1696208 Oryza sativa genomic DNA, chromosome 4, BAC...    73   6e-12   
gb:AC133002_1741235 Oryza sativa chromosome 11 BAC OJ1123_D06 ge...    73   7e-12   
gb:AY072134_1567028 Arabidopsis thaliana putative nitrate transp...    73   7e-12   
gb:AB052786_1521245 Glycine max mRNA for putative nitrate transp...    73   7e-12   
pir|C86397|C86397 protein T7N9.10 [imported] - Arabidopsis thali...    73   7e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP004778_1844948 Oryza sativa (japonica cultivar-group) genom...    72   1e-11   
pir|H96720|H96720 probable peptide transporter T17F3.11 [importe...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023773 Oryza sativa (japonica cultivar-group) chrom...    72   1e-11   
gb:AC144739_1744180 Oryza sativa (japonica cultivar-group) chrom...    71   2e-11   
gb:OSJN00149_1695685 Oryza sativa genomic DNA, chromosome 4, BAC...    71   2e-11   
gb:AP004994_1846927 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:AP004994_1846925 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:AF420016_1798605 Narcissus pseudonarcissus putative low-affin...    71   3e-11   
gb:AC133002_1741241 Oryza sativa chromosome 11 BAC OJ1123_D06 ge...    71   3e-11   
gb:AE016959_1023998 Oryza sativa (japonica cultivar-group) chrom...    71   3e-11   
gb:AE016959_1020935 Oryza sativa (japonica cultivar-group) chrom...    71   3e-11   
gb:AE016959_1023035 Oryza sativa (japonica cultivar-group) chrom...    70   4e-11   
gb:AE016959_1020662 Oryza sativa (japonica cultivar-group) chrom...    70   4e-11   
pir|E84798|E84798 probable peptide/amino acid transporter [impor...    70   4e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP004669_1843007 Oryza sativa (japonica cultivar-group) genom...    70   6e-11   
gb:AF213936_1777806 Prunus dulcis amino acid/peptide transporter...    69   8e-11   
gb:AP004669_1843010 Oryza sativa (japonica cultivar-group) genom...    69   1e-10   
gb:AP003566_1830929 Oryza sativa (japonica cultivar-group) genom...    69   1e-10   
gb:AC093018_1735829 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...    69   1e-10   
gb:BT000720_1634993 Arabidopsis thaliana clone RAFL09-73-M24 (R1...    69   1e-10   
gb:AY062453_1565109 Arabidopsis thaliana nitrate transporter (NT...    69   1e-10   
pir|G96720|G96720 nitrate transporter (NTL1), 53025-56402 [impor...    69   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00261_1697580 Oryza sativa genomic DNA, chromosome 4, BAC...    67   3e-10   
pir|T51361|T51361 nitrate transporter NTL1 [validated] - Arabido...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AP003372_1828661 Oryza sativa (japonica cultivar-group) genom...    67   5e-10   
gb:AB052787_1521246 Glycine max mRNA for putative nitrate transp...    66   9e-10   
gb:AGL488290_1811026 Alnus glutinosa mRNA for dicarboxylate tran...    65   1e-09   
gb:CAR489612_1645347 Cicer arietinum partial mRNA for nitrate tr...    65   1e-09   
gb:AP003630_1831755 Oryza sativa (japonica cultivar-group) genom...    65   2e-09   
gb:AP003076_1824650 Oryza sativa (japonica cultivar-group) genom...    65   2e-09   
gb:AP004750_1844346 Oryza sativa (japonica cultivar-group) genom...    65   2e-09   
gb:AC149302_1745016 Solanum demissum chromosome 11 clone PGEC400...    65   2e-09   
gb:AP003566_1830927 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AC149302_1745015 Solanum demissum chromosome 11 clone PGEC400...    64   3e-09   
gb:AC149302_1745014 Solanum demissum chromosome 11 clone PGEC400...    62   1e-08   
gb:BNU17987_1633659 Brassica napus RCH2 protein mRNA, complete cds.    62   1e-08   
gb:BNA278966_1633311 Brassica napus mRNA for nitrate transporter...    62   1e-08   
pir|T47505|T47505 hypothetical protein F9K21.230 - Arabidopsis t...    62   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP003621_1831573 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
gb:OSJN00261_1697577 Oryza sativa genomic DNA, chromosome 4, BAC...    61   2e-08   
gb:AB009053_1510684 Arabidopsis thaliana genomic DNA, chromosome...    60   4e-08   
pir|T47511|T47511 probable transporter protein - Arabidopsis tha...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T47506|T47506 hypothetical protein F9K21.240 - Arabidopsis t...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC028394_1979253 Homo sapiens solute carrier family 15, membe...    57   4e-07   
gb:AY050629_1935247 Homo sapiens peptide/histidine transporter m...    57   4e-07   
gb:AY038999_1934821 Homo sapiens peptide/histidine transporter (...    57   4e-07   
sp|Q05085|CHL1_ARATH|CHL1_ARATH Nitrate/chlorate transporter.>pir|A45772|A4...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AK117660_1815682 Arabidopsis thaliana At3g45680 mRNA for puta...    56   7e-07   
pir|T47508|T47508 probable transporter protein - Arabidopsis tha...    56   7e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T47512|T47512 probable transporter protein - Arabidopsis tha...    56   9e-07   Arabidopsis thaliana [mouse-ear cress]
gb:BC037974_1982267 Homo sapiens solute carrier family 15, membe...    55   1e-06   
gb:AB020598_1865221 Homo sapiens mRNA for peptide transporter 3,...    55   1e-06   
gb:AP003238_1825994 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:BC016233_2092243 Mus musculus solute carrier family 15, membe...    55   2e-06   
gb:BC056821_2552004 Danio rerio zgc:63767, mRNA (cDNA clone MGC:...    54   3e-06   
gb:AL627256_2504206 Zebrafish DNA sequence from clone RP71-1L10 ...    54   3e-06   
gb:BC087709_2110176 Rattus norvegicus peptide/histidine transpor...    54   3e-06   
gb:AB000280_2042987 Rattus norvegicus mRNA for peptide/histidine...    54   3e-06   
gb:BT005911_1638833 Arabidopsis thaliana At3g45700 gene, complet...    54   5e-06   
pir|T47510|T47510 probable transporter protein - Arabidopsis tha...    54   5e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AY050630_2074568 Mus musculus peptide/histidine transporter m...    52   1e-05   
gb:AC134342_1741730 Oryza sativa (japonica cultivar-group) chrom...    52   2e-05   
gb:AC003028_1530967 Arabidopsis thaliana chromosome 2 clone F16M...    52   2e-05   
pir|T01242|T01242 peptide transport protein homolog At2g38100 - ...    52   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:BC079971_2561410 Xenopus laevis MGC80026 protein, mRNA (cDNA ...    50   4e-05   
gb:AF000392_1760498 Lotus japonicus peptide transporter (LjNOD65...    50   5e-05   
gb:AF121080_2055355 Mus musculus cAMP inducible 1 protein (Ci1) ...    49   1e-04   
gb:AB026665_2044421 Rattus norvegicus mRNA for peptide histidine...    49   1e-04   
gb:AK051941_1169864 Mus musculus 12 days embryo eyeball cDNA, RI...    49   1e-04   
gb:AB026647_1517209 Arabidopsis thaliana genomic DNA, chromosome...    47   6e-04   
gb:AY187878_1588173 Zea mays nitrate transporter (Nrt1.1) mRNA, ...    45   0.002   
gb:AF080545_1766448 Nepenthes alata peptide transporter (PTR1) m...    44   0.005   
gb:AF461893_1151003 Homo sapiens FP12591 mRNA, complete cds.           44   0.005   
gb:HVU495773_1682726 Hordeum vulgare partial mRNA for putative p...    43   0.008   
gb:AY289623_1594950 Vicia faba peptide transporter 2 (PTR2) mRNA...    43   0.008   
gb:OSJN00261_1697578 Oryza sativa genomic DNA, chromosome 4, BAC...    40   0.040   
gb:BC026899_2095622 Mus musculus hypothetical protein 9830102E05...    40   0.052   
gb:AB026647_1517211 Arabidopsis thaliana genomic DNA, chromosome...    40   0.052   
gb:AY679588_1622018 Fragaria x ananassa putative nitrate transpo...    39   0.089   
gb:AK036413_1164464 Mus musculus adult male bone cDNA, RIKEN ful...    39   0.12    
gb:AE014298_1124220 Drosophila melanogaster chromosome X, comple...    37   0.34    
pir|T21870|T21870 hypothetical protein F36G9.13 - Caenorhabditis...    37   0.34    Caenorhabditis elegans [roundworm]
gb:SSU37262_191478 Serratia sp. MK1 phospholipase A1 (plaA) and ...    36   0.99    
gb:AE017340_457551 Idiomarina loihiensis L2TR, complete genome.        35   1.3     
pir|T47509|T47509 probable transporter protein - Arabidopsis tha...    35   1.3     Arabidopsis thaliana [mouse-ear cress]
gb:DMU97114_1381143 Drosophila melanogaster opt1 (opt) gene, alt...    35   1.7     
gb:DMU97114_1381142 Drosophila melanogaster opt1 (opt) gene, alt...    35   1.7     
gb:AF181635_1248302 Drosophila melanogaster BcDNA.GH06717 (BcDNA...    35   1.7     
gb:AE014298_1124221 Drosophila melanogaster chromosome X, comple...    35   1.7     
pir|T13674|T13674 hypothetical protein EG0002.1 - fruit fly (Dro...    35   1.7     Drosophila melanogaster
pir|T13673|T13673 hypothetical protein EG0002.1 - fruit fly (Dro...    35   1.7     Drosophila melanogaster
sp|P91679|OPT1_DROME|OPT1_DROME Oligopeptide transporter 1 (YIN protein).>g...    35   1.7     Drosophila melanogaster
gb:AY058467_1291621 Drosophila melanogaster GH27264 full length ...    35   2.2     
gb:AE014298_1124219 Drosophila melanogaster chromosome X, comple...    35   2.2     
gb:AE014298_1124218 Drosophila melanogaster chromosome X, comple...    35   2.2     
gb:AE014298_1124217 Drosophila melanogaster chromosome X, comple...    35   2.2     
gb:AY289935_1942819 Macaca mulatta proton-dependent dipeptide tr...    34   3.8     
gb:AL158049_1921262 Human DNA sequence from clone RP3-482C21 on ...    33   4.9     
gb:AL158049_1921261 Human DNA sequence from clone RP3-482C21 on ...    33   4.9     
gb:YSCPTR2_1730389 Saccharomyces cerevisiae S288C permease (PTR2...    33   4.9     
gb:CQ782927_1452217 Sequence 3067 from Patent EP1396543.>gb:AK07...    33   4.9     
sp|P32901|PTR2_YEAST|PTR2_YEAST Peptide transporter PTR2 (Peptide permease ...    33   4.9     Saccharomyces cerevisiae [brewer's yeast]
gb:AP005878_1859539 Oryza sativa (japonica cultivar-group) genom...    33   6.4     
gb:AF257711_2060757 Mus musculus proton-dependent high affinity ...    33   8.4     
gb:AF111811_2054910 Mus musculus proton-dependent high affinity ...    33   8.4     
pir|JC7501|JC7501 oligopeptide transporter PEPT2, kidney isoform...    33   8.4     Mus musculus [mouse]


>gb:AY099590_1576615 Arabidopsis thaliana putative transport protein
           (At3g16180) mRNA, partial cds.
          Length = 579

 Score =  159 bits (402), Expect = 6e-38
 Identities = 80/182 (43%), Positives = 107/182 (58%), Gaps = 3/182 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct: 390 WVVLYDRAILPLASKIRGRPVRVNVKIRMGLGLFISFLAMAVSATVEHYRRKTAISQGLA 449

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           +D      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+I             
Sbjct: 450 NDANSTVSISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN 509

Query: 361 XXXXXINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                I     NS   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct: 510 ILASVILNAVKNSSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTV 569

Query: 532 DE 537
           D+
Sbjct: 570 DQ 571



>gb:AB012247_1511830 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MSL1.
          Length = 541

 Score =  159 bits (402), Expect = 6e-38
 Identities = 80/182 (43%), Positives = 107/182 (58%), Gaps = 3/182 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+VLYDR +LP+AS+IRG  V    K RMG G+F+SF    +   VE  RR  AI Q  +
Sbjct: 340 WVVLYDRAILPLASKIRGRPVRVNVKIRMGLGLFISFLAMAVSATVEHYRRKTAISQGLA 399

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           +D      +S +W+VPQY L G+A     + Q +FF +EFP+SMS+I             
Sbjct: 400 NDANSTVSISAMWLVPQYVLHGLAEALTGIGQTEFFYTEFPKSMSSIAASLFGLGMAVAN 459

Query: 361 XXXXXINELSINS---GNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                I     NS   GN SWI  +IN+GHYDY+YWVLA LS VN + +++CS SYGP+ 
Sbjct: 460 ILASVILNAVKNSSKQGNVSWIEDNINKGHYDYYYWVLAILSFVNVIYYVVCSWSYGPTV 519

Query: 532 DE 537
           D+
Sbjct: 520 DQ 521



>gb:AY058204_1564338 Arabidopsis thaliana At1g52190/F9I5_4 mRNA,
           complete cds.>gb:AY098981_1576541 Arabidopsis thaliana
           At1g52190/F9I5_4 mRNA, complete cds.
          Length = 265

 Score =  159 bits (401), Expect = 8e-38
 Identities = 74/183 (40%), Positives = 112/183 (61%), Gaps = 4/183 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W++LYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR  AI Q ++
Sbjct: 48  WVILYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVESFRRKKAISQGYA 107

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXX 348
           +++     +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+I             
Sbjct: 108 NNSNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS 167

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    +NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct: 168 LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL 227

Query: 529 KDE 537
            D+
Sbjct: 228 VDQ 230



>pir|H96561|H96561 probable peptide transporter [imported] -
           Arabidopsis thaliana>gb:AE005173_893132 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC022354_1538914 Arabidopsis thaliana
           chromosome 1 BAC F9I5 genomic sequence, complete
           sequence.
          Length = 607

 Score =  159 bits (401), Expect = 8e-38
 Identities = 74/183 (40%), Positives = 112/183 (61%), Gaps = 4/183 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W++LYDR ++P+AS+IRG       K RMG G+F+SF    +   VES RR  AI Q ++
Sbjct: 390 WVILYDRAVIPLASKIRGRPFRLSVKLRMGLGLFMSFLAMAISAMVESFRRKKAISQGYA 449

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXX 348
           +++     +S +W+VPQY L G+A    A+ Q +FF +EFP+SMS+I             
Sbjct: 450 NNSNAVVDISAMWLVPQYVLHGLAEALTAIGQTEFFYTEFPKSMSSIAASLFGLGMAVAS 509

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    +NEL+  +G  SW++ +IN+GHY+Y+YWVLA +S +N + ++ICS SYGP 
Sbjct: 510 LLASVVLNAVNELTSRNGKESWVSDNINKGHYNYYYWVLAIMSFINVIYYVICSWSYGPL 569

Query: 529 KDE 537
            D+
Sbjct: 570 VDQ 572



>gb:AF377946_1793296 Oryza sativa (japonica cultivar-group)
           chromosome 3, BAC clone OSJNBa0031O09, complete
           sequence.
          Length = 377

 Score =  108 bits (271), Expect = 9e-23
 Identities = 57/181 (31%), Positives = 90/181 (49%), Gaps = 4/181 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ LYD +L+P+A R  GN        RMG G+ +S  +++    V  I+R    + EH 
Sbjct: 196 WVPLYDSILVPIARRFTGNPRGFTELQRMGIGLVISI-FSMAAAAVLEIKRLDIARAEHL 254

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
            D      ++I W +PQY L+G +     V   +FF  + P +M ++             
Sbjct: 255 VDQNVPVPLNICWQIPQYFLVGASEVFTFVGSLEFFYDQSPDAMRSLCSALQLVTTALGN 314

Query: 361 XXXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                I  L    +   GN  WI  ++N+GH DYF+W+LAGLS +NF++++IC+  Y   
Sbjct: 315 YLSAFILTLVAYFTTRGGNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICANKYKSK 374

Query: 529 K 531
           K
Sbjct: 375 K 375



>gb:AB067652_1522599 Oryza sativa (japonica cultivar-group) OsPTR1
           mRNA for peptide transporter, complete
           cds.>gb:AB067653_1522600 Oryza sativa (japonica
           cultivar-group) OsPTR1 gene for peptide transporter,
           complete cds.>gb:AC147426_1744673 Oryza sativa
           chromosome 3 B1377B10 genomic sequence, complete
           sequence.
          Length = 593

 Score =  108 bits (271), Expect = 9e-23
 Identities = 57/181 (31%), Positives = 90/181 (49%), Gaps = 4/181 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ LYD +L+P+A R  GN        RMG G+ +S  +++    V  I+R    + EH 
Sbjct: 412 WVPLYDSILVPIARRFTGNPRGFTELQRMGIGLVISI-FSMAAAAVLEIKRLDIARAEHL 470

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
            D      ++I W +PQY L+G +     V   +FF  + P +M ++             
Sbjct: 471 VDQNVPVPLNICWQIPQYFLVGASEVFTFVGSLEFFYDQSPDAMRSLCSALQLVTTALGN 530

Query: 361 XXXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                I  L    +   GN  WI  ++N+GH DYF+W+LAGLS +NF++++IC+  Y   
Sbjct: 531 YLSAFILTLVAYFTTRGGNPGWIPDNLNQGHLDYFFWLLAGLSFLNFVIYVICANKYKSK 590

Query: 529 K 531
           K
Sbjct: 591 K 591



>gb:AP003256_1826467 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0460E08.>gb:AP003274_1826979 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0512C01.
          Length = 574

 Score =  107 bits (268), Expect = 2e-22
 Identities = 62/178 (34%), Positives = 82/178 (46%), Gaps = 4/178 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W   YDR   P   R+ GN      K R+G G+            VE+ RR  A      
Sbjct: 387 WSGCYDRWTAPALRRLTGNPRGLTMKQRIGGGLVFGTAAMAAAAVVEAARRRQA------ 440

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
              LG   MS  W+VPQYAL G+A     +   +FF +E P+SM++              
Sbjct: 441 ---LGGGGMSAFWLVPQYALAGLAEAFGVIGVIEFFYTELPKSMASFSMALLYMALGAGS 497

Query: 361 XXXXXI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG 522
                I    +E+S   G  SW+  D+N G YDY+YW+LAGL  VNF+ FL C  +YG
Sbjct: 498 LVGSLIIKLVHEVSGRRGRTSWLAEDLNAGRYDYYYWLLAGLGAVNFVYFLWCGWAYG 555



>pir|T48516|T48516 probable oligopeptide transporter protein -
           Arabidopsis thaliana>gb:ATF15N18_1548744 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F15N18 (ESSA
           project).
          Length = 481

 Score =  107 bits (268), Expect = 2e-22
 Identities = 60/171 (35%), Positives = 87/171 (50%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           LYD +++P+ S         G   RM  G  +S      +   E  RR  A       D 
Sbjct: 314 LYDLVIVPLLSWALREPFRLGVMVRMWAGYVISVLCISALAATEYARRKTA------RDE 367

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
            G +K+S +W++P   L GIA   N +AQN+FF SE P++MS++                
Sbjct: 368 SG-TKLSAMWLLPYMILGGIAEALNTIAQNEFFYSELPKTMSSVATTLSSLNMAAASLIS 426

Query: 370 XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG 522
             I  +   +  GSWIT +I+EGH DY+YW+L GLS++N L F+ C +SYG
Sbjct: 427 SWIITIVDVTTYGSWITENIDEGHLDYYYWLLVGLSLLNVLYFVWCKKSYG 477



>gb:AP003436_1829384 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0470A12.
          Length = 600

 Score =  105 bits (261), Expect = 1e-21
 Identities = 59/177 (33%), Positives = 91/177 (51%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDR+L+P+A    G         R G G+ +S    V+ G VE  RR+ A+     
Sbjct: 396 FIPIYDRILVPIARGFTGVESGITLLQRQGIGLAISPISMVVAGLVERKRRNSALS---- 451

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXX 348
             N G S MS+LW+ PQ  LMGIA   NAV Q +F+  +FP +M T+             
Sbjct: 452 --NGGISPMSVLWLAPQLVLMGIAEAFNAVGQIEFYNKQFPENMQTLAGSLFFCTIAGAN 509

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    + +++   G+ SW+T +IN G  DY+++ +A + ++N + FLICS  Y
Sbjct: 510 YLSTALANIMRKVTTRDGHSSWLTDNINLGKLDYYFYFIALMGVLNLIYFLICSHFY 566



>gb:AB052785_1521244 Glycine max mRNA for nitrate transporter
           NRT1-2, complete cds.
          Length = 605

 Score =  104 bits (260), Expect = 2e-21
 Identities = 55/179 (30%), Positives = 91/179 (50%), Gaps = 6/179 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YDR+L+P   R+           R+GFG+F+S    ++ G VE  RR+LA+     
Sbjct: 398 WLPIYDRILVPSLQRVTKKEGGITVLQRIGFGMFLSILCTMVSGVVEERRRTLALTNPIG 457

Query: 181 SDNLGD--SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXX----XX 342
            +      S MS LW+VPQ  L G++     V Q +FF  +FP +M ++           
Sbjct: 458 LEPRKGAISSMSGLWLVPQLTLAGLSDAFAIVGQVEFFYKQFPENMKSLAASLFFCGLAG 517

Query: 343 XXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                      I+  +  S  G+W+  D+N+G  DYFY+++  L++VNF  F++C++ Y
Sbjct: 518 SSYLSSLLISIIHRATAKSSTGNWLPQDLNKGRLDYFYYIITALAVVNFGYFILCAKWY 576



>gb:AB020751_1514667 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRG21.
          Length = 616

 Score =  103 bits (257), Expect = 4e-21
 Identities = 59/180 (32%), Positives = 94/180 (52%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH- 177
           +IV+YDR+L+P   RI G         R+G GIF +    V+ G VE  RR+ A+ +   
Sbjct: 410 FIVVYDRVLVPTMRRITGLDTGITLLQRIGTGIFFATASLVVAGFVEERRRTFALTKPTL 469

Query: 178 -SSDNLGD-SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXX 339
             +   G+ S MS +W++PQ +L G+A    A+ Q +F+  +FP +M     +I      
Sbjct: 470 GMAPRKGEISSMSAMWLIPQLSLAGVAEAFAAIGQMEFYYKQFPENMRSFAGSIFYVGGG 529

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       ++  + NS  G+W+  D+N+G  D FY+++AG+  VNF  FL+ SR Y
Sbjct: 530 VSSYLGSFLIATVHRTTQNSSGGNWLAEDLNKGRLDLFYFMIAGILAVNFAYFLVMSRWY 589



>gb:AP003256_1826468 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0460E08.>gb:AP003274_1826980 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0512C01.
          Length = 590

 Score =  103 bits (256), Expect = 5e-21
 Identities = 59/194 (30%), Positives = 97/194 (50%), Gaps = 8/194 (4%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQ--- 171
           W+ +YDR L+   SR+ G+      + RMG G+ +      +  + E+ RR+ A+ +   
Sbjct: 382 WVAVYDRALVRPLSRLTGHARGVTLRQRMGIGLALFAVAMAVAARTEAARRAEALAEGLR 441

Query: 172 EHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXX 351
           ++   +    +MS + +VPQ+ + G+A   N + Q +F+ SEFP++MS+I          
Sbjct: 442 DYGPQSGRAVRMSAMRLVPQHCITGLAEALNLIGQIEFYYSEFPKTMSSIGVSLLALGMG 501

Query: 352 XXXXXXXXIN---ELSINSGNG--SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRS 516
                   I         SG G  SW++S++N GHYDY+Y VLA L + N   F+ C  +
Sbjct: 502 FGSVAGSAIVGAINAGTRSGGGRDSWLSSNLNRGHYDYYYLVLAALCVANLAYFVWCGWA 561

Query: 517 YGPSKDEKPVAMEE 558
           YG     +  A EE
Sbjct: 562 YGEEGQNRVTAEEE 575



>gb:BT005728_1638663 Arabidopsis thaliana clone RAFL15-01-K12
           (R20132) putative oligopeptide transporter protein
           (At5g01180) mRNA, partial cds.
          Length = 512

 Score = 99.4 bits (246), Expect = 7e-20
 Identities = 55/177 (31%), Positives = 88/177 (49%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W  +YD+L++P A +  G+        R+G G+ +S +  V  G +E  R  L   Q H+
Sbjct: 328 WAPVYDKLIVPFARKYTGHERGFTQLQRIGIGLVISIFSMVSAGILEVAR--LNYVQTHN 385

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
             N     M+I W VPQY L+G A     + Q +FF  + P +M    S +         
Sbjct: 386 LYNEETIPMTIFWQVPQYFLVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTAIAFGN 445

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    + +++ + G   WI  ++N GH DYF+W+LAGLS +NFL++L  ++ Y
Sbjct: 446 YLSTFLVTLVTKVTRSGGRPGWIAKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWY 502



>pir|T45958|T45958 oligopeptide transporter-like protein -
           Arabidopsis thaliana>gb:ATF7J8_1550997 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F7J8 (ESSA
           project).
          Length = 570

 Score = 99.4 bits (246), Expect = 7e-20
 Identities = 55/177 (31%), Positives = 88/177 (49%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W  +YD+L++P A +  G+        R+G G+ +S +  V  G +E  R  L   Q H+
Sbjct: 386 WAPVYDKLIVPFARKYTGHERGFTQLQRIGIGLVISIFSMVSAGILEVAR--LNYVQTHN 443

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
             N     M+I W VPQY L+G A     + Q +FF  + P +M    S +         
Sbjct: 444 LYNEETIPMTIFWQVPQYFLVGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTAIAFGN 503

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    + +++ + G   WI  ++N GH DYF+W+LAGLS +NFL++L  ++ Y
Sbjct: 504 YLSTFLVTLVTKVTRSGGRPGWIAKNLNNGHLDYFFWLLAGLSFLNFLVYLWIAKWY 560



>gb:AC092779_1735702 Oryza sativa chromosome 3 BAC OSJNBb0024N19
           genomic sequence, complete sequence.
          Length = 587

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 55/178 (30%), Positives = 88/178 (49%), Gaps = 5/178 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           WI +YDRLL+P   R+ G         R G GI +S    V+   VE  RR +A+ Q   
Sbjct: 402 WIPIYDRLLVPRLRRVTGKDEGLTLLQRQGIGIALSTVAMVMSAVVEDRRRHIALTQPTL 461

Query: 181 SDNLGD---SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXX-XXX 348
              +     S MS LW+VPQ  ++G++   N ++Q +F+  E P  M ++          
Sbjct: 462 GTTITGGAISAMSSLWMVPQLMVLGLSEAFNLISQIEFYYKEIPEHMRSVAGALAFCNLA 521

Query: 349 XXXXXXXXXINELSINSGNGS-WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +  +   +G GS W+  D+N+G  D FYW++AG+ + N + F+IC++ Y
Sbjct: 522 LGNYLSGFLVTIVHRTTGAGSNWLAQDLNKGRLDLFYWMIAGIGIFNIIYFMICAKWY 579



>gb:AB052784_1521243 Glycine max mRNA for nitrate transporter
           NRT1-1, complete cds.
          Length = 597

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 53/179 (29%), Positives = 88/179 (49%), Gaps = 6/179 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YDR+L+P   R+           R+GFG+F+S    ++ G VE  RR+LA+     
Sbjct: 390 WLPIYDRILVPSLQRVTKKEGGITVLQRIGFGMFLSILCTMVSGVVEERRRTLALTNPIG 449

Query: 181 SDNLGD--SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXX----XX 342
            +      S MS LW+VPQ  L G++     V Q +FF  +FP +M ++           
Sbjct: 450 LEPRKGAISSMSGLWLVPQLTLAGLSDAFAIVGQVEFFYKQFPENMKSLAASLFFCGLAG 509

Query: 343 XXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                      I+  +  S  G+W+  D+N+G  D  Y+++  L +VNF  F++C++ Y
Sbjct: 510 SSYLSSLLISIIHRATAKSSTGNWLPQDLNKGRLDRLYYIITALEVVNFGYFILCAKWY 568



>gb:AP004993_1846907 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0037N01.>gb:AP005382_1850697 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1001_B06.
          Length = 597

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 54/176 (30%), Positives = 85/176 (48%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           ++ YDR+L+P+A R+ G         RMG G  +S    ++ G VE  RR  A      +
Sbjct: 395 LLAYDRVLVPLARRVTGLDRGISYLHRMGVGFAISVAATLVAGFVERHRRESAAAA--GT 452

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXXX 351
            + G S +S  W+VPQYAL G+A   N+V   +F   + P SM ++              
Sbjct: 453 TDAGTSPLSAYWLVPQYALHGMAEAFNSVGHLEFMYDQSPESMRSMATALFWLSISLGSY 512

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   ++  S  +   +W+  +IN G  DYFYW++A L ++N   + IC+R Y
Sbjct: 513 VSTMLISAVHRWSAGADGSNWLPDNINRGRLDYFYWIVALLQVLNLAYYAICARCY 568



>gb:AP005173_1848761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0003E08.
          Length = 618

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 53/180 (29%), Positives = 86/180 (47%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           WI LYDRL++P A R+ G         RMG G+ +S    ++    E  RR LA     +
Sbjct: 412 WIPLYDRLVVPWARRLTGREGGITPLQRMGVGMALSVLAMLVAAMAEKRRRDLAAGSPSN 471

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           +  +  S+ S  W+VPQ A +G++   N V+Q +F+  EFP SM ++             
Sbjct: 472 TGRV--SRQSAFWLVPQLAALGLSEAFNQVSQTEFYYREFPESMRSVAGSVLFSGLALSS 529

Query: 361 XXXXXI-------NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +          +    +G W+  D+N+G  D+FY ++A +   NFL F+ C++ Y
Sbjct: 530 YLSGVLVAAVERATRGASAGDDGGWLAEDLNKGRLDWFYLLIAAIGAANFLAFVACAKWY 589



>pir|T04378|T04378 peptide transport protein -
           barley>gb:AF023472_1762048 Hordeum vulgare peptide
           transporter (ptr1) mRNA, complete cds.
          Length = 579

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 58/197 (29%), Positives = 95/197 (48%), Gaps = 11/197 (5%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIR-RSLAIKQEH 177
           W+ +YDR+L+P    + G         RMG G+ VS +  +  G +E +R R++A    +
Sbjct: 385 WVPVYDRILVPAVRSVTGRPRGFTQLQRMGIGLVVSMFAMLAAGVLELVRLRTIAQHGLY 444

Query: 178 SSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXX 345
              ++    +SI W VPQY ++G A     V Q +FF  + P +M    S +        
Sbjct: 445 GEKDV--VPISIFWQVPQYFIIGCAEVFTFVGQLEFFYDQAPDAMRSMCSALSLTTVALG 502

Query: 346 XXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY-- 519
                     + +++   G   WI  ++N GH DYF+W+LA LS+VNF ++L+ +  Y  
Sbjct: 503 NYLSTLLVTVVAKVTTRGGKQGWIPDNLNVGHLDYFFWLLAALSLVNFAVYLLIASWYTY 562

Query: 520 ----GPSKDEKPVAMEE 558
               G S D K  A ++
Sbjct: 563 KKTAGDSPDAKGGAHDQ 579



>pir|T47573|T47573 peptide transport-like protein - Arabidopsis
           thaliana>gb:ATF24B22_1549823 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24B22.>gb:AY084773_1569857
           Arabidopsis thaliana clone 117581 mRNA, complete
           sequence.>gb:AY113884_1578295 Arabidopsis thaliana
           putative peptide transport protein (At3g54140) mRNA,
           complete cds.>gb:AF360155_1791111 Arabidopsis thaliana
           putative peptide transport protein (At3g54140) mRNA,
           complete cds.
          Length = 570

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 52/177 (29%), Positives = 88/177 (49%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W  +YD+ ++P+A +   N        RMG G+ VS +  +  G +E +R  L   + H+
Sbjct: 386 WTPVYDQFIIPLARKFTRNERGFTQLQRMGIGLVVSIFAMITAGVLEVVR--LDYVKTHN 443

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
           + +     MSI W +PQY L+G A     + Q +FF  + P +M    S +         
Sbjct: 444 AYDQKQIHMSIFWQIPQYLLIGCAEVFTFIGQLEFFYDQAPDAMRSLCSALSLTTVALGN 503

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    + +++  +G   WI  ++N GH DYF+++LA LS +NFL++L  S+ Y
Sbjct: 504 YLSTVLVTVVMKITKKNGKPGWIPDNLNRGHLDYFFYLLATLSFLNFLVYLWISKRY 560



>gb:AY090257_1574009 Arabidopsis thaliana At1g69870/T17F3_10 mRNA,
           complete cds.>gb:AY125531_1580336 Arabidopsis thaliana
           At1g69870/T17F3_10 mRNA, complete cds.
          Length = 620

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++  YDR+ +P   RI G+        R+G GI  + +  ++ G VE +RR   I+  ++
Sbjct: 418 FLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIVERMRR---IRSINA 474

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIX----XXXXXXXX 348
            D  G + MS+ W+ PQ  LMG+    N + Q +FF S+FP  M +I             
Sbjct: 475 GDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFPEHMRSIANSLFSLSFAGSS 534

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +++ S       W+  ++N G  DYFY+++A L +VN + F  C+R Y
Sbjct: 535 YLSSFLVTVVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAVLGVVNLVYFWYCARGY 591



>pir|S46236|S46236 histidine transport protein - Arabidopsis
           thaliana>gb:ATLBNT1_1553564 Arabadopsis thaliana
           Landsberg NT1 mRNA.
          Length = 586

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 55/187 (29%), Positives = 86/187 (45%), Gaps = 10/187 (5%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ LYDR ++P+A +  G         RMG G+FVS         VE IR        H 
Sbjct: 404 WVPLYDRFIVPLARKFTGVDKGFTEIQRMGIGLFVSVLCMAAAAIVEIIRL-------HM 456

Query: 181 SDNLG------DSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXX 330
           +++LG         +S+LW +PQY ++G A     + Q +FF  + P +M    S +   
Sbjct: 457 ANDLGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALL 516

Query: 331 XXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICS 510
                          +   +  +G   WI+ ++N GH DYF+W+LAGLS+VN  ++   +
Sbjct: 517 TNALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFFWLLAGLSLVNMAVYFFSA 576

Query: 511 RSYGPSK 531
             Y   K
Sbjct: 577 ARYKQKK 583



>pir|A96721|A96721 probable peptide transporter T17F3.10 [imported]
           - Arabidopsis thaliana>gb:AE005173_894571 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537003 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 644

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++  YDR+ +P   RI G+        R+G GI  + +  ++ G VE +RR   I+  ++
Sbjct: 442 FLPFYDRVFVPFMRRITGHKSGITLLQRIGTGIVFAIFSMIVAGIVERMRR---IRSINA 498

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIX----XXXXXXXX 348
            D  G + MS+ W+ PQ  LMG+    N + Q +FF S+FP  M +I             
Sbjct: 499 GDPTGMTPMSVFWLSPQLILMGLCEAFNIIGQIEFFNSQFPEHMRSIANSLFSLSFAGSS 558

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +++ S       W+  ++N G  DYFY+++A L +VN + F  C+R Y
Sbjct: 559 YLSSFLVTVVHKFSGGHDRPDWLNKNLNAGKLDYFYYLIAVLGVVNLVYFWYCARGY 615



>sp|P46032|PT2B_ARATH Peptide transporter PTR2-B (Histidine
           transporting protein).>pir|C84432|C84432 histidine
           transport protein (PTR2-B) [imported] - Arabidopsis
           thaliana>gb:AC006532_1534374 Arabidopsis thaliana
           chromosome 2 clone F14H20 map CIC11A04, complete
           sequence.>gb:ATHATPT_1553051 Arabidopsis thaliana
           transport protein (PTR2-B) mRNA, complete
           cds.>gb:AY143954_1583411 Arabidopsis thaliana
           At2g02040/F14H20.11 mRNA, complete
           cds.>gb:AF372946_1792661 Arabidopsis thaliana
           At2g02040/F14H20.11 mRNA, complete cds.
          Length = 585

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 55/187 (29%), Positives = 86/187 (45%), Gaps = 10/187 (5%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ LYDR ++P+A +  G         RMG G+FVS         VE IR        H 
Sbjct: 403 WVPLYDRFIVPLARKFTGVDKGFTEIQRMGIGLFVSVLCMAAAAIVEIIRL-------HM 455

Query: 181 SDNLG------DSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXX 330
           +++LG         +S+LW +PQY ++G A     + Q +FF  + P +M    S +   
Sbjct: 456 ANDLGLVESGAPVPISVLWQIPQYFILGAAEVFYFIGQLEFFYDQSPDAMRSLCSALALL 515

Query: 331 XXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICS 510
                          +   +  +G   WI+ ++N GH DYF+W+LAGLS+VN  ++   +
Sbjct: 516 TNALGNYLSSLILTLVTYFTTRNGQEGWISDNLNSGHLDYFFWLLAGLSLVNMAVYFFSA 575

Query: 511 RSYGPSK 531
             Y   K
Sbjct: 576 ARYKQKK 582



>gb:AF428467_1799397 Arabidopsis thaliana AT3g47960/T17F15_170 mRNA,
           complete cds.
          Length = 606

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH- 177
           +I+ YDR+L+P   R+ G         R+G G   +    ++ G +E  RR+ A+ +   
Sbjct: 396 FIIFYDRVLVPSLRRVTGLETGISLLQRIGAGFTFAIMSLLVSGFIEERRRNFALTKPTL 455

Query: 178 -SSDNLGD-SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST----IXXXXXX 339
             +   G+ S MS LW++PQ  L GIA    A+ Q +F+  +FP +M +    I      
Sbjct: 456 GMAPRTGEISSMSALWLIPQLTLAGIAEAFAAIGQMEFYYKQFPENMKSFAGSIFYVGAG 515

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       ++  + +S +G+W+  D+N+   DYFY++L GL +VN   FL+ +R Y
Sbjct: 516 VSSYLASFLISTVHRTTAHSPSGNWLAEDLNKAKLDYFYFMLTGLMVVNMAYFLLMARWY 575



>gb:AF370202_1792090 Arabidopsis thaliana putative peptide
           transporter protein (At3g47960) mRNA, complete cds.
          Length = 606

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH- 177
           +I+ YDR+L+P   R+ G         R+G G   +    ++ G +E  RR+ A+ +   
Sbjct: 396 FIIFYDRVLVPSLRRVTGLETGISLLQRIGAGFTFAIMSLLVSGFIEERRRNFALTKPTL 455

Query: 178 -SSDNLGD-SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST----IXXXXXX 339
             +   G+ S MS LW++PQ  L GIA    A+ Q +F+  +FP +M +    I      
Sbjct: 456 GMAPRTGEISSMSALWLIPQLTLAGIAEAFAAIGQMEFYYKQFPENMKSFAGSIFYVGAG 515

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       ++  + +S +G+W+  D+N+   DYFY++L GL +VN   FL+ +R Y
Sbjct: 516 VSSYLASFLISTVHRTTAHSPSGNWLAEDLNKAKLDYFYFMLTGLMVVNMAYFLLMARWY 575



>pir|T06687|T06687 probable peptide transport protein T17F15.170 -
           Arabidopsis thaliana>gb:ATT17F15_1554708 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T17F15.
          Length = 636

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 53/180 (29%), Positives = 90/180 (50%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH- 177
           +I+ YDR+L+P   R+ G         R+G G   +    ++ G +E  RR+ A+ +   
Sbjct: 426 FIIFYDRVLVPSLRRVTGLETGISLLQRIGAGFTFAIMSLLVSGFIEERRRNFALTKPTL 485

Query: 178 -SSDNLGD-SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST----IXXXXXX 339
             +   G+ S MS LW++PQ  L GIA    A+ Q +F+  +FP +M +    I      
Sbjct: 486 GMAPRTGEISSMSALWLIPQLTLAGIAEAFAAIGQMEFYYKQFPENMKSFAGSIFYVGAG 545

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       ++  + +S +G+W+  D+N+   DYFY++L GL +VN   FL+ +R Y
Sbjct: 546 VSSYLASFLISTVHRTTAHSPSGNWLAEDLNKAKLDYFYFMLTGLMVVNMAYFLLMARWY 605



>pir|T51439|T51439 oligopeptide transporter-like protein -
           Arabidopsis thaliana>gb:ATF2G14_1550442 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F2G14 (ESSA
           project).
          Length = 552

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 53/180 (29%), Positives = 89/180 (49%), Gaps = 5/180 (2%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           YD++L+P+A ++  N      K RMG G+F+S    V+   VE  R  ++ K   ++ NL
Sbjct: 368 YDKILIPIAKKLTKNEKGISVKERMGIGMFLSIIAIVIAALVERKRLKIS-KMMKTTPNL 426

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXX 372
               +SILW++PQY L+GI+     V   +FF SE P SM T+                 
Sbjct: 427 --DPVSILWLLPQYILLGISDIFTVVGMQEFFYSEVPVSMRTMGFALYTSVFGVGSFVSA 484

Query: 373 XINEL-----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE 537
            +  +     S   G  +W   D++E   D +YW+LA  S ++FL++++  + +    D+
Sbjct: 485 ALISIIETYTSSRGGKHNWFADDMSEARLDNYYWLLAFTSAISFLMYIVICKHFKSRSDD 544



>gb:AY570975_1178672 Xerophyta humilis clone HC323 nitrate
           transporter mRNA, partial cds.
          Length = 275

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 47/180 (26%), Positives = 91/180 (50%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH- 177
           WI +YDR+++P   ++ G         RMG G+ ++    V+   +E  RRS AI +   
Sbjct: 69  WIPIYDRIIVPRFRKLTGQEGGITLLQRMGVGLVLAIIGMVVSAIIEIQRRSYAIHRPTI 128

Query: 178 --SSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXX 351
             +      S MS LW++PQ  ++G++   NA+ Q +F+  +FP +M ++          
Sbjct: 129 GTAPSGGAISSMSSLWLIPQLVILGLSEAFNAIGQIEFYYKQFPENMRSVAGSLFFLGAA 188

Query: 352 XXXXXXXX----INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       ++ ++      +W+  D+N+G  DY+Y+ +AGL ++N + F++C++ Y
Sbjct: 189 TANYLSGALIGVVHRVTGRGAGKNWLAGDLNKGRLDYYYFFIAGLGVLNLVYFMMCAKWY 248



>gb:AB052788_1521247 Glycine max mRNA for nitrate transporter
           NRT1-5, partial cds.
          Length = 572

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 54/180 (30%), Positives = 89/180 (49%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVA-SRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH 177
           W+ +YDR+++P + S     +         G GIF+S    ++ G VE  RRSLA+    
Sbjct: 374 WLPIYDRIVVPFSLSNTPEKSGGITLLQSDGIGIFISALCMIVAGVVEEHRRSLALTNPI 433

Query: 178 SSDNLGD--SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXX----X 339
                    S MS LW++PQ +L G++    AV Q +F+  +FP +M +I          
Sbjct: 434 GVQPRKGAISSMSGLWLIPQLSLAGLSESFTAVGQVEFYYKQFPENMRSIAGSLFYCGMA 493

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       ++  S  S  G+W+  D+N+G  D+FY+++A L ++N   FL+CS+ Y
Sbjct: 494 GSSYLSTLLISIVHNTSEKSATGNWLPEDLNKGRLDFFYYMIAALEIMNLGYFLLCSKWY 553



>gb:AP003791_1833396 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1065G12.>gb:AP006757_1862932 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551C06.
          Length = 545

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 49/174 (28%), Positives = 81/174 (46%), Gaps = 1/174 (0%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ LYDR ++P+A R+  +       +RMG G+ +        G +E+ RR L       
Sbjct: 377 WVALYDRAIVPLARRVTRHDGGFTQLARMGVGLVILTVAMAAAGALEAARRRLI------ 430

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
                 ++ S+ W VPQYA++G +     + Q +FF  + P +M ++             
Sbjct: 431 ------ARPSVFWQVPQYAVVGASEVFTLIGQMEFFYDQAPDAMRSLCSALSSTSFALGD 484

Query: 361 XXXXXINELSINSGNG-SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +  ++   G    WI  DIN GH DYF+W+L  L + NF  +L+ +R Y
Sbjct: 485 YASSALVVVAARRGGAPGWIPDDINRGHLDYFFWLLTALCVANFAAYLLIARWY 538



>gb:AF016713_1761512 Lycopersicon esculentum oligopeptide
           transporter (LeOPT1) mRNA, complete cds.
          Length = 580

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 51/181 (28%), Positives = 82/181 (45%), Gaps = 4/181 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YD++L+P+A R  G         RMG G+F+S         VE IRR    +    
Sbjct: 399 WVPVYDKILVPIARRFTGIERGFSELQRMGIGLFLSMLCMSAAAIVE-IRRLQLARDLGL 457

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
            D      +SI W +PQY ++G A     + Q +FF  + P +M    S +         
Sbjct: 458 VDEAVSVPLSIFWQIPQYFILGAAEIFTFIGQLEFFYDQSPDAMRSLCSALSLLTTALGN 517

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    +  ++   G   WI +++N GH DYF+W+LA LS  N ++++   + Y   
Sbjct: 518 YLSSFILTVVTSITTRGGKPGWIPNNLNGGHLDYFFWLLAALSFFNLVIYVFLCQMYKSK 577

Query: 529 K 531
           K
Sbjct: 578 K 578



>gb:OSJN00056_1694025 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0015K02, complete sequence.
          Length = 574

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 59/191 (30%), Positives = 90/191 (47%), Gaps = 5/191 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YD L+   A R+ G         R G G+ +S    V+   VE  RR+ A+     
Sbjct: 378 FVPVYDLLVARAAQRVTGVEGGITVLQRQGVGVAISGLALVVAAVVERRRRASAL----- 432

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
            DN G S MS+  + PQ A+MG++   N + Q +F+ +EFP  M T+             
Sbjct: 433 -DNGGTSPMSVFVLAPQLAVMGVSAAFNMIGQMEFYNTEFPDQMRTLANAAFYCAQGASS 491

Query: 361 XXXXXI----NELSINSGNGS-WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP 525
                +    N  +   G G  W+  DIN G  D+FY+ +A  + +NF+ FL+CS  Y  
Sbjct: 492 YLATAVVNVVNARTRRRGGGQGWVAEDINAGKLDHFYYAMAVFAAINFVYFLVCSYFY-R 550

Query: 526 SKDEKPVAMEE 558
            K E  VA E+
Sbjct: 551 YKGEPEVAAED 561



>gb:AP003621_1831571 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003761_1833088 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0018H04.
          Length = 571

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 55/181 (30%), Positives = 80/181 (44%), Gaps = 4/181 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I LYDR  +P A R+ G         R+G G+ ++         VE+ R   A       
Sbjct: 398 IPLYDRAFVPAARRLAGREKGIPDLLRIGAGLTMAVLAMAAAALVETKRARAA------- 450

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
             +G  K SI+W VPQYA+MG+     +  Q  FF S+ P +M T+              
Sbjct: 451 -RMGMEKTSIVWQVPQYAVMGVGEMLASAGQLDFFYSQAPPAMKTVCMALGFLAVAAGVY 509

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   ++  +   G   WI  D+NEGH D F+W++AGL  +N + F  C+  Y   K
Sbjct: 510 LSSLVLTAVSWATATGGRPGWIPDDLNEGHLDRFFWMMAGLGCLNLVAFTSCAMRYKSRK 569

Query: 532 D 534
           D
Sbjct: 570 D 570



>gb:AP002483_1822204 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0019D06.>gb:AP003311_1827798
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0024G09.
          Length = 580

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/177 (28%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YDRL++P    + G         RMG G+ +S  +++L   V  + R  AI +   
Sbjct: 386 WVPVYDRLIVPAVRAVTGRPRGFTQLQRMGIGLVISV-FSMLAAGVLDVVRLRAIARHGL 444

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
             +     +SI W VPQY ++G A     V Q +FF  + P +M    S +         
Sbjct: 445 YGDKDVVPISIFWQVPQYFIIGAAEVFTFVGQLEFFYDQAPDAMRSMCSALSLTTVALGN 504

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +  ++  +G   WI  ++N GH DYF+W+LA LS++NF ++L+ +  Y
Sbjct: 505 YLSTLLVTIVTHVTTRNGAVGWIPDNLNRGHLDYFFWLLAVLSLINFGVYLVIASWY 561



>gb:AY587264_1616474 Triticum aestivum low affinity nitrate
           transporter NRT1.2 mRNA, complete cds.
          Length = 586

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 57/180 (31%), Positives = 87/180 (48%), Gaps = 8/180 (4%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y+R+L+PV  +  G      +  R+G G+  S    VL   VES R  +A      S
Sbjct: 406 VPIYERVLVPVIRKFTGRANGISSPQRIGIGLCFSMLSMVLAALVESNRLQIA-----QS 460

Query: 184 DNLGDSK----MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXX 351
           + L  SK    MSILW  PQY L+G+A   + +   +FF  E P +M ++          
Sbjct: 461 EGLVHSKVTVPMSILWQGPQYFLLGVAEVFSNIGLTEFFCDESPDAMRSLGMAFSLLNIS 520

Query: 352 XXXXXXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   I  L    +   G+  WI  ++NEGH D FY ++AGLS++N  +F+  +R Y
Sbjct: 521 AGNYLSSFILSLVPVFTARGGSPGWIPDNLNEGHLDRFYLMMAGLSLLNIFVFVFYARRY 580



>gb:OSJN00099_1694893 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0020J19, complete sequence.
          Length = 510

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 52/176 (29%), Positives = 80/176 (45%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR ++P+  R+ GN     T  R G G+ +S     +   VE  RR   ++++  +
Sbjct: 314 VPIYDRAVVPMLRRMTGNPRGLTTLQRTGTGMALSLAAVAVAAAVEG-RRLETVREQRPA 372

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
                  MS  W+VPQY  MG+A     V   +FF  E P  M ++              
Sbjct: 373 -------MSWAWLVPQYVAMGVADVLAVVGMQEFFHGEMPEGMRSLGLALYYSVMGIGGF 425

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   ++ ++   G   W   D+N GH DYFYW+LAG+S     +FL  +RSY
Sbjct: 426 ISSALISALDGITRRDGGDGWFADDLNRGHLDYFYWLLAGVSAAELAMFLCFARSY 481



>gb:AE016959_1020655 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732723
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750474 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 578

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 51/177 (28%), Positives = 83/177 (46%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           WI +YD  L+P+A R  G         R+G G+ V+         VE  R + A      
Sbjct: 403 WIPVYDVALVPLARRATGKPKGITQLQRIGVGLAVAALIMAYSALVEERRLAAA------ 456

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
               G ++ SILW VP   + G+AV   ++ +++FF  + PRSM    + +         
Sbjct: 457 --RAGAARTSILWQVPAQLMHGMAVVFTSIGKSEFFYDQAPRSMRSMCTALGQLAIAAGN 514

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +   +   G+  WI  D+N+GH DYF+W++A L +++ LLF+ C+  Y
Sbjct: 515 YLSAFLLAVVASATTRGGDPGWIPDDLNKGHLDYFFWLMAALLLLDLLLFVFCAMRY 571



>gb:AP005869_1859325 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 572

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 55/178 (30%), Positives = 82/178 (46%), Gaps = 5/178 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YDRL++P A R  G+        RMG G+ +S +  V  G +E +R  L +   H 
Sbjct: 384 WVPVYDRLIVPAARRFTGHPRGFTQLQRMGIGLLISVFSMVAAGVLEVVR--LRVAAAHG 441

Query: 181 S-DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXX 345
             D+     +SI W V QY ++G A     + Q  FF  + P  M    + +        
Sbjct: 442 MLDSTSYLPISIFWQV-QYFIIGAAEVFAFIGQIDFFYDQAPDDMRSTCTALSLTSSALG 500

Query: 346 XXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                     +   S   G   WI  ++N GH DYF+W+LA LS VNFL++L  +  Y
Sbjct: 501 NYLSTLLVVIVTAASTRGGGLGWIPDNLNRGHLDYFFWLLAALSAVNFLVYLWIANWY 558



>gb:AY090354_1574104 Arabidopsis thaliana At1g72130/F28P5.1 mRNA,
           complete cds.>gb:BT000836_1635091 Arabidopsis thaliana
           putative oligopeptide transporter (At1g72130/F28P5.1)
           mRNA, complete cds.
          Length = 538

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 53/177 (29%), Positives = 86/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDRLL+P A     N+    T  R+G GIF+S    VL   VE+ +R  A + E S
Sbjct: 361 FIPIYDRLLVPFARSFTQNSSGITTLQRIGTGIFLSILAMVLAALVET-KRLQAARDELS 419

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                   MS+ W++PQY + G++     V   +FF  + P  + ++             
Sbjct: 420 IP------MSVWWLIPQYVIFGVSDMFTMVGLQEFFYGQVPSELRSVGMALNLSIYGAGN 473

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I++++   G  SW  +D+++ H DYFYW+LA L  + F  +L  ++SY
Sbjct: 474 YLSSFMISVIDKITNQYGQRSWFDNDLDQAHLDYFYWLLACLGFIGFAFYLWFAKSY 530



>pir|F96744|F96744 probable peptide transporter PTR2-B T9N14.15
           [imported] - Arabidopsis thaliana>gb:AE005173_894760
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC067754_1540312 Arabidopsis thaliana
           chromosome 1 BAC T9N14 genomic sequence, complete
           sequence.
          Length = 812

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 53/177 (29%), Positives = 86/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDRLL+P A     N+    T  R+G GIF+S    VL   VE+ +R  A + E S
Sbjct: 361 FIPIYDRLLVPFARSFTQNSSGITTLQRIGTGIFLSILAMVLAALVET-KRLQAARDELS 419

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                   MS+ W++PQY + G++     V   +FF  + P  + ++             
Sbjct: 420 IP------MSVWWLIPQYVIFGVSDMFTMVGLQEFFYGQVPSELRSVGMALNLSIYGAGN 473

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I++++   G  SW  +D+++ H DYFYW+LA L  + F  +L  ++SY
Sbjct: 474 YLSSFMISVIDKITNQYGQRSWFDNDLDQAHLDYFYWLLACLGFIGFAFYLWFAKSY 530



>gb:AP003791_1833395 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1065G12.>gb:AP006757_1862931 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551C06.
          Length = 557

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 52/180 (28%), Positives = 85/180 (47%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ LYDR ++P+A R+ G+       +RMG G+ +     ++ G +E  RR +  +    
Sbjct: 372 WVPLYDRAIVPLARRVTGHDRGFTQLARMGVGLVILTVAMLVAGTLEVARRRVIARHGLY 431

Query: 181 SDNLGDS---KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXX 339
            D+ GD     +SI W VPQY ++G +     + Q +FF  + P +M    S +      
Sbjct: 432 GDD-GDGGYLPLSIFWQVPQYVVVGASEVFTFIGQMEFFYDQAPDAMRSLCSGLSSTSFA 490

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       +   +   G   WI  +IN GH D F+W+LA L + NF  +L+ +R Y
Sbjct: 491 LGNYASSAIVVVVARATARGGRLGWIPDNINRGHLDDFFWLLAVLCVANFAAYLLIARWY 550



>gb:AF140606_1771555 Oryza sativa nitrate transporter (NRT1) mRNA,
           complete cds.
          Length = 584

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 54/176 (30%), Positives = 81/176 (46%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y+R+L+PV  +  G         RMG G+F S    V    VES R  +A + E   
Sbjct: 404 VPVYERVLVPVFRKFTGRANGITPLQRMGIGLFFSMLSMVSAALVESNRLRIA-QDEGLV 462

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
                  MSILW  PQY L+G+    + +   +FF  E P +M ++              
Sbjct: 463 HRKVAVPMSILWQGPQYFLIGVGEVFSNIGLTEFFYQESPDAMRSLCLAFSLANVSAGSY 522

Query: 364 XXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               I  L    +   G+  WI  ++NEGH D F+W++AGL  +N L F+ C+  Y
Sbjct: 523 LSSFIVSLVPVFTAREGSPGWIPDNLNEGHLDRFFWMMAGLCFLNMLAFVFCAMRY 578



>gb:AK175547_1817535 Arabidopsis thaliana mRNA for putative peptide
           transporter PTR2-B, complete cds, clone: RAFL21-96-L14.
          Length = 555

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 55/177 (31%), Positives = 81/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDRL +P+A  I        T  R+  GIF+S    V+   VE  R   A      
Sbjct: 373 FIPIYDRLFVPIARSITRKPAGITTLQRISTGIFLSIISMVIAALVEMKRLKTARDHGLV 432

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMS-TIXXXXXXXXX 348
                   MS+ W++PQY L G++     V   +FF  E P   RSM   +         
Sbjct: 433 DSPKATVPMSVCWLIPQYILFGVSDVFTMVGLQEFFYGEVPPQLRSMGLALYLSIIGIGN 492

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I E +  SG  SW ++++N+ H DYFYW+LA LS + F+  +  ++SY
Sbjct: 493 FLSSFMVSVIEEATSQSGQVSWFSNNLNQAHLDYFYWLLACLSSLAFIFTVYFAKSY 549



>gb:AY065020_1566183 Arabidopsis thaliana At1g72120/F28P5_2 mRNA,
           complete cds.>gb:BT001020_1635275 Arabidopsis thaliana
           At1g72120/F28P5_2 mRNA, complete cds.
          Length = 557

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 55/177 (31%), Positives = 80/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YDR+ +P+A  I        T  R+G GI +S    V+   VE  R   A +    
Sbjct: 373 FVPIYDRVFVPIARLITKEPCGITTLKRIGTGIVLSTITMVIAALVEFKRLETAKEHGLI 432

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
                   MSI W++PQY L+G+A     V   +FF S+ P  + +I             
Sbjct: 433 DQPEATLPMSIWWLIPQYLLLGLADVYTLVGMQEFFYSQVPTELRSIGLALYLSALGVGS 492

Query: 361 XXXXXINELSINSGNG----SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +  L   +  G    SW  S++N  H DYFYW+LA +S V F  FL  S+SY
Sbjct: 493 LLSSLLISLIDLATGGDAGNSWFNSNLNRAHLDYFYWLLAIVSAVGFFTFLFISKSY 549



>pir|G96744|G96744 probable peptide transporter PTR2-B, T9N14.16
           [imported] - Arabidopsis thaliana>gb:AE005173_894761
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC067754_1540313 Arabidopsis thaliana
           chromosome 1 BAC T9N14 genomic sequence, complete
           sequence.>gb:BT015165_1642135 Arabidopsis thaliana
           At1g72140 gene, complete cds.
          Length = 555

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 55/177 (31%), Positives = 81/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDRL +P+A  I        T  R+  GIF+S    V+   VE  R   A      
Sbjct: 373 FIPIYDRLFVPIARSITRKPAGITTLQRISTGIFLSIISMVIAALVEMKRLKTARDHGLV 432

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMS-TIXXXXXXXXX 348
                   MS+ W++PQY L G++     V   +FF  E P   RSM   +         
Sbjct: 433 DSPKATVPMSVCWLIPQYILFGVSDVFTMVGLQEFFYGEVPPQLRSMGLALYLSIIGIGN 492

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I E +  SG  SW ++++N+ H DYFYW+LA LS + F+  +  ++SY
Sbjct: 493 FLSSFMVSVIEEATSQSGQVSWFSNNLNQAHLDYFYWLLACLSSLAFIFTVYFAKSY 549



>gb:ATAC010676_1543134 Arabidopsis thaliana chromosome III BAC T22N4
           genomic sequence, complete sequence.
          Length = 563

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 51/182 (28%), Positives = 90/182 (49%), Gaps = 6/182 (3%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           LYD++L+P+  RI+ N        RMG G+F+S    V+   VE  R +++ K +   D 
Sbjct: 373 LYDKILIPITKRIKKNGTGISVMERMGVGMFLSIIAIVIAAIVERKRLAISQKMKTLPDY 432

Query: 190 LGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXX 366
             ++  +SI W++PQY L+GI+     V   +FF SE P  M T+               
Sbjct: 433 DPETVPLSIFWLLPQYILLGISDIFTVVGMQEFFYSEVPVRMRTMGFALYTSVFGVGSFV 492

Query: 367 XXXINEL--SINSGNG---SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
              +  +  + +S  G   +W   D++E   D +YW+LA  S ++F++++   + +  S 
Sbjct: 493 SAALISIVEAYSSSTGDRQNWFADDMSEARLDKYYWLLALTSTISFVVYIFLCKFFKSSS 552

Query: 532 DE 537
           D+
Sbjct: 553 DQ 554



>pir|E96744|E96744 probable oligopeptide transporter F28P5.2
            [imported] - Arabidopsis thaliana>gb:AE005173_894759
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC069273_1540773 Arabidopsis thaliana
            chromosome 1 BAC F28P5 genomic sequence, complete
            sequence.
          Length = 1095

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 55/177 (31%), Positives = 82/177 (46%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1    WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
            ++ +YDR+L+P+   I  +     T  R+G G+ ++    V+   VES R   A +    
Sbjct: 911  FVPIYDRVLVPIGRSITKDPCGITTLKRIGTGMVLATLTMVVAALVESKRLETAKEYGLI 970

Query: 181  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
                    MSI W+ PQY L+G+A     V   +FF S+ P   RS+             
Sbjct: 971  DQPKTTLPMSIWWLFPQYMLLGLADVHTLVGMQEFFYSQVPTELRSLGLAIYLSAMGVGS 1030

Query: 352  XXXXXXXXINELSINSGNG-SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    + +L+     G SW  S++N  H DYFYW+LA +S V F  FL  S+SY
Sbjct: 1031 LLSSLLIYLIDLATGGDAGNSWFNSNLNRAHLDYFYWLLAVVSAVGFFTFLFISKSY 1087



 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 46/160 (28%), Positives = 69/160 (43%), Gaps = 4/160 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YDR+ +P+A  I        T  R+G GI +S    V+   VE  R   A +    
Sbjct: 373 FVPIYDRVFVPIARLITKEPCGITTLKRIGTGIVLSTITMVIAALVEFKRLETAKEHGLI 432

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
                   MSI W++PQY L+G+A     V   +FF S+ P  + +I             
Sbjct: 433 DQPEATLPMSIWWLIPQYLLLGLADVYTLVGMQEFFYSQVPTELRSIGLALYLSALGVGS 492

Query: 361 XXXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLA 468
                +  L    +      SW  S++N  H DYFYW+LA
Sbjct: 493 LLSSLLISLIDLATGGDAGNSWFNSNLNRAHLDYFYWLLA 532



>pir|F86358|F86358 Similar to peptide transporter [imported] -
           Arabidopsis thaliana>gb:AE005172_891207 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC006551_1534439 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.
          Length = 570

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 52/177 (29%), Positives = 78/177 (44%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDR+L+P+A              R+G GIF+SF   V+   VE  R   A      
Sbjct: 386 FIPIYDRVLIPIARSFTHKPGGITMLQRIGTGIFLSFLAMVVAALVEMKRLKTAADYGLV 445

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                   MS+ W+VPQY L GI      V   +FF  + P  + ++             
Sbjct: 446 DSPDATVPMSVWWLVPQYVLFGITDVFAMVGLQEFFYDQVPNELRSVGLALYLSIFGIGN 505

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I + +  SG  SW  +++N+ H DYFYW+LA LS +    +L  ++SY
Sbjct: 506 FLSSFMISIIEKATSQSGQASWFANNLNQAHLDYFYWLLACLSFIGLASYLYVAKSY 562



>gb:AK117678_1815699 Arabidopsis thaliana At1g72130 mRNA for
           putative peptide transporter PTR2-B, complete cds,
           clone: RAFL17-34-C15.
          Length = 499

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDR L+P A     N+    T  R+G GIF+S    VL   VE+ +R  A + E S
Sbjct: 322 FIPIYDRSLVPFARSFTQNSSGITTLQRIGTGIFLSILAMVLAALVET-KRLQAARDELS 380

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                   MS+ W++PQY + G++     V   +FF  + P  + ++             
Sbjct: 381 IP------MSVWWLIPQYVIFGVSDMFTMVGLQEFFYGQVPSELRSVGMALNLSIYGAGN 434

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I++++   G  SW  +D+++ H DYFYW+LA L  + F  +L  ++SY
Sbjct: 435 YLSSFMISVIDKITNQYGQRSWFDNDLDQAHLDYFYWLLACLGFIGFAFYLWFAKSY 491



>gb:AY058836_1564373 Arabidopsis thaliana At1g62200/F19K23_13 mRNA,
           complete cds.
          Length = 590

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 56/173 (32%), Positives = 80/173 (46%), Gaps = 5/173 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I +YDR L+P   R  G         RMG G+F+S         VE++R  LA  Q+  +
Sbjct: 418 IPIYDRFLVPFVRRFTGIPKGLTDLQRMGIGLFLSVLSIAAAAIVETVRLQLA--QDFVA 475

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
                  MSI W +PQY LMGIA     + + +FF  E P +M ++              
Sbjct: 476 -------MSIFWQIPQYILMGIAEVFFFIGRVEFFYDESPDAMRSVCSALALLNTAVGSY 528

Query: 364 XXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLF-LIC 507
               I  L    +   G   W+  D+N+GH DYF+W+L  L +VN  ++ LIC
Sbjct: 529 LSSLILTLVAYFTALGGKDGWVPDDLNKGHLDYFFWLLVSLGLVNIPVYALIC 581



>pir|E96648|E96648 hypothetical protein F19K23.13 [imported] -
           Arabidopsis thaliana>gb:AE005173_893887 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F19K23_1677697 Sequence of BAC F19K23 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 568

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 56/173 (32%), Positives = 80/173 (46%), Gaps = 5/173 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I +YDR L+P   R  G         RMG G+F+S         VE++R  LA  Q+  +
Sbjct: 396 IPIYDRFLVPFVRRFTGIPKGLTDLQRMGIGLFLSVLSIAAAAIVETVRLQLA--QDFVA 453

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
                  MSI W +PQY LMGIA     + + +FF  E P +M ++              
Sbjct: 454 -------MSIFWQIPQYILMGIAEVFFFIGRVEFFYDESPDAMRSVCSALALLNTAVGSY 506

Query: 364 XXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLF-LIC 507
               I  L    +   G   W+  D+N+GH DYF+W+L  L +VN  ++ LIC
Sbjct: 507 LSSLILTLVAYFTALGGKDGWVPDDLNKGHLDYFFWLLVSLGLVNIPVYALIC 559



>gb:AP003566_1830922 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 548

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 52/177 (29%), Positives = 81/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDRL +P+A R  G         R+G G+ +S    VL   VE+ R  +A     +
Sbjct: 347 FIPVYDRLFVPLARRYTGRPSGITMLQRVGAGLALSLVAVVLSALVETRRLRVAAGAGMA 406

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                   MS+ W+VPQY L+G+A     +   +FF  + P ++ ++             
Sbjct: 407 DAPKARLPMSLWWMVPQYVLVGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGVGH 466

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I+  +     GSW  +++N  H DYFYW+LAGL  V  + F + SR Y
Sbjct: 467 LLSSLLISVIDGATARRAGGSWFANNLNRAHLDYFYWLLAGLCAVELVAFFLFSRVY 523



>gb:AP003235_1825912 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843001 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 532

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 52/177 (29%), Positives = 81/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDRL +P+A R  G         R+G G+ +S    VL   VE+ R  +A     +
Sbjct: 331 FIPVYDRLFVPLARRYTGRPSGITMLQRVGAGLALSLVAVVLSALVETRRLRVAAGAGMA 390

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                   MS+ W+VPQY L+G+A     +   +FF  + P ++ ++             
Sbjct: 391 DAPKARLPMSLWWMVPQYVLVGVADVFAMIGLQEFFYDQVPDAVRSLGLALFLSIFGVGH 450

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I+  +     GSW  +++N  H DYFYW+LAGL  V  + F + SR Y
Sbjct: 451 LLSSLLISVIDGATARRAGGSWFANNLNRAHLDYFYWLLAGLCAVELVAFFLFSRVY 507



>pir|B86359|B86359 protein Similar to LeOPT1 [Lycopersicon
           esculentum] [imported] - Arabidopsis
           thaliana>gb:AE005172_891211 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006551_1534435 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.
          Length = 565

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 54/175 (30%), Positives = 82/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + LY+R+ LP+A +I           R+G G+ +S +  +L   VES R  L I +EH  
Sbjct: 385 VPLYERVFLPIARKITKKPFGITMLQRIGAGMVLSVFNMMLAALVESKR--LKIAREHGL 442

Query: 184 DNLGDSK--MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXX 357
            +  D    MSI W VPQY L+G+    + V   +FF  + P  + +I            
Sbjct: 443 VDKPDVTVPMSIWWFVPQYLLLGMIDLFSMVGTQEFFYDQVPTELRSIGLSLSLSAMGLS 502

Query: 358 XXXXXX-INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  I+ +   +G   W  S++N  H DYFYW+LA  + + F  FL  S+ Y
Sbjct: 503 SFLSGFLISLIDWATGKDGWFNSNLNRAHVDYFYWLLAAFTAIAFFAFLFISKMY 557



>gb:AP003235_1825917 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843006 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 433

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 52/181 (28%), Positives = 85/181 (46%), Gaps = 5/181 (2%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           YDR L+P+A R  G+     T  R+G G+     + V+   VE+ R   A      +D  
Sbjct: 255 YDRALVPLARRFTGHPAGITTLQRVGAGMATCCLHMVVAALVEAKRLRAASDAGLPAD-- 312

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXX----XXXXX 360
               MS+ W+VPQYAL+G++     +   +FF  + P  + ++                 
Sbjct: 313 ATVPMSVWWLVPQYALVGLSKVFGVIGLQEFFYDQVPDDLRSVGLAMSLSAQGVGSYASS 372

Query: 361 XXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY-GPSKDE 537
                I+  +   G  SW + DIN  H DYFYW+LA L+ ++  +F+  ++ Y   +KDE
Sbjct: 373 ALVSAIDWATTRRGGESWFSDDINRAHLDYFYWLLAALAALDVAVFVYIAKRYVYRNKDE 432

Query: 538 K 540
           +
Sbjct: 433 Q 433



>gb:AE016959_1020640 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068654_1540426
           Genomic Sequence For Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare Clone OSJNBa0015O22
           From Chromosome 10, complete
           sequence.>gb:AE017049_1750459 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 516

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 49/176 (27%), Positives = 82/176 (46%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + LYD  ++P A R+ G+        R+G G+ +S         VE  R + A       
Sbjct: 346 VPLYDAAVVPAARRLTGSERGLTELQRIGAGMALSVAAMAAAATVEGRRLAAA------- 398

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXXX 351
                 ++SI W VPQY L+G +     + Q +FF ++ P SM    S +          
Sbjct: 399 -----GEVSIAWQVPQYVLLGASAVLAHIGQLEFFYNQAPDSMRSLCSALGHMTCSLGSY 453

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   ++  +   G+  WI  DI++GH D F+W++AGLS +N ++F+ C++ Y
Sbjct: 454 LSSVVVTVVSHATARGGSPGWIADDIDDGHLDRFFWLVAGLSSINLVVFICCAKRY 509



>pir|A84432|A84432 probable peptide/amino acid transporter
           [imported] - Arabidopsis thaliana>gb:AC006532_1534372
           Arabidopsis thaliana chromosome 2 clone F14H20 map
           CIC11A04, complete sequence.
          Length = 545

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 58/175 (33%), Positives = 82/175 (46%), Gaps = 3/175 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR+++P+  R  G         RMG G+FVS         VE++R  LA  ++   
Sbjct: 368 VPIYDRVIVPLVRRFTGLAKGFTELQRMGIGLFVSVLSLTFAAIVETVRLQLA--RDLDL 425

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
              GD   ++I W +PQY LMG A     V + +FF  + P SM ++             
Sbjct: 426 VESGDIVPLNIFWQIPQYFLMGTAGVFFFVGRIEFFYEQSPDSMRSLCSAWALLTTTLGN 485

Query: 361 XXXXXINEL-SINSGNGSWITSD-INEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                I  L +  SG   WI SD IN GH DYF+W+L  L  VN  +F+  S  Y
Sbjct: 486 YLSSLIITLVAYLSGKDCWIPSDNINNGHLDYFFWLLVSLGSVNIPVFVFFSVKY 540



>gb:AP004047_1836888 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1191_G08.>gb:AP004098_1837706 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ2056_H01.
          Length = 584

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 55/177 (31%), Positives = 86/177 (48%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +Y R+L+PV SR+ GN        RMG G+ V     V+ G VE  R    +K+  +
Sbjct: 395 FIAIYRRVLVPVMSRLSGNPQGLTELQRMGVGLVVGMAAMVVAGVVEVER----LKRVGA 450

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
            D    S +S+LW VPQYAL+G +     V Q +FF  + P  +    S++         
Sbjct: 451 PDQ--PSSLSVLWQVPQYALIGASEVFMYVGQLEFFNGQAPDGVKSFGSSLCMASISLGN 508

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +  L+       WI  ++N GH D FY++LA LS+V+  +++ C+  Y
Sbjct: 509 YVSIMLVSVVTSLTAGDRRPGWIPGNLNSGHLDRFYFLLAALSLVDLAVYVACAVWY 565



>gb:AP004096_1837679 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1743_B12.
          Length = 610

 Score = 85.9 bits (211), Expect = 8e-16
 Identities = 50/176 (28%), Positives = 82/176 (46%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I LY R + P+ SR+ G         RMG G+ +        G VE  R++        +
Sbjct: 415 IFLYRRAVCPLVSRLTGRHTGPTELQRMGLGLVLGAMAMATAGTVEHFRKA-------GA 467

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXXX 351
                S + I+W VPQYAL+G++     V Q +FF  E P ++    S +          
Sbjct: 468 TTAMSSDLHIMWQVPQYALIGVSEVMMYVGQLEFFNGEMPDALKSFGSALCMMSMSLGNY 527

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   + + +   G   WI +D+NEGH D F+++LA L++ +F ++L+C+  Y
Sbjct: 528 FSDVIVSAVTKATAVRGRPGWIPADLNEGHLDKFFFLLAVLAVADFAVYLVCASRY 583



>gb:AP003235_1825914 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843003 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 415

 Score = 85.9 bits (211), Expect = 8e-16
 Identities = 50/176 (28%), Positives = 83/176 (47%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR ++P+A R  G+     T  R+G G+  S    V+   VE+ RR  A       
Sbjct: 233 VPVYDRAVVPLARRFTGHPAGVTTLQRVGAGMATSCLAMVVAALVEA-RRLRAASDASLV 291

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
           D  G +  M + W+VPQY L+G+A     +  ++FF  + P   RS+             
Sbjct: 292 DRPGATVPMGVWWLVPQYLLVGLAKVFGDIGLDEFFYDQAPDGLRSVGLAMSLSVLGVGN 351

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   + + +  SG  SW + D+N  H DYFYW+LA  + +  ++F+  ++ Y
Sbjct: 352 YVSGVLVSVIDTATRSGGESWFSDDLNRAHLDYFYWILAAFAALEVVVFVYIAKRY 407



>pir|G86322|G86322 hypothetical protein F6A14.2 - Arabidopsis
           thaliana>gb:AE005172_890845 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC011809_1537478 Arabidopsis thaliana
           chromosome I BAC F6A14 genomic sequence, complete
           sequence.>gb:AY070054_1566697 Arabidopsis thaliana
           putative peptide transporter protein (At1g18880) mRNA,
           complete cds.>gb:AY117308_1579349 Arabidopsis thaliana
           putative peptide transporter protein (At1g18880) mRNA,
           complete cds.
          Length = 587

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 49/180 (27%), Positives = 85/180 (47%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH- 177
           +I +YDR+L+P   +  G         R+G G+F+     ++   VE  RR +A+ +   
Sbjct: 384 FIPIYDRVLVPFLRKYTGRDGGITQLQRVGAGLFLCITSMMVSAIVEQYRRKVALTKPTL 443

Query: 178 --SSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXX---- 339
             +      S MS +W++PQ  LMGIA     V Q +F+  +FP +M +           
Sbjct: 444 GLAPRKGAISSMSGMWLIPQLVLMGIADALAGVGQMEFYYKQFPENMRSFAGSLYYCGIG 503

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       +++ +     GSW+  D+N+G  +YFY+++AG+  +N   FL+ S  Y
Sbjct: 504 LASYLSTFLLSAVHDTTEGFSGGSWLPEDLNKGRLEYFYFLVAGMMTLNLAYFLLVSHWY 563



>gb:AY289622_1594949 Vicia faba peptide transporter 1 (PTR1) mRNA,
           complete cds.
          Length = 584

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 53/181 (29%), Positives = 81/181 (44%), Gaps = 4/181 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YDR ++P+A +  G         RMG G+F+S         VE  R  LA K+   
Sbjct: 404 WVPVYDRFIVPIARKFTGKERGFSELQRMGIGLFISVLCMSAAAIVEIKRLQLA-KELDL 462

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
            D      ++I   +PQY L+G A     V Q +FF  + P +M    S +         
Sbjct: 463 VDKAVPVPLTIFLQIPQYFLLGAAEVFTFVGQLEFFYDQSPDAMRSLCSALSLLTTSLGN 522

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    +   +   GN  WI  ++N+GH DYF   LAGLS +N  L+++ ++ Y   
Sbjct: 523 YLSSFILTVVLYFTTRGGNPGWIPDNLNKGHLDYFSG-LAGLSFLNMFLYIVAAKRYKSK 581

Query: 529 K 531
           K
Sbjct: 582 K 582



>pir|G86449|G86449 F5D14.23 protein - Arabidopsis
           thaliana>gb:AE005172_892084 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F5D14_1678323 Sequence of BAC F5D14 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 606

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 57/196 (29%), Positives = 94/196 (47%), Gaps = 9/196 (4%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTK-SRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEH 177
           +I LY R+L PVA+R + N     T+  RMG G+ ++    +  G VE  R   A K   
Sbjct: 398 FIFLYRRVLEPVANRFKKNGSKGITELHRMGIGLVIAVIAMIAAGIVECYRLKYADKSCT 457

Query: 178 SSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXX 345
             D  G S +SI W  PQY+L+G +     V Q +FF ++ P  +    S +        
Sbjct: 458 HCD--GSSSLSIFWQAPQYSLIGASEVFMYVGQLEFFNAQTPDGLKSFGSALCMMSMSMG 515

Query: 346 XXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGP 525
                     + ++S       WI  ++N+GH D FY++LA L+ ++ ++++ C++ Y P
Sbjct: 516 NFVSSLLVTMVVKISTEDHMPGWIPRNLNKGHLDRFYFLLAALTSIDLVVYIACAKWYKP 575

Query: 526 ----SKDEKPVAMEED 561
                KDE     ++D
Sbjct: 576 IQLEGKDEMQDMSDDD 591



>gb:AP002818_1822868 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0436E04.>gb:AP002969_1824013 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0455C04.
          Length = 606

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 52/179 (29%), Positives = 83/179 (46%), Gaps = 7/179 (3%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + LY R   P+A R+ G+        R+G G+ +S       G  E  RR+ AI+     
Sbjct: 416 LALYYRAFAPLARRLTGHPHGASQLQRLGLGLLLSTLSVAWAGLFERYRRAYAIRHGFLP 475

Query: 184 DNLGDSK-MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
             L     +S  W++ QY L+G+A     VA  +F   E P +M ++             
Sbjct: 476 LFLTPMPGLSAYWLLIQYCLIGLAEVFCLVALLEFLYQEAPDAMRSLASAYAALAGGLGC 535

Query: 361 XXXXXINEL------SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                IN         I++G  SW+  +IN G +DYFYW+LA LS +N ++F+  +++Y
Sbjct: 536 FLATAINTAVDSITGDIDAGRPSWLAQNINVGKFDYFYWLLAVLSTINLIVFIYFAKAY 594



>gb:BT004638_1637672 Arabidopsis thaliana At1g22550 gene, complete
           cds.
          Length = 564

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 54/175 (30%), Positives = 80/175 (45%), Gaps = 6/175 (3%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           Y+R+ LP+A  I           R+G G+ +S    V+   VE  R   A  +EH   + 
Sbjct: 384 YERVFLPLARLITKKPSGITMLQRIGAGMVLSSLNMVVAALVEMKRLETA--KEHGLVDR 441

Query: 193 GDSK--MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXX 366
            D+   MSI W VPQY L+G+    + V   +FF  + P  + +I               
Sbjct: 442 PDATIPMSIWWFVPQYLLLGMIDVFSLVGTQEFFYDQVPTELRSIGLALSLSAMGLASFL 501

Query: 367 X----XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  IN  +  +G  SW  +++N  H DYFYW+LA  + + FL FL+ SR Y
Sbjct: 502 SGFLITVINWATGKNGGDSWFNTNLNRAHVDYFYWLLAAFTAIGFLAFLLLSRLY 556



>pir|G86358|G86358 protein Similar to LeOPT1 [Lycopersicon
           esculentum] [imported] - Arabidopsis
           thaliana>gb:AE005172_891208 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006551_1534438 Arabidopsis thaliana
           chromosome I BAC F12K8 genomic sequence, complete
           sequence.
          Length = 564

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 54/175 (30%), Positives = 80/175 (45%), Gaps = 6/175 (3%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           Y+R+ LP+A  I           R+G G+ +S    V+   VE  R   A  +EH   + 
Sbjct: 384 YERVFLPLARLITKKPSGITMLQRIGAGMVLSSLNMVVAALVEMKRLETA--KEHGLVDR 441

Query: 193 GDSK--MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXX 366
            D+   MSI W VPQY L+G+    + V   +FF  + P  + +I               
Sbjct: 442 PDATIPMSIWWFVPQYLLLGMIDVFSLVGTQEFFYDQVPTELRSIGLALSLSAMGLASFL 501

Query: 367 X----XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  IN  +  +G  SW  +++N  H DYFYW+LA  + + FL FL+ SR Y
Sbjct: 502 SGFLITVINWATGKNGGDSWFNTNLNRAHVDYFYWLLAAFTAIGFLAFLLLSRLY 556



>gb:AB102806_1526337 Nicotiana tabacum NtNRT1.1-t mRNA for nitrate
           transporter, complete cds.
          Length = 590

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 47/174 (27%), Positives = 83/174 (47%), Gaps = 3/174 (1%)
 Frame = +1

Query: 7   VLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSD 186
           + YDR ++PV  R+  N        R+  G+ +S   A++   +  ++R L +   H   
Sbjct: 397 IFYDRAVVPVCRRVLNNPHGTSPLQRIAVGLILSI-IAMIAAALTEVKR-LNVAHLHGLT 454

Query: 187 NLGDSK--MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           N  ++K  +S+ W+VPQ+ L+G       + Q  FF+ E P+ M T+             
Sbjct: 455 NDANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGF 514

Query: 361 XXXXXINELSIN-SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +  +    +G   W+  ++N+G    FYW+LA LS++N ++FL  SR Y
Sbjct: 515 FFSSILVTIVHKVTGKNPWLADNLNQGRLYDFYWLLATLSVLNLMIFLFISRRY 568



>gb:AE016959_1020653 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732721
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750472 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 566

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 46/177 (25%), Positives = 81/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YD +L+P+A R+ G         R+G G+ ++         VE+ R   A      
Sbjct: 392 WVPVYDTVLVPLARRVTGKDRGISHLQRIGVGLALAAVAMAYSAVVEARRLGTA------ 445

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
                 + +SI+W  P Y ++G+A   + +   +FF  + P SM ++             
Sbjct: 446 -----PAPVSIMWQAPSYLVLGVAEAFSVIGMMEFFYEQSPESMKSLCTALGQLAIAVAN 500

Query: 361 XXXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +  +    +   G   WI  +++EGH DYF+W++A +S++N L FL CS  Y
Sbjct: 501 YLNSGVLVVVAAATTRGGGAGWIPDNLDEGHLDYFFWMMAVVSVLNLLHFLHCSIRY 557



>gb:AP003566_1830926 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 586

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 3/176 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YDR L+P+A R  G+     T  R+G G+ +S     +   VE+ R   A      
Sbjct: 403 FVPVYDRALVPLARRFTGHPAGITTLQRVGVGMAMSCLAMAVAALVEAKRLRAASDAGLI 462

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
                   M + W+VPQYAL+G++     +  ++FF  + P   RS+             
Sbjct: 463 DRPDATVPMGVWWLVPQYALVGLSKVFGIIGLDEFFYDQVPDDLRSVGLAMSLSVRGVGS 522

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                     + +  SG  SW + ++N  H DYFYW+LA L+ +   +F+  ++ Y
Sbjct: 523 YASGVLVSAIDCATRSGGESWFSDNLNRAHLDYFYWILAALAALEVAVFVYIAKRY 578



>gb:AP003235_1825915 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843004 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 537

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 47/176 (26%), Positives = 80/176 (45%), Gaps = 3/176 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YDR L+P+A R  G+     T  R+G G+ +S     +   VE+ R   A      
Sbjct: 354 FVPVYDRALVPLARRFTGHPAGITTLQRVGVGMAMSCLAMAVAALVEAKRLRAASDAGLI 413

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
                   M + W+VPQYAL+G++     +  ++FF  + P   RS+             
Sbjct: 414 DRPDATVPMGVWWLVPQYALVGLSKVFGIIGLDEFFYDQVPDDLRSVGLAMSLSVRGVGS 473

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                     + +  SG  SW + ++N  H DYFYW+LA L+ +   +F+  ++ Y
Sbjct: 474 YASGVLVSAIDCATRSGGESWFSDNLNRAHLDYFYWILAALAALEVAVFVYIAKRY 529



>gb:AY084539_1569628 Arabidopsis thaliana clone 111089 mRNA,
           complete sequence.
          Length = 590

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 48/184 (26%), Positives = 82/184 (44%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           L +R+ +P+  R+        +  R+G G+  S     +   +E+ RR  A+        
Sbjct: 394 LNERVFVPLTRRLTKKPQGITSLQRIGVGLVFSMAAMAVAAVIENARREAAVNN------ 447

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
             D K+S  W+VPQY L+G       V Q +FFI E P  M ++                
Sbjct: 448 --DKKISAFWLVPQYFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLSTISMGFFVS 505

Query: 370 XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVA 549
             +  L     + SW+ S++N+   +YFYW+L  L  +NFL+F++ +  +    D   V 
Sbjct: 506 SLLVSLVDRVTDKSWLRSNLNKARLNYFYWLLVVLGALNFLIFIVFAMKHQYKADVITVV 565

Query: 550 MEED 561
           + +D
Sbjct: 566 VTDD 569



>gb:ATH131464_1551986 Arabidopsis thaliana mRNA for nitrate
           transporter, partial.
          Length = 567

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 48/184 (26%), Positives = 82/184 (44%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           L +R+ +P+  R+        +  R+G G+  S     +   +E+ RR  A+        
Sbjct: 371 LNERVFVPLTRRLTKKPQGITSLQRIGVGLVFSMAAMAVAAVIENARREAAVNN------ 424

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
             D K+S  W+VPQY L+G       V Q +FFI E P  M ++                
Sbjct: 425 --DKKISAFWLVPQYFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLSTISMGFFVS 482

Query: 370 XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVA 549
             +  L     + SW+ S++N+   +YFYW+L  L  +NFL+F++ +  +    D   V 
Sbjct: 483 SLLVSLVDRVTDKSWLRSNLNKARLNYFYWLLVVLGALNFLIFIVFAMKHQYKADVITVV 542

Query: 550 MEED 561
           + +D
Sbjct: 543 VTDD 546



>gb:AB019232_1514187 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MIL23.>gb:AY143946_1583403 Arabidopsis
           thaliana At3g21670/MIL23_23 mRNA, complete
           cds.>gb:AF372959_1792672 Arabidopsis thaliana
           AT3g21670/MIL23_23 mRNA, complete cds.
          Length = 590

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 48/184 (26%), Positives = 82/184 (44%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           L +R+ +P+  R+        +  R+G G+  S     +   +E+ RR  A+        
Sbjct: 394 LNERVFVPLTRRLTKKPQGITSLQRIGVGLVFSMAAMAVAAVIENARREAAVNN------ 447

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
             D K+S  W+VPQY L+G       V Q +FFI E P  M ++                
Sbjct: 448 --DKKISAFWLVPQYFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLSTISMGFFVS 505

Query: 370 XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVA 549
             +  L     + SW+ S++N+   +YFYW+L  L  +NFL+F++ +  +    D   V 
Sbjct: 506 SLLVSLVDRVTDKSWLRSNLNKARLNYFYWLLVVLGALNFLIFIVFAMKHQYKADVITVV 565

Query: 550 MEED 561
           + +D
Sbjct: 566 VTDD 569



>pir|T52585|T52585 probable nitrate transporter ntp3 [imported] -
           Arabidopsis thaliana (fragment)
          Length = 567

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 48/184 (26%), Positives = 82/184 (44%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           L +R+ +P+  R+        +  R+G G+  S     +   +E+ RR  A+        
Sbjct: 371 LNERVFVPLTRRLTKKPQGITSLQRIGVGLVFSMAAMAVAAVIENARREAAVNN------ 424

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
             D K+S  W+VPQY L+G       V Q +FFI E P  M ++                
Sbjct: 425 --DKKISAFWLVPQYFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLSTISMGFFVS 482

Query: 370 XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVA 549
             +  L     + SW+ S++N+   +YFYW+L  L  +NFL+F++ +  +    D   V 
Sbjct: 483 SLLVSLVDRVTDKSWLRSNLNKARLNYFYWLLVVLGALNFLIFIVFAMKHQYKADVITVV 542

Query: 550 MEED 561
           + +D
Sbjct: 543 VTDD 546



>gb:AP003857_1834399 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1014_E06.
          Length = 509

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 53/177 (29%), Positives = 76/177 (42%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YDR ++P   R  GN     T  R G G+  S      +  VE  R   A      
Sbjct: 325 FVPIYDRAVVPALRRATGNPSGLTTLQRTGAGLATS------LAAVEGRRLGAARAGRRP 378

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXX 348
           +       MS  W+VPQYA MG+A    AV   +FF  E P    ++             
Sbjct: 379 A-------MSWAWLVPQYASMGVADVLAAVGMQEFFHGEMPEGRRSVGLALYCGAVGIGG 431

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    ++ ++   G   W   D++ GH DYFYW+LAG+S V   +FL  +RSY
Sbjct: 432 FVSAALIAALDGVTRRDGGEGWFADDLDRGHLDYFYWLLAGVSAVALAMFLCFARSY 488



>gb:AP003621_1831570 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003761_1833087 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0018H04.
          Length = 569

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 51/181 (28%), Positives = 77/181 (42%), Gaps = 5/181 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIR-RSLAIKQEHS 180
           I LYDR  +P   R+ G         R+G G+ +          VE+ R R+     E  
Sbjct: 396 IPLYDRAFVPAVRRLTGREKGISELVRIGGGLAMVVLAMAAAALVETKRVRAWQTAME-- 453

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                  K SI+W VPQ+ L+G+     ++ Q  FF S+ P +M T+             
Sbjct: 454 -------KTSIMWQVPQFVLVGVGELLTSIGQLDFFYSQAPPAMKTVCAALALGAIAAGD 506

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    ++  +   G   WI  D+NEGH D F+W++AGL  +N   F+ C+  Y   
Sbjct: 507 YLSSIIVTAVSWATATGGRPGWIPDDLNEGHLDRFFWMMAGLGCLNLAAFMSCAMKYKTR 566

Query: 529 K 531
           K
Sbjct: 567 K 567



>gb:AP003566_1830923 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 521

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 50/179 (27%), Positives = 87/179 (48%), Gaps = 1/179 (0%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I  YDR L+P+A R+  +     T  R+G G+ V+   A+ V  +    R  A +     
Sbjct: 339 IPAYDRALVPLARRVTKHPSGITTLRRVGTGM-VTACLAMAVAALVEAARLRAARDAGLL 397

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           D  G +  MS+ W+ PQ+ L+G+A     V   +FF  + P  + ++             
Sbjct: 398 DEPGVAVPMSVWWLAPQFVLLGVATTFTMVGLEEFFYDQVPDELRSVGVAACMSVVGVGS 457

Query: 361 XXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE 537
                +   + + G  SW + ++N  H DYFYW+LAG+S ++ L+FL  ++ Y  +K++
Sbjct: 458 YASGMLVSATRSRGE-SWFSDNLNRAHLDYFYWLLAGISALDVLVFLYFAKGYVYTKNK 515



>gb:AP003905_1835020 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1177_E11.
          Length = 603

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 45/174 (25%), Positives = 81/174 (46%), Gaps = 2/174 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDRL++PVA R  GN        R+G G+ +S   A++   +  +RR L + ++   
Sbjct: 407 VPIYDRLVVPVARRATGNPHGLTPLQRIGVGLVLSI-VAMVCAALTEVRR-LRVARDARV 464

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
                  M++ W++PQ+  +G       + Q  FF+ E P+ M T+              
Sbjct: 465 GGGEAVPMTVFWLIPQFLFVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF 524

Query: 364 XXXXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +      +      W+  D+N+G    FYW+LAG+ + N L++L+ +R Y
Sbjct: 525 VSSALVAAVHKLTGDRHPWLADDLNKGQLHKFYWLLAGVCLANLLVYLVAARWY 578



>gb:AC130729_1740927 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668F02, complete sequence.
          Length = 218

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 53/190 (27%), Positives = 80/190 (42%), Gaps = 1/190 (0%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + LYDR+L+PVA R  G         RMG G  V+    VL G +   +R  A  +    
Sbjct: 5   LALYDRVLVPVARRYTGRRSGITYFQRMGAGFAVAA-LGVLAGALVEAKRRAAAAEHGLL 63

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           D  G    +S+ W+VPQYAL G+      V   +F   + P SM +              
Sbjct: 64  DAPGAVVPVSVFWLVPQYALHGVGDALATVGHMEFLYDQSPESMRSSAAALFWVAGSLGN 123

Query: 361 XXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK 540
                +  +  ++  G W+  +IN G  DY+YW++  L ++N   + +C   Y     E 
Sbjct: 124 YLGTVLVTVVQSASRGEWLQDNINRGRLDYYYWLVTFLLVLNLAYYFVCFHFYTLKSFEV 183

Query: 541 PVAMEED*RR 570
               E   RR
Sbjct: 184 DAGDEAQRRR 193



>gb:BT020275_1642670 Arabidopsis thaliana At3g54450 mRNA, complete
           cds.>gb:BT020512_1642906 Arabidopsis thaliana At3g54450
           gene, complete cds.
          Length = 329

 Score = 82.4 bits (202), Expect = 9e-15
 Identities = 51/180 (28%), Positives = 88/180 (48%), Gaps = 8/180 (4%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I LYDR+ +P+  +I  +     +  R+G G+FV+ +  V+ G VE+ R  L + ++H  
Sbjct: 139 IPLYDRVFVPMVRKITNHHSGITSLQRIGVGLFVATFNMVICGLVEAKR--LKVARDHG- 195

Query: 184 DNLGDSK-----MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
             L DS      MS LW++PQY L+GI      V   + F  + P +M +I         
Sbjct: 196 --LIDSPKEVVPMSSLWLLPQYILVGIGDVFTIVGMQELFYDQMPETMRSIGAAIFISVV 253

Query: 349 XXXXXXXXXINEL--SINSGNGS-WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I     +I+  +G  W+ +++N  H DY+YW++A L+ V+   +L  +  +
Sbjct: 254 GVGSFVSTGIISTVQTISKSHGEEWLVNNLNRAHLDYYYWIIASLNAVSLCFYLFIANHF 313



>gb:AC069273_1540772 Arabidopsis thaliana chromosome 1 BAC F28P5
           genomic sequence, complete sequence.
          Length = 763

 Score = 82.4 bits (202), Expect = 9e-15
 Identities = 49/165 (29%), Positives = 79/165 (47%), Gaps = 4/165 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDRLL+P A     N+    T  R+G GIF+S    VL   VE+ +R  A + E S
Sbjct: 361 FIPIYDRLLVPFARSFTQNSSGITTLQRIGTGIFLSILAMVLAALVET-KRLQAARDELS 419

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                   MS+ W++PQY + G++     V   +FF  + P  + ++             
Sbjct: 420 IP------MSVWWLIPQYVIFGVSDMFTMVGLQEFFYGQVPSELRSVGMALNLSIYGAGN 473

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMV 483
                    I++++   G  SW  +D+++ H DYFYW+LA L  +
Sbjct: 474 YLSSFMISVIDKITNQYGQRSWFDNDLDQAHLDYFYWLLACLGFI 518



>gb:AE016959_1023995 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC018727_1538376
           Oryza sativa chromosome 10 BAC OSJNBa0056G17 genomic
           sequence, complete sequence.>gb:AE017123_1753814 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           77 of 77 of the complete sequence.
          Length = 569

 Score = 82.4 bits (202), Expect = 9e-15
 Identities = 46/176 (26%), Positives = 83/176 (47%), Gaps = 3/176 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+V  D +++P+A R  GN        RMG G  +    AV    V ++  +  ++    
Sbjct: 392 WVVFQDTVVVPIARRYTGNPAGLTQLQRMGVGRLL----AVPALAVAAVLETWRLRSVRD 447

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
             NL     SI W +PQ+ ++  +     +AQ +FF SE P   RS+ +           
Sbjct: 448 GGNL-----SIAWQLPQFVILACSDVFCGIAQLEFFYSEAPVSMRSLCSAFSFLALSLGY 502

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   I  +   + N  W+ +D+N+GH DY++W+  G+S +NF+++   +++Y
Sbjct: 503 YVNSLVVSIVAVVTTTSNKGWLPADLNDGHLDYYFWLWTGISAINFVVYAAFAKNY 558



>pir|T47604|T47604 oligopeptide transporter-like protein -
           Arabidopsis thaliana>gb:ATT14E10_1554460 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T14E10.
          Length = 555

 Score = 82.4 bits (202), Expect = 9e-15
 Identities = 51/180 (28%), Positives = 88/180 (48%), Gaps = 8/180 (4%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I LYDR+ +P+  +I  +     +  R+G G+FV+ +  V+ G VE+ R  L + ++H  
Sbjct: 365 IPLYDRVFVPMVRKITNHHSGITSLQRIGVGLFVATFNMVICGLVEAKR--LKVARDHG- 421

Query: 184 DNLGDSK-----MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
             L DS      MS LW++PQY L+GI      V   + F  + P +M +I         
Sbjct: 422 --LIDSPKEVVPMSSLWLLPQYILVGIGDVFTIVGMQELFYDQMPETMRSIGAAIFISVV 479

Query: 349 XXXXXXXXXINEL--SINSGNGS-WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I     +I+  +G  W+ +++N  H DY+YW++A L+ V+   +L  +  +
Sbjct: 480 GVGSFVSTGIISTVQTISKSHGEEWLVNNLNRAHLDYYYWIIASLNAVSLCFYLFIANHF 539



>gb:OSJN00129_1695377 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNba0093F12, complete sequence.
          Length = 593

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+++Y  +++P+ + +           RMG G  +  +   +   VE +R   A + E  
Sbjct: 419 WVLMYSSVIVPMLNSLSLANGEPSQLQRMGAGRLLMAFAMAVAALVEMMRLDAAGRGE-- 476

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
                   +SI W +PQY  +  A     +AQ +FF SE P SM    +++         
Sbjct: 477 -------SLSIAWQMPQYFALAGAEVFCYIAQLEFFYSEAPESMKSMCTSLALLTVALGS 529

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +N  +   G   WI+ ++NEGH DYF+WV+A L  +NF+++   +R+Y
Sbjct: 530 YMSSFIYAVVNAFTAVDGRPGWISDNLNEGHMDYFFWVMAALCTLNFVVYSAFARTY 586



>pir|B86458|B86458 probable protein nitrate transporter NTL1
           54085-51470 [imported] - Arabidopsis
           thaliana>gb:AE005172_892158 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC051630_1540096 Arabidopsis thaliana
           chromosome 1 BAC F10C21 genomic sequence, complete
           sequence.
          Length = 596

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 48/181 (26%), Positives = 88/181 (48%), Gaps = 8/181 (4%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ LY+   +P+A ++ GN        R+G G+F++ +  V    VE  RR   ++Q   
Sbjct: 390 FVPLYETFFVPLARKLTGNDSGISPLQRIGTGLFLATFSMVAAALVEKKRRESFLEQ--- 446

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
                +  +SI W+ PQ+ + G++    AV   +FF  +  +SM +              
Sbjct: 447 -----NVMLSIFWIAPQFLIFGLSEMFTAVGLVEFFYKQSSQSMQSFLTAMTYCSYSFGF 501

Query: 355 --XXXXXXXINELSINSGNGS---WI-TSDINEGHYDYFYWVLAGLSMVNFLLFLICSRS 516
                    +N ++ ++G+G+   W+  +D+N+   D+FYW+LA LS +NF  +L  SR 
Sbjct: 502 YLSSVLVSTVNRVTSSNGSGTKEGWLGDNDLNKDRLDHFYWLLASLSFINFFNYLFWSRW 561

Query: 517 Y 519
           Y
Sbjct: 562 Y 562



>gb:AP004669_1843009 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0491F11.
          Length = 300

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/177 (29%), Positives = 86/177 (48%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR+L+P+  R   N     T  R+G G+ +S    V+   VE+ RR +  +     
Sbjct: 116 VPIYDRILVPLTRRYSKNPRGITTLQRIGIGLIISVILMVVSALVET-RRLMVARDFGLV 174

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           DN   +  MS  WVVPQ+ L G+A     V   +FF  + P  + ++             
Sbjct: 175 DNPEATIPMSFWWVVPQFILTGLADMFTMVGLQEFFYDQVPDGLRSLGLALYLSIFGIGS 234

Query: 361 XXXX----XINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I++++  +G+ SW + ++N GH DYFYW+LA LS++    +L  SR Y
Sbjct: 235 FISSFLVYAIDKVTSMTGD-SWFSDNLNRGHLDYFYWLLAVLSVLGLAAYLHFSRVY 290



>gb:AP003566_1830928 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 548

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 53/177 (29%), Positives = 86/177 (48%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR+L+P+  R   N     T  R+G G+ +S    V+   VE+ RR +  +     
Sbjct: 364 VPIYDRILVPLTRRYSKNPRGITTLQRIGIGLIISVILMVVSALVET-RRLMVARDFGLV 422

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           DN   +  MS  WVVPQ+ L G+A     V   +FF  + P  + ++             
Sbjct: 423 DNPEATIPMSFWWVVPQFILTGLADMFTMVGLQEFFYDQVPDGLRSLGLALYLSIFGIGS 482

Query: 361 XXXX----XINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    I++++  +G+ SW + ++N GH DYFYW+LA LS++    +L  SR Y
Sbjct: 483 FISSFLVYAIDKVTSMTGD-SWFSDNLNRGHLDYFYWLLAVLSVLGLAAYLHFSRVY 538



>gb:AY587265_1616475 Triticum aestivum low affinity nitrate
           transporter NRT1.1 mRNA, complete cds.
          Length = 586

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 51/180 (28%), Positives = 82/180 (45%), Gaps = 8/180 (4%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y+RL++PV  +  G      +  R+G G+  S +  V    VE  R  +A      +
Sbjct: 406 VPIYERLIVPVIRKFTGRANGITSPQRIGIGLCFSMFSMVSAALVEGNRLQIA-----QA 460

Query: 184 DNLGDSK----MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXX 351
           + L   K    MSI+W  PQY L+G+A   + +   + F  E P  M ++          
Sbjct: 461 EGLVHRKVAVPMSIMWQGPQYFLLGVAEVFSNIGLTEAFYDESPDGMRSLCMAFSLVNMS 520

Query: 352 XXXXXXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   I  L    +   G+  WI  ++NEGH D FY ++AGLS  N ++F+ C+  Y
Sbjct: 521 AGNYLSSLILSLVPVFTARGGSPGWIPDNLNEGHLDRFYLMMAGLSFFNIVVFVFCAMRY 580



>gb:AY305030_1597541 Oryza sativa (japonica cultivar-group) nitrate
           transporter NRT1;2 mRNA, complete cds.
          Length = 593

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/177 (26%), Positives = 82/177 (46%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+++Y  +++P+ + +           RMG G  +  +   +   VE +R   A + E  
Sbjct: 419 WVLMYSSVIVPMLNSLSLANGEPSQLQRMGAGRLLMAFAMAVAALVEMMRLDAAGRGE-- 476

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
                   +SI W +PQY  +  A     +AQ +FF SE P SM    +++         
Sbjct: 477 -------SLSIAWQMPQYFALAGAEVFCYIAQLEFFYSEAPESMKSMCTSLALLTVALGS 529

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +N  +   G   WI+ ++NEGH DYF+WV+A L  +NF+++   +R+Y
Sbjct: 530 YMSSFIYAVVNAFTAVDGRPGWISDNLNEGHMDYFFWVVAALCTLNFVVYSAFARTY 586



>gb:AE016959_1020657 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732725
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750476 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 576

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 44/173 (25%), Positives = 82/173 (47%), Gaps = 4/173 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y+ + +P+     G         R+G G+ +S    V    +E ++R   ++    +
Sbjct: 396 VPVYEIISVPLVKHFTGQDKGFSHAQRIGIGLSLSMIMMVYAALLE-MKRLAIVQSSGLA 454

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           D+   + MSILW  P Y L G++   + +  +QFF  + P SM ++              
Sbjct: 455 DHNVAAPMSILWQTPAYFLQGVSEIFSCIGMSQFFYDQAPDSMKSVCAALGQLAIASGAY 514

Query: 364 XXX----XINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICS 510
                   +  ++ +SG   WI  ++NEGH DYF+W++A LS++N  +F+  S
Sbjct: 515 FNTFVLGAVAVITTSSGAPGWIPDNLNEGHLDYFFWMMATLSLLNLAMFVYSS 567



>pir|A96710|A96710 hypothetical protein F24J5.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_894478 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY091784_1574742 Arabidopsis thaliana
           At1g68570/F24J5_7 mRNA, complete
           cds.>gb:BT002278_1635881 Arabidopsis thaliana
           At1g68570/F24J5_7 mRNA, complete cds.>gb:F24J5_1678009
           Arabidopsis thaliana chromosome 1 BAC F24J5 sequence,
           complete sequence.
          Length = 596

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I+ YDR+ + VA +  G         RMG G  +S    ++ G VE  R+S+AI+     
Sbjct: 389 IIFYDRVFVKVARKFTGLERGITFLHRMGIGFVISIIATLVAGFVEVKRKSVAIEHGLLD 448

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXXX 351
                  +S LW++PQY L G+A    ++   +FF  + P SM +               
Sbjct: 449 KPHTIVPISFLWLIPQYGLHGVAEAFMSIGHLEFFYDQAPESMRSTATALFWMAISIGNY 508

Query: 352 XXXXXXXXINELSINSGNGSWIT-SDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   +++ S      +W+  +++N G  +YFYW++  L  VN + +L C++ Y
Sbjct: 509 VSTLLVTLVHKFSAKPDGSNWLPDNNLNRGRLEYFYWLITVLQAVNLVYYLWCAKIY 565



>gb:AY064057_1565995 Arabidopsis thaliana putative peptide
           transporter protein (At5g46050) mRNA, complete cds.
          Length = 582

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 54/195 (27%), Positives = 87/195 (44%), Gaps = 10/195 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           IVLYDR+ + +  +  GN        RMG G+       ++    E  R  +A       
Sbjct: 387 IVLYDRVFVKITRKFTGNPRGITLLQRMGIGLIFHILIMIVASVTERYRLKVAADHGLIH 446

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
                  ++I  ++PQ+ LMG+A     VA+ +FF  + P SM ++              
Sbjct: 447 QTGVKLPLTIFALLPQFVLMGMADSFLEVAKLEFFYDQAPESMKSLGTSYSTTSLAIGNF 506

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY---- 519
                   ++E++   G G WI +++NE   DY+Y   A L++VNF+LFL+  + Y    
Sbjct: 507 MSSFLLSTVSEITKKRGRG-WILNNLNESRLDYYYLFFAVLNLVNFILFLVVVKFYVYRA 565

Query: 520 --GPSKDEKPVAMEE 558
               S D K V M+E
Sbjct: 566 EVTDSVDVKEVEMKE 580



>gb:AK118142_1816136 Arabidopsis thaliana At4g21680 mRNA for
           putative peptide transporter, complete cds, clone:
           RAFL19-44-G15.
          Length = 589

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 7/186 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKS--RMGFGIFVSFWYAVLVGKVESIRRSLAIKQE 174
           +I  Y R L P+ +R+     + G     RMG G+ ++    +  G VE  R  L  K+ 
Sbjct: 393 FIFAYRRFLDPLFARLNKTERNKGLTELQRMGIGLVIAIMAMISAGIVEIHR--LKNKEP 450

Query: 175 HSSDNLGDSK-MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXX 339
            S+ ++  S  +SI W VPQY L+G +     V Q +FF S+ P  +    S +      
Sbjct: 451 ESATSISSSSTLSIFWQVPQYMLIGASEVFMYVGQLEFFNSQAPTGLKSFASALCMASIS 510

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       + ++S       WI  ++N+GH + FY++LAGL+  +F+++LIC++ Y
Sbjct: 511 LGNYVSSLLVSIVMKISTTDDVHGWIPENLNKGHLERFYFLLAGLTAADFVVYLICAKWY 570

Query: 520 GPSKDE 537
              K E
Sbjct: 571 KYIKSE 576



>gb:AB006698_1509861 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCL19.>gb:AY150511_1585076 Arabidopsis thaliana
           peptide transporter (At5g46050) mRNA, complete cds.
          Length = 582

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 54/195 (27%), Positives = 87/195 (44%), Gaps = 10/195 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           IVLYDR+ + +  +  GN        RMG G+       ++    E  R  +A       
Sbjct: 387 IVLYDRVFVKITRKFTGNPRGITLLQRMGIGLIFHILIMIVASVTERYRLKVAADHGLIH 446

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
                  ++I  ++PQ+ LMG+A     VA+ +FF  + P SM ++              
Sbjct: 447 QTGVKLPLTIFALLPQFVLMGMADSFLEVAKLEFFYDQAPESMKSLGTSYSTTSLAIGNF 506

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY---- 519
                   ++E++   G G WI +++NE   DY+Y   A L++VNF+LFL+  + Y    
Sbjct: 507 MSSFLLSTVSEITKKRGRG-WILNNLNESRLDYYYLFFAVLNLVNFVLFLVVVKFYVYRA 565

Query: 520 --GPSKDEKPVAMEE 558
               S D K V M+E
Sbjct: 566 EVTDSVDVKEVEMKE 580



>pir|T05843|T05843 peptide transport protein homolog F17L22.140 -
           Arabidopsis thaliana>gb:ATCHRIV55_1546005 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           55.>gb:ATF17L22_1548990 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17L22 (ESSAII project).
          Length = 576

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 54/186 (29%), Positives = 90/186 (48%), Gaps = 7/186 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKS--RMGFGIFVSFWYAVLVGKVESIRRSLAIKQE 174
           +I  Y R L P+ +R+     + G     RMG G+ ++    +  G VE  R  L  K+ 
Sbjct: 380 FIFAYRRFLDPLFARLNKTERNKGLTELQRMGIGLVIAIMAMISAGIVEIHR--LKNKEP 437

Query: 175 HSSDNLGDSK-MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXX 339
            S+ ++  S  +SI W VPQY L+G +     V Q +FF S+ P  +    S +      
Sbjct: 438 ESATSISSSSTLSIFWQVPQYMLIGASEVFMYVGQLEFFNSQAPTGLKSFASALCMASIS 497

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       + ++S       WI  ++N+GH + FY++LAGL+  +F+++LIC++ Y
Sbjct: 498 LGNYVSSLLVSIVMKISTTDDVHGWIPENLNKGHLERFYFLLAGLTAADFVVYLICAKWY 557

Query: 520 GPSKDE 537
              K E
Sbjct: 558 KYIKSE 563



>gb:AP003566_1830921 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 617

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 49/176 (27%), Positives = 76/176 (43%), Gaps = 3/176 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDR  +PVA R    +       R+G G+ ++    V+   VE+ R  +A      
Sbjct: 428 FIPVYDRAFVPVARRFTRASSGITMLQRIGTGLVLALAAMVVAALVEARRLGVARDAGMV 487

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
            D      MS+ W+VPQY L G++     +   +FF  + P   RS+             
Sbjct: 488 DDPKAALPMSLWWMVPQYVLFGLSDVFAMIGLQEFFYDQVPDALRSLGLAFFLSIFGVGH 547

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                     + +      SW  +++N  H DYFYW+LAGL  V  + F+  SR Y
Sbjct: 548 FFSSFIISAIDGATKKSGASWFANNLNRAHLDYFYWLLAGLCAVELVAFVFVSRVY 603



>gb:AP003235_1825911 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP004669_1843000 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0491F11.
          Length = 545

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 49/176 (27%), Positives = 76/176 (43%), Gaps = 3/176 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I +YDR  +PVA R    +       R+G G+ ++    V+   VE+ R  +A      
Sbjct: 356 FIPVYDRAFVPVARRFTRASSGITMLQRIGTGLVLALAAMVVAALVEARRLGVARDAGMV 415

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
            D      MS+ W+VPQY L G++     +   +FF  + P   RS+             
Sbjct: 416 DDPKAALPMSLWWMVPQYVLFGLSDVFAMIGLQEFFYDQVPDALRSLGLAFFLSIFGVGH 475

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                     + +      SW  +++N  H DYFYW+LAGL  V  + F+  SR Y
Sbjct: 476 FFSSFIISAIDGATKKSGASWFANNLNRAHLDYFYWLLAGLCAVELVAFVFVSRVY 531



>gb:AB128925_1528356 Prunus persica PpNRT1 gene for nitrate
           transporter, partial cds.
          Length = 594

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 2/174 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDRL++P+A +   N        RMG G+  S +  V     E  R ++A     + 
Sbjct: 400 VPVYDRLIVPMARKALENPQGLTPLQRMGVGLVFSIFAMVAAALTEVKRLNIARSHGLTD 459

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           +   +  +S+ W+VPQ+  +G       + Q  FF+ E P+ M T+              
Sbjct: 460 NPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF 519

Query: 364 XXXXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +       N  W+  ++N+G    FYW+LA LS +N +++L C+  Y
Sbjct: 520 FSSLLVTIVHKTTGHNKPWLADNLNQGKLYDFYWLLALLSALNLVIYLFCANWY 573



>gb:AB102805_1526336 Nicotiana tabacum NtNRT1.1-s mRNA for nitrate
           transporter, complete cds.
          Length = 590

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 4/175 (2%)
 Frame = +1

Query: 7   VLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSD 186
           + YDR ++PV  R+  N        R+  G+ +S    V     E  R ++A     ++D
Sbjct: 397 IFYDRAVVPVCRRVLNNPHGTTPLQRIAVGLILSIIAMVAAALTEVKRLNVAHLHGLTND 456

Query: 187 NLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXX----XXXXXXXXX 354
                 +S+ W+VPQ+ L+G       + Q  FF+ E P+ M T+               
Sbjct: 457 ANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFF 516

Query: 355 XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  ++++++ +    W+  ++N+G    FYW+LA LS++N ++FL  SR Y
Sbjct: 517 SSILVTIVHKVTVKN---PWLADNLNQGRLYDFYWLLATLSVLNLMIFLFISRRY 568



>gb:AB089677_1524914 Prunus persica PpNRT1 mRNA for nitrate
           transporter, complete cds.
          Length = 596

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 44/174 (25%), Positives = 78/174 (44%), Gaps = 2/174 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDRL++P+A +   N        RMG G+  S +  V     E  R ++A     + 
Sbjct: 400 VPVYDRLIVPMARKALENPQGLTPLQRMGVGLVFSIFAMVAAALTEVKRLNIARSHGLTD 459

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           +   +  +S+ W+VPQ+  +G       + Q  FF+ E P+ M T+              
Sbjct: 460 NPTAEIPLSVFWLVPQFFFVGSGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFF 519

Query: 364 XXXXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +       N  W+  ++N+G    FYW+LA LS +N +++L C+  Y
Sbjct: 520 FSSLLVTIVHKTTGHNKPWLADNLNQGKLYDFYWLLALLSALNLVIYLFCANWY 573



>gb:AB006698_1509860 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCL19.
          Length = 586

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 46/176 (26%), Positives = 82/176 (46%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           IV+YDR+ +    ++ GN        RMG G+ +     ++    E  R  +A +   + 
Sbjct: 387 IVIYDRVFVKFMRKLTGNPRGITLLQRMGIGMILHILIMIIASITERYRLKVAAEHGLTH 446

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXX---- 351
                  +SI  ++PQY LMG+A     +A+ +FF  + P SM ++              
Sbjct: 447 QTAVPIPLSIFTLLPQYVLMGLADAFIEIAKLEFFYDQAPESMKSLGTSYTSTSMAVGYF 506

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   +++++   G G WI +++NE   D +Y   A L+++NF+LFL+  R Y
Sbjct: 507 MSSILLSSVSQITKKQGRG-WIQNNLNESRLDNYYMFFAVLNLLNFILFLVVIRFY 561



>pir|E86397|E86397 protein T7N9.14 [imported] - Arabidopsis
            thaliana>gb:AE005172_891587 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC000348_1530066 Genomic sequence for
            Arabidopsis thaliana BAC T7N9 from chromosome I, complete
            sequence.
          Length = 700

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 48/177 (27%), Positives = 80/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1    WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
            W+ +Y+ LL+P   R+R   V      RMG GI  +       G VE +RR+ A +    
Sbjct: 504  WVPIYEHLLVPFLWRMRKFRVTL--LQRMGIGIVFAILSMFTAGFVEGVRRTRATEM--- 558

Query: 181  SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXX 348
                  ++MS+ W+     LMG+    N +   +FF S+FP  M +I             
Sbjct: 559  ------TQMSVFWLALPLILMGLCESFNFIGLIEFFNSQFPEHMRSIANSLFPLSFAAAN 612

Query: 349  XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                     ++++S    +  W+  D++ G  DYFY+++A L +VN + F  C+  Y
Sbjct: 613  YLSSLLVTTVHKVSGTKDHPDWLNKDLDRGKLDYFYYLIAVLGVVNLVYFWYCAHRY 669



>gb:NPL277084_1691078 Nicotiana plumbaginifolia mRNA for putative
           low-affinity nitrate transporter (nrt1.1 gene).
          Length = 590

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 45/175 (25%), Positives = 81/175 (46%), Gaps = 4/175 (2%)
 Frame = +1

Query: 7   VLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSD 186
           + YDR ++PV  R+  N        R+  G+ +S    V     E  R ++A     ++D
Sbjct: 397 IFYDRAVVPVCRRVLNNPHGTTPLQRIAVGLILSIIAMVAAALTEVKRLNVAHLHGLTND 456

Query: 187 NLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXX----XXXXXXXXX 354
                 +S+ W+VPQ+ L+G       + Q  FF+ E P+ M T+               
Sbjct: 457 ANAKVPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLSLGFFV 516

Query: 355 XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  ++++++ +    W+  ++N+G    FYW+LA LS++N ++FL  SR Y
Sbjct: 517 SSILVTIVHKVTVKN---PWLADNLNQGRLYDFYWLLATLSVLNLMVFLFISRRY 568



>pir|G84829|G84829 probable PTR2 family peptide transporter
           [imported] - Arabidopsis thaliana>gb:AC002336_1530447
           Arabidopsis thaliana chromosome 2 clone T2P4 map
           CIC10A06, complete sequence.>gb:AY094400_1575706
           Arabidopsis thaliana At2g40460/T2P4.19 mRNA, complete
           cds.>gb:AY150513_1585078 Arabidopsis thaliana putative
           PTR2 family peptide transporter (At2g40460) mRNA,
           complete cds.>gb:BT002242_1635845 Arabidopsis thaliana
           At2g40460/T2P4.19 mRNA, complete cds.
          Length = 583

 Score = 80.1 bits (196), Expect = 5e-14
 Identities = 47/182 (25%), Positives = 82/182 (45%), Gaps = 4/182 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YD+  +P   +  GN        R+G G  +    A+ +     ++R   IK+ H +
Sbjct: 378 VPMYDQSFVPFMRKKTGNPRGITLLQRLGVGFAIQI-VAIAIASAVEVKRMRVIKEFHIT 436

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXXX 351
                  MSI W++PQY+L+GI    NA+   +FF  + P  M    +T           
Sbjct: 437 SPTQVVPMSIFWLLPQYSLLGIGDVFNAIGLLEFFYDQSPEEMQSLGTTFFTSGIGLGNF 496

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   I++++   G  SWI +++N+   DY+Y  L  +S+VN  LF+  +  Y    
Sbjct: 497 LNSFLVTMIDKITSKGGGKSWIGNNLNDSRLDYYYGFLVVISIVNMGLFVWAASKYVYKS 556

Query: 532 DE 537
           D+
Sbjct: 557 DD 558



>gb:OSJN00129_1695376 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNba0093F12, complete sequence.
          Length = 575

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 47/177 (26%), Positives = 78/177 (44%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+++Y  +++P+               RMG G  +      +   VE +R   A + E  
Sbjct: 401 WVLVYGSVIVPLLRSFSPANGEPSQLRRMGAGRLLIAVAMAIAALVEMVRLDAAARGE-- 458

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
                   +SI W +PQY ++        +AQ +FF SE P SM +I             
Sbjct: 459 -------SLSIAWQMPQYFMLAGGEVFCYIAQLEFFYSEAPESMKSICTSLALLTVALGS 511

Query: 361 XXXXXI----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                I    N  +   G   WI+ ++NEGH DYF+WV++ L  +NF+++   +R+Y
Sbjct: 512 YMSSFIYAVVNAFTAVDGRPGWISDNLNEGHLDYFFWVMSALCTLNFVVYSAFARNY 568



>gb:AY063897_1565844 Arabidopsis thaliana putative PTR2 family
           peptide transporter protein (At2g40460) mRNA, complete
           cds.
          Length = 583

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 47/182 (25%), Positives = 82/182 (45%), Gaps = 4/182 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YD+  +P   +  GN        R+G G  +    A+ +     ++R   IK+ H +
Sbjct: 378 VPMYDQSFVPFMRKKTGNPRGITLLQRLGVGFAIQI-VAIAIASAVEVKRMRVIKEFHIT 436

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXXX 351
                  MSI W++PQY+L+GI    NA+   +FF  + P  M    +T           
Sbjct: 437 SPTQVVPMSIFWLLPQYSLLGIGDVFNAIGLLEFFYDQSPGEMQSLGTTFFTSGIGLGNF 496

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   I++++   G  SWI +++N+   DY+Y  L  +S+VN  LF+  +  Y    
Sbjct: 497 LNSFLVTMIDKITSKGGGKSWIGNNLNDSRLDYYYGFLVVISIVNMGLFVWAASKYVYKS 556

Query: 532 DE 537
           D+
Sbjct: 557 DD 558



>gb:AC130729_1740923 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668F02, complete sequence.
          Length = 500

 Score = 79.0 bits (193), Expect = 1e-13
 Identities = 52/188 (27%), Positives = 80/188 (42%), Gaps = 2/188 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + LYDR  +P+A R+ G         RM  G+ +S         VE  RR  A       
Sbjct: 295 LALYDRAFVPLARRVTGLPSGITYFQRMAIGLGISILGVASAALVEVRRRGAAADHGLLD 354

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-STIXXXXXXXXXXXXX 360
                  +S+ W+VPQYA+ G+A   ++VA  +F   + P SM S+              
Sbjct: 355 SPAAVVPISVFWLVPQYAVHGVAEAFSSVAHMEFLYDQAPESMRSSAAALFWLSSSLGNY 414

Query: 361 XXXXXINELS-INSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE 537
                +  +     G G W+  +IN G  D +YW++  L ++N   +L+C   Y     E
Sbjct: 415 MGTVLVTAVQRATRGGGEWLQDNINRGRLDCYYWLVTTLMVLNLGYYLVCFHFYTMKPLE 474

Query: 538 KPVAMEED 561
             VA E+D
Sbjct: 475 --VAEEDD 480



>gb:AC108502_1738512 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1378_A04, complete
           sequence.>gb:AC130600_1740744 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0048I21,
           complete sequence.
          Length = 530

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 50/176 (28%), Positives = 79/176 (44%), Gaps = 4/176 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           ++LY+ +L+P A R  G         R+G GI +     ++   VE  R S A      +
Sbjct: 349 VLLYEHVLVPAARRATGVATGITMLQRIGAGIAMCAVTLLVAALVEMRRLSAA----RDA 404

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXX----XX 351
           D      MS+ W+VPQY L G A     V   +FF  + P ++ ++              
Sbjct: 405 DPGAAVPMSLWWMVPQYVLFGAADVFAMVGMQEFFYDQVPGALKSLGLALYLSVLGVGSF 464

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   I+ ++   G  SW   D+N GH DYFY +LA L++++ L ++  S SY
Sbjct: 465 ISSFLISAIDVVTRRDGGTSWFDDDLNRGHLDYFYLLLAALTVLDLLAYVYFSMSY 520



>gb:AC105769_1738202 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1301_G07, complete
           sequence.>gb:AC108502_1738515 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1378_A04, complete
           sequence.
          Length = 469

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 51/169 (30%), Positives = 77/169 (45%), Gaps = 4/169 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I +YDR+++PVA R  G         R+G G+ +S    V+   VE+ RR  A +     
Sbjct: 278 IPVYDRVIVPVARRYTGVPSGITMLQRIGAGMVLSLVSMVIAALVET-RRLRAARDAGLV 336

Query: 184 DNLG-DSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP---RSMSTIXXXXXXXXXX 351
           D  G    MS+ W+VPQY L G A     V   +FF  + P   RS+             
Sbjct: 337 DKAGVPVPMSLWWMVPQYVLFGAADVFTMVGLQEFFYDQVPDKLRSLGLALYLSIFGVGS 396

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLF 498
                     + +  +  GSW ++++N  H DYFYW++A LS +  L +
Sbjct: 397 FISSALVSGIDRATAARGGSWFSNNLNRAHLDYFYWLIAALSALELLAY 445



>gb:OSJN00129_1695375 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNba0093F12, complete sequence.
          Length = 617

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 48/181 (26%), Positives = 81/181 (44%), Gaps = 4/181 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ LY+R ++P A R  G  V       MGFG   +   AV V      RR  A +    
Sbjct: 443 FVTLYNRAVMPAARRCLGRAVAFTPLQLMGFGHATAV-VAVGVAACTEARRLHAARA--- 498

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXX- 357
               G   M I W++PQY +M  +  S  V Q +FF  + P +M +              
Sbjct: 499 ----GAPAMGIAWLLPQYLVMAASDASLTVGQLEFFYDQSPETMRSASTAFYFLAISLGN 554

Query: 358 ---XXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    + +++   GN  W   D+++GH DYF+ ++  ++ VNF +++  +++Y P 
Sbjct: 555 LLNSQLVTLVAKVTAVWGNAGWFPLDLDDGHLDYFFLLIVAITAVNFAVYVALAKNYTPK 614

Query: 529 K 531
           K
Sbjct: 615 K 615



>gb:AP005175_1848772 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBb0040H10.>gb:AP005809_1858247 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0039M16.
          Length = 577

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 4/177 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ L +++++PV      N        R+G G F+   +A+ +     ++R  +++    
Sbjct: 400 WVFLVNKVIIPVTRACFANGAEMTQLQRIGIGRFLMI-FAMAIAAFLEMKRLESVQG--- 455

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
               GD  +SI W +PQY ++  A     + Q +FF  + P SM ++             
Sbjct: 456 ----GDQPLSIAWQLPQYFVIAGAECFTIITQLEFFHGQAPDSMKSMLTAFALLTTALGN 511

Query: 361 XXXXXINELSINSG----NGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                I  L         +  WI  D+N+GH DY+YW LA +S VNF++++  +  Y
Sbjct: 512 YFSSAIITLIARVTGTWHSPGWIPDDLNKGHLDYYYWCLAAISAVNFVVYIYFASKY 568



>gb:AP003999_1836131 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1115_A05.>gb:AP006161_1861123 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:B1267B06.
          Length = 609

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 48/170 (28%), Positives = 77/170 (45%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           L +R+L+P A R+        +  R+G G+ ++         VE  RR  A      +D 
Sbjct: 402 LNERVLVPAARRLTRRPQGLTSLQRVGAGLVLATVAMATSALVEKKRRDAA------NDG 455

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
            G   +S  W+VPQ+ L+G       V Q +FFI E P  M ++                
Sbjct: 456 GGGGMISAFWLVPQFFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLVTLSMGFFLS 515

Query: 370 XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             +      +  G+WI +D++ G  D FYW+LA L + NF +FL+ +R +
Sbjct: 516 SFLVFAVDAATRGAWIRNDLDAGRLDLFYWMLAVLGVANFAVFLVFARRH 565



>gb:AE016959_1020642 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068654_1540428
           Genomic Sequence For Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare Clone OSJNBa0015O22
           From Chromosome 10, complete
           sequence.>gb:AE017049_1750461 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 601

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 46/174 (26%), Positives = 76/174 (43%), Gaps = 5/174 (2%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           YDR+L+P  SR+ G         R+G G+  +         VE+ R          S   
Sbjct: 429 YDRVLMPAVSRLTGVKRGLSELHRIGVGMVFAVLALAAAAAVETARLR--------SVEA 480

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXX 372
               +SILW  PQY L+G+A     V   +F   + P +M ++                 
Sbjct: 481 DAPAVSILWQAPQYVLVGVAKVFGVVGYIEFAYEQSPDAMRSLCQACSLIMVTPGSYLLS 540

Query: 373 XINELSIN-----SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
            +  +  +      G+G WI  ++NEGH D F+W++A L ++N + F+ C+ +Y
Sbjct: 541 AMLTIISSVTGGGGGHGGWIPENLNEGHLDRFFWLMAALQLINLIAFVCCAATY 594



>gb:AF361587_1791333 Arabidopsis thaliana AT3g53960/F5K20_260 mRNA,
           complete cds.
          Length = 310

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y++LL+P+  R  GN        R+G G+  S +  ++   +E  R   A K+ H +
Sbjct: 107 VTIYEKLLVPLLRRATGNERGISILQRIGVGMVFSLFAMIIAALIEKKRLDYA-KEHHMN 165

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
             +    +S +W+ PQ+ ++G+A     V   ++F  + P SM ++              
Sbjct: 166 KTM---TLSAIWLAPQFLVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF 222

Query: 364 XXXXINELSIN-----SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +S +     SG G W   D+N    D FYW+LA L+  N   F+I +  Y
Sbjct: 223 VNNLLITVSDHLAEEISGKG-WFGKDLNSSRLDRFYWMLAALTAANICCFVIVAMRY 278



>pir|T45936|T45936 transporter-like protein - Arabidopsis
           thaliana>gb:ATF5K20_1550800 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F5K20.
          Length = 620

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 45/177 (25%), Positives = 80/177 (45%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y++LL+P+  R  GN        R+G G+  S +  ++   +E  R   A K+ H +
Sbjct: 399 VTIYEKLLVPLLRRATGNERGISILQRIGVGMVFSLFAMIIAALIEKKRLDYA-KEHHMN 457

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
             +    +S +W+ PQ+ ++G+A     V   ++F  + P SM ++              
Sbjct: 458 KTM---TLSAIWLAPQFLVLGVADAFTLVGLQEYFYDQVPDSMRSLGIAFYLSVLGAASF 514

Query: 364 XXXXINELSIN-----SGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +S +     SG G W   D+N    D FYW+LA L+  N   F+I +  Y
Sbjct: 515 VNNLLITVSDHLAEEISGKG-WFGKDLNSSRLDRFYWMLAALTAANICCFVIVAMRY 570



>pir|T48587|T48587 peptide transporter-like protein - Arabidopsis
           thaliana>gb:ATT22N19_1555307 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T22N19 (ESSA
           project).>gb:AY072338_1567155 Arabidopsis thaliana
           peptide transporter-like protein (At5g13400; T22N19_50)
           mRNA, complete cds.>gb:AY128754_1580834 Arabidopsis
           thaliana peptide transporter-like protein (At5g13400)
           mRNA, complete cds.
          Length = 624

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 50/175 (28%), Positives = 78/175 (44%), Gaps = 5/175 (2%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           LY  + +P+  RI GN        R+G G+ VS       G  E+ RR  AI+     + 
Sbjct: 434 LYYSVFVPITRRITGNPHGASQLQRVGIGLAVSIISVAWAGLFENYRRHYAIQNGFEFNF 493

Query: 190 LGDSK-MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXX 366
           L     ++  W++ QY L+GIA     V   +F   E P +M +I               
Sbjct: 494 LTQMPDLTAYWLLIQYCLIGIAEVFCIVGLLEFLYEEAPDAMKSIGSAYAALAGGLGCFA 553

Query: 367 XXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
              +N +    + +S   SW++ +IN G +D  YW+L  LS +NF +FL  +  Y
Sbjct: 554 ATILNNIVKAATRDSDGKSWLSQNINTGRFDCLYWLLTLLSFLNFCVFLWSAHRY 608



>gb:AE016959_1020652 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732720
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AE017049_1750471 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 591

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 43/160 (26%), Positives = 72/160 (45%), Gaps = 4/160 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YD +L+P+A R  GN        R+G G+ +S        +VE  RR  A ++E  
Sbjct: 406 WVPVYDAVLVPLARRATGNDRGLSHLQRIGVGLALSAVAMAYSAQVERRRRRPAAEEE-- 463

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
                   MSI+W  P Y ++G+A    ++   +FF    P SM ++             
Sbjct: 464 -------AMSIMWQAPCYLVLGMAEVFTSIGMLEFFYERSPGSMKSLGTSLAHLAVATAN 516

Query: 361 XXXXXINELSI----NSGNGSWITSDINEGHYDYFYWVLA 468
                +  + +      G   WI  +++EGH DYF+W++A
Sbjct: 517 YLNSGVLGVVVAATTRGGGAGWIPDNLDEGHLDYFFWMMA 556



>pir|T52608|T52608 probable nitrate transporter [imported] -
           Arabidopsis thaliana>gb:ATH011604_1551926 Arabidopsis
           thaliana mRNA for nitrate transporter.
          Length = 577

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 4/188 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR ++P   + +G       + R+  G+ +S         VE  R S+A      S
Sbjct: 386 LAVYDRAIMPFWKKWKGKPGFSSLQ-RIAIGLVLSTAGMAAAALVEQKRLSVA-----KS 439

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
            +     +S+  +VPQ+ L+G         Q  FFI++ P+ M T+              
Sbjct: 440 SSQKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFF 499

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   +  ++  S +  W+  +IN G  DYFYW+L  LS +NF++++IC+  + P+K
Sbjct: 500 VSSFLVSIVKRVTSTSTDVGWLADNINHGRLDYFYWLLVILSGINFVVYIICALWFKPTK 559

Query: 532 DEKPVAME 555
            +  V  E
Sbjct: 560 GKDSVEKE 567



>pir|F84663|F84663 probable nitrate transporter [imported] -
           Arabidopsis thaliana>gb:AC003105_1531086 Arabidopsis
           thaliana chromosome 2 clone F18A8 map B68, complete
           sequence.
          Length = 586

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 4/188 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR ++P   + +G       + R+  G+ +S         VE  R S+A      S
Sbjct: 395 LAVYDRAIMPFWKKWKGKPGFSSLQ-RIAIGLVLSTAGMAAAALVEQKRLSVA-----KS 448

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
            +     +S+  +VPQ+ L+G         Q  FFI++ P+ M T+              
Sbjct: 449 SSQKTLPISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFF 508

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   +  ++  S +  W+  +IN G  DYFYW+L  LS +NF++++IC+  + P+K
Sbjct: 509 VSSFLVSIVKRVTSTSTDVGWLADNINHGRLDYFYWLLVILSGINFVVYIICALWFKPTK 568

Query: 532 DEKPVAME 555
            +  V  E
Sbjct: 569 GKDSVEKE 576



>gb:CSNITR1_1674000 Cucumis sativus mRNA for nitrite transporter
           (NiTR1 gene).
          Length = 604

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 6/185 (3%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +VLYDRLL+P A ++  N        RMG G  ++   A LV  +  I+R          
Sbjct: 399 LVLYDRLLVPFAKKLTHNPSGITCLQRMGVGFAINI-LATLVSSIVEIKRKKVAANHGLL 457

Query: 184 DN-LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           DN       S+ W+VPQ+ L GIA    +V   +F   + P S+ +              
Sbjct: 458 DNPTATIPFSVFWLVPQFWLHGIAEVFMSVGHLEFMYDQSPESLRSTATALYWLAISVGN 517

Query: 361 XXXXXINEL--SINSGNGSWITS-DINEGHYDYFYWVLAGLSMVNFLLFLICS--RSYGP 525
                +  L         +W+   ++N G  +Y+YW+++G+ ++N + ++IC+   +Y P
Sbjct: 518 YIGTLMVYLVHKYTGEEHNWLPDRNLNRGRLEYYYWLVSGIQVMNLVYYVICAWFYTYKP 577

Query: 526 SKDEK 540
            ++EK
Sbjct: 578 LEEEK 582



>gb:AB102807_1526338 Nicotiana tabacum NtNRT1.2-s mRNA for nitrate
           transporter, complete cds.
          Length = 594

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 42/174 (24%), Positives = 75/174 (43%), Gaps = 2/174 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           ++ YDR+++P+  R            R+  G+ +S    +     E  R  +A     ++
Sbjct: 399 VIFYDRVIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKVAHLHGLTN 458

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           D      +S+ W+VPQ+ L+G       + Q  FF+ E P+ M T+              
Sbjct: 459 DANATIPLSVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLALGFF 518

Query: 364 XXXXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +   +      W+  ++N+G    FYW+LA LS++N + FL  SR Y
Sbjct: 519 FSSILVTIVHVVTGTTNPWLADNLNQGRLYDFYWLLAILSVLNLMFFLYFSRKY 572



>gb:AE016959_1022199 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC107314_1738429
           Oryza sativa (japonica cultivar-group) cultivar
           Nipponbare clone OJ1208D02 from chromosome 10, complete
           sequence.>gb:AE017085_1752018 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 39 of 77 of the
           complete sequence.
          Length = 551

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 46/173 (26%), Positives = 76/173 (43%), Gaps = 4/173 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I +YD  L+P+A R+ G         R+G G+ +S         VE+ R ++A       
Sbjct: 374 IPVYDAALVPLARRVTGRDRGVSHMQRIGVGLALSAVAMAYSALVEARRLAMAAAA---- 429

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
                ++MSI W VP + ++G       +   +F   + P SM ++              
Sbjct: 430 ---AGTRMSIAWQVPSFFVLGAGEVFAVIGMLEFCYEQSPASMKSLGTALVQLAVAVANY 486

Query: 364 XXXXINEL----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICS 510
               +  +    +   G   WI   ++EGH DYF+W++A LS++N L FL CS
Sbjct: 487 LNSGMLRVVAAATARGGGAGWIPDKLDEGHLDYFFWMMAALSVLNLLQFLHCS 539



>pir|T10255|T10255 nitrite transport protein, chloroplast - cucumber
          Length = 484

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 6/185 (3%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +VLYDRLL+P A ++  N        RMG G  ++   A LV  +  I+R          
Sbjct: 279 LVLYDRLLVPFAKKLTHNPSGITCLQRMGVGFAINI-LATLVSSIVEIKRKKVAANHGLL 337

Query: 184 DN-LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
           DN       S+ W+VPQ+ L GIA    +V   +F   + P S+ +              
Sbjct: 338 DNPTATIPFSVFWLVPQFWLHGIAEVFMSVGHLEFMYDQSPESLRSTATALYWLAISVGN 397

Query: 361 XXXXXINEL--SINSGNGSWITS-DINEGHYDYFYWVLAGLSMVNFLLFLICS--RSYGP 525
                +  L         +W+   ++N G  +Y+YW+++G+ ++N + ++IC+   +Y P
Sbjct: 398 YIGTLMVYLVHKYTGEEHNWLPDRNLNRGRLEYYYWLVSGIQVMNLVYYVICAWFYTYKP 457

Query: 526 SKDEK 540
            ++EK
Sbjct: 458 LEEEK 462



>gb:AY035037_1559815 Arabidopsis thaliana putative oligopeptide
           transporter protein (At1g59740) mRNA, complete
           cds.>gb:AY051041_1562517 Arabidopsis thaliana putative
           oligopeptide transporter protein (At1g59740) mRNA,
           complete cds.
          Length = 591

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 6/176 (3%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + LYD  L+P A ++ G+       +R+G G+F+S +  V    +E  RR  ++      
Sbjct: 405 VPLYDSFLVPFARKLTGHNSGIPPLTRIGIGLFLSTFSMVSAAMLEKKRRDSSV------ 458

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST----IXXXXXXXXXX 351
             L    +SI W+ PQ+ + GI+    AV   +FF  +  + M +    +          
Sbjct: 459 --LDGRILSIFWITPQFLIFGISEMFTAVGLIEFFYKQSAKGMESFLMALTYCSYSFGFY 516

Query: 352 XXXXXXXXINELSINSGNGS-WI-TSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                   +N+++  S +   W+  +D+N+   D FYW+LA LS++NFL +L  SR
Sbjct: 517 FSSVLVSVVNKITSTSVDSKGWLGENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR 572



>gb:AE016959_1023039 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC026815_1539706
           Oryza sativa chromosome 10 BAC OSJNBa0079L16 genomic
           sequence, complete sequence.>gb:AE017104_1752858 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           58 of 77 of the complete sequence.
          Length = 608

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 49/182 (26%), Positives = 82/182 (45%), Gaps = 10/182 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +VLYDR+ +P+ +R  GN        RMG G+ +      +    E  R  LA+ +EH  
Sbjct: 396 VVLYDRVFMPLMARATGNPRGITLLQRMGVGLVIHIAIMGIASVTE--RHRLAVAREHG- 452

Query: 184 DNLGDSK-----MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
             + DSK     ++I  ++PQ+ LMG+A     VA+ +FF  + P  M ++         
Sbjct: 453 --IADSKGTTIPLTIFVLLPQFVLMGVADAFLEVAKIEFFYDQAPEGMKSLGTSYAMTSL 510

Query: 349 XXXXXXXXXI-----NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                    +     +    + G G WI +++N    D++Y   A L+ VN + F +  R
Sbjct: 511 GVGNFLSSLLLSTVAHVTRRHGGGGGWIQNNLNASRLDHYYAFFAVLNCVNLVFFFLVCR 570

Query: 514 SY 519
            Y
Sbjct: 571 LY 572



>pir|C96621|C96621 hypothetical protein F23H11.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_893657 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007258_1535658 Arabidopsis thaliana
           chromosome I BAC F23H11 genomic sequence, complete
           sequence.
          Length = 474

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 6/176 (3%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + LYD  L+P A ++ G+       +R+G G+F+S +  V    +E  RR  ++      
Sbjct: 288 VPLYDSFLVPFARKLTGHNSGIPPLTRIGIGLFLSTFSMVSAAMLEKKRRDSSV------ 341

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST----IXXXXXXXXXX 351
             L    +SI W+ PQ+ + GI+    AV   +FF  +  + M +    +          
Sbjct: 342 --LDGRILSIFWITPQFLIFGISEMFTAVGLIEFFYKQSAKGMESFLMALTYCSYSFGFY 399

Query: 352 XXXXXXXXINELSINSGNGS-WI-TSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                   +N+++  S +   W+  +D+N+   D FYW+LA LS++NFL +L  SR
Sbjct: 400 FSSVLVSVVNKITSTSVDSKGWLGENDLNKDRLDLFYWLLAVLSLLNFLSYLFWSR 455



>gb:AY099800_1576825 Arabidopsis thaliana putative nitrate
           transporter (At2g26690) mRNA, complete cds.
          Length = 577

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 48/188 (25%), Positives = 85/188 (45%), Gaps = 4/188 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR ++P   + +G       + R+  G+ +S         VE  R  L + +  S 
Sbjct: 386 LAVYDRAIMPFWKKWKGKPGFSSLQ-RIAIGLVLSTAGMAAAALVEQKR--LCVAKSSSQ 442

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
             L    +S+  +VPQ+ L+G         Q  FFI++ P+ M T+              
Sbjct: 443 KTL---PISVFLLVPQFFLVGAGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFF 499

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   +  ++  S +  W+  +IN G  DYFYW+L  LS +NF++++IC+  + P+K
Sbjct: 500 VSSFLVSIVKRVTSTSTDVGWLADNINHGRLDYFYWLLVILSGINFVVYIICALWFKPTK 559

Query: 532 DEKPVAME 555
            +  V  E
Sbjct: 560 GKDSVEKE 567



>gb:AB102808_1526339 Nicotiana tabacum NtNRT1.2-t mRNA for nitrate
           transporter, complete cds.
          Length = 594

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 2/174 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           ++ YDR+++P+  R            R+  G+ +S    +     E  R  +A     ++
Sbjct: 399 VIFYDRIIVPICRRFMNKPHGLTPLQRIFTGLVLSILAMIAAALTEVKRLKVAHLHGLTN 458

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           D      +++ W+VPQ+ L+G       + Q  FF+ E P+ M T+              
Sbjct: 459 DANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLALGFF 518

Query: 364 XXXXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +   +      W+  ++N+G    FYW+LA LS+ N + FL  SR Y
Sbjct: 519 FSSILVTIVHVVTGTTNPWLADNLNQGRLYDFYWLLAILSVFNLMFFLYSSRKY 572



>gb:NPL277085_1691079 Nicotiana plumbaginifolia mRNA for putative
           low-affinity nitrate transporter (nrt1.2 gene).
          Length = 594

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 2/174 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           ++ YDR+++P+  R            R+  G+ +S    +     E  R  +A     ++
Sbjct: 399 VIFYDRIIVPICRRFMNKPHGLTPLHRIFTGLVLSILAMIAAALTEVKRLKVAHLHGLTN 458

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           D      +++ W+VPQ+ L+G       + Q  FF+ E P+ M T+              
Sbjct: 459 DANATIPLTVFWLVPQFLLVGAGEAFTYIGQLDFFLRECPKGMKTMSTGLFLSTLALGFF 518

Query: 364 XXXXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +   +      W+  ++N+G    FYW+LA LS+ N + FL  SR Y
Sbjct: 519 VSSILVTIVHVVTGTKNPWLADNLNQGRLYDFYWLLAILSVFNLMFFLYSSRKY 572



>gb:AC130729_1740928 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668F02, complete sequence.
          Length = 598

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 3/175 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +  YDR+L+ V  R  G+        R G G+ ++     +   VES R+S+A       
Sbjct: 391 LAFYDRVLVRVLRRFTGHPNGITHLQRAGVGMTIAMLANAVAAVVESRRKSVAAASGMLD 450

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
              G S  +S+ W+VPQYA+ G+A     V + +F   + P SM +              
Sbjct: 451 APKGSSLPISVFWLVPQYAIHGVADAFMDVGRMEFLYDQAPESMRSTAAALYWLTMSIGS 510

Query: 361 XXXXXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +  +  +    +G W+  ++N    D +YW++ GL  +N + + +C R Y
Sbjct: 511 YLGTLLVTIIHAKTQRSGQWLQDNLNRAKLDSYYWLVFGLQGLNLIYYFVCVRYY 565



>gb:AJ843128_1814513 Plantago major mRNA for putative peptide
           transporter (ptr1 gene).
          Length = 159

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 6/152 (3%)
 Frame = +1

Query: 82  RMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDS--KMSILWVVPQYALMGIAV 255
           R+G G+ +S    V    +E  R+ LA   E+   ++  +   MS LW+ PQY L G+A 
Sbjct: 4   RIGIGLVLSLVSIVYAAIIE--RKRLATAMEYGLVDMPKAVVPMSALWLAPQYVLSGVAD 61

Query: 256 GSNAVAQNQFFISEFPRSMSTIXXXXXXXX----XXXXXXXXXXINELSINSGNGSWITS 423
               +   +FF  + P  + +I                      I  ++   G   W   
Sbjct: 62  VFTMIGLQEFFYDQIPCDLKSIGLAMYLSILGIGSLLSSFLVSFIQNMTKGHGQDGWFAD 121

Query: 424 DINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           ++N+ H DYFYW+LAGLS V    ++  +RSY
Sbjct: 122 NLNKAHLDYFYWLLAGLSTVGLSAYIYFARSY 153



>gb:OSJN00292_1698070 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: P0076O17, complete sequence.
          Length = 621

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 9/178 (5%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           Y+ LL+P+  R  G         R+G G+       V    VE  RR L++    S+   
Sbjct: 419 YELLLVPLMRRATGARSGITPLQRIGVGLCTVPLSMVAAATVEHRRRDLSL----SAGGA 474

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISE-----FPRSMSTIXXXXXXXXXXXX 357
               MS+LW+VPQ+ + G++    AV   +FF  +         ++ +            
Sbjct: 475 PPRAMSVLWIVPQFLVFGVSEMFTAVGLIEFFYKQARGAGMQSFLTALTYCSYAFGFYLS 534

Query: 358 XXXXXXINELSIN---SGNGSWI-TSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                 +N ++ +    G+G W+  +D+++   D FYW+LA LS++NF  +L+C+R Y
Sbjct: 535 SVLVSLVNRVTASRGGGGHGGWLGDNDLDKDRLDLFYWMLAVLSVINFFCYLLCARWY 592



>gb:OSJN00175_1696208 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064D20, complete sequence.
          Length = 611

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 47/178 (26%), Positives = 82/178 (46%), Gaps = 9/178 (5%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           Y+ LL+P+  R  G         R+G G+       V    VE  RR L++    S+   
Sbjct: 409 YELLLVPLMRRATGARSGITPLQRIGVGLCTVPLSMVAAATVEHRRRDLSL----SAGGA 464

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISE-----FPRSMSTIXXXXXXXXXXXX 357
               MS+LW+VPQ+ + G++    AV   +FF  +         ++ +            
Sbjct: 465 PPRAMSVLWIVPQFLVFGVSEMFTAVGLIEFFYKQARGAGMQSFLTALTYCSYAFGFYLS 524

Query: 358 XXXXXXINELSIN---SGNGSWI-TSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                 +N ++ +    G+G W+  +D+++   D FYW+LA LS++NF  +L+C+R Y
Sbjct: 525 SVLVSLVNRVTASRGGGGHGGWLGDNDLDKDRLDLFYWMLAVLSVINFFCYLLCARWY 582



>gb:AC133002_1741235 Oryza sativa chromosome 11 BAC OJ1123_D06
           genomic sequence, complete sequence.
          Length = 486

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 47/190 (24%), Positives = 87/190 (45%), Gaps = 5/190 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +++YDR ++P   R+ G         R+G G FV+   A  +  V   RR +  ++    
Sbjct: 286 LIIYDRAIVPPLRRLTGYVGGVTHLQRIGIG-FVATIVATAIAAVVETRRKMTAEESGLE 344

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           D      +S+ W+ PQ+ L+GI   ++ V   +FF SE    M +I              
Sbjct: 345 DATTGIPLSVFWLTPQFFLIGIVDVTSFVGLLEFFCSEASMGMKSIGSSIFYCILGVSAW 404

Query: 364 XXXXI----NELSINSGNGSWIT-SDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
               +    N ++  +  G W+  +++N+G  D FY VL  + +V  ++++  +R Y   
Sbjct: 405 LGSLLIQVTNRVTQRTNGGGWLDGANLNKGKLDRFYVVLCIIEVVALVIYVFFARRYVYR 464

Query: 529 KDEKPVAMEE 558
            D++ VA E+
Sbjct: 465 NDQRVVAQEQ 474



>gb:AY072134_1567028 Arabidopsis thaliana putative nitrate
           transporter protein (At1g27040) mRNA, complete
           cds.>gb:AY096445_1575989 Arabidopsis thaliana putative
           nitrate transporter (At1g27040) mRNA, complete cds.
          Length = 567

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 41/173 (23%), Positives = 78/173 (45%), Gaps = 4/173 (2%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           YD L++P A ++  + +      R+G G+ +S   A+ V  +  ++R    ++    D+ 
Sbjct: 387 YDHLIIPFARKVTKSEIGITHLQRIGVGLVLSI-VAMAVAALVELKRKQVAREAGLLDSE 445

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXX 372
               ++ LW+  QY  +G A         +FF +E P SM ++                 
Sbjct: 446 ETLPITFLWIALQYLFLGSADLFTLAGLLEFFFTEAPSSMRSLATSLSWASLALGYYLSS 505

Query: 373 X----INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +N ++ ++G   W+   +N    D FYW++  LS+VNFL +L  ++ Y
Sbjct: 506 VMVPIVNRVTKSAGQSPWLGEKLNRNRLDLFYWLMCVLSVVNFLHYLFWAKRY 558



>gb:AB052786_1521245 Glycine max mRNA for putative nitrate
           transporter NRT1-3, complete cds.
          Length = 574

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 47/174 (27%), Positives = 77/174 (44%), Gaps = 5/174 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           IVLYDR  + +  R   N        RMG G+ +     ++    ES R  L + +EH  
Sbjct: 390 IVLYDRFFVKIMQRFTKNPRGITLLQRMGIGLVIHTLIMIIASGTESYR--LKVAREHGV 447

Query: 184 -DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
            ++ G   +SI  ++PQ+ LMG A     VA+ +FF  + P  M +I             
Sbjct: 448 VESGGQVPLSIFILLPQFILMGTADAFLEVAKIEFFYDQSPEHMKSIGTSYSTTTLGLGN 507

Query: 355 --XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICS 510
                    ++ ++  +G+  WI +++NE H DY+Y   A   +    L  +CS
Sbjct: 508 FISSFLLSTVSNITKKNGHKGWILNNLNESHLDYYYAFFAIFKLPQPHLLRVCS 561



>pir|C86397|C86397 protein T7N9.10 [imported] - Arabidopsis
           thaliana>gb:AE005172_891583 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC000348_1530062 Genomic sequence for
           Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 563

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 41/173 (23%), Positives = 78/173 (45%), Gaps = 4/173 (2%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           YD L++P A ++  + +      R+G G+ +S   A+ V  +  ++R    ++    D+ 
Sbjct: 383 YDHLIIPFARKVTKSEIGITHLQRIGVGLVLSI-VAMAVAALVELKRKQVAREAGLLDSE 441

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXX 372
               ++ LW+  QY  +G A         +FF +E P SM ++                 
Sbjct: 442 ETLPITFLWIALQYLFLGSADLFTLAGLLEFFFTEAPSSMRSLATSLSWASLALGYYLSS 501

Query: 373 X----INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +N ++ ++G   W+   +N    D FYW++  LS+VNFL +L  ++ Y
Sbjct: 502 VMVPIVNRVTKSAGQSPWLGEKLNRNRLDLFYWLMCVLSVVNFLHYLFWAKRY 554



>gb:AP004778_1844948 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0459B01.
          Length = 574

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/180 (25%), Positives = 84/180 (46%), Gaps = 7/180 (3%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKS---RMGFGIFVSFWYAVLVGKVESIRRSLAIKQ 171
           W++LY ++++P A R   ++   G  S   RMG G  +      +   VE+ R + A   
Sbjct: 398 WVILYSKVIVP-ALRGFSSSGAAGEPSQLQRMGAGRLLMALAMAVAALVETKRLNAAASG 456

Query: 172 EHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXX 339
           E          ++I W +PQY  +  A     +AQ +FF  E P +M    +++      
Sbjct: 457 E---------AINIAWQMPQYFFLAGAEVFCYIAQLEFFFGEAPDTMKSTCTSLALLTIA 507

Query: 340 XXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                       +   +  +G   WI+ D+N+GH DYF+W+LA +  +NF+++   +++Y
Sbjct: 508 LGSYLSSLIYAVVEAFTATAGGHGWISDDLNQGHLDYFFWMLAAMCTLNFVVYSGFAKNY 567



>pir|H96720|H96720 probable peptide transporter T17F3.11 [imported]
           - Arabidopsis thaliana>gb:AE005173_894570 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537004 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 555

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/176 (27%), Positives = 75/176 (42%), Gaps = 3/176 (1%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+  Y+ +L+     I           ++G G   S    ++ G VE  RR L+      
Sbjct: 380 WLPFYETVLVRHIENITKQNGGISLLQKVGIGNIFSISTMLISGIVERKRRDLS------ 433

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
              L   KMS+ W+ PQ  LMG       V   +FF  + P +M +I             
Sbjct: 434 ---LNGVKMSVFWLTPQQVLMGFYQVFTIVGLTEFFNKQVPINMRSIGNSLLYLGLSLAS 490

Query: 361 XXXXXINEL--SINSGNG-SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                +  +  S+ +  G SW+T DI++   D FY+ +A LS +NF+ F  C+R Y
Sbjct: 491 YLSSAMVSIVHSVTARGGQSWLTDDIDKSKLDCFYYFIAALSTLNFIFFFWCARRY 546



>gb:AE016959_1023773 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC037426_1540041
           Oryza sativa chromosome 10 BAC OSJNBb0014I11 genomic
           sequence, complete sequence.>gb:AE017118_1753592 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           72 of 77 of the complete sequence.
          Length = 594

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 43/177 (24%), Positives = 78/177 (44%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +  YDRL++PVA R   N        R+  G+ +S     +   VE  R +       +S
Sbjct: 401 VPFYDRLVVPVARRATANPHGLTPLQRVFVGLSLSIAGMAVAAAVERHRAT-------AS 453

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
            +   +  ++  ++PQ+ L+G       + Q  FF+ E P+ M T+              
Sbjct: 454 ASAAAAAPTVFLLMPQFLLVGAGEAFTYMGQLDFFLRECPKGMKTMSTGLFLSTCAIGFF 513

Query: 364 XXXXINEL-----SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               +  +        +  G W+  ++++G  DYFYW+LA +S +N +LF + +R Y
Sbjct: 514 FSTLLVTIVHKVTGHGARGGGWLADNLDDGRLDYFYWLLAVISAINLVLFTVAARGY 570



>gb:AC144739_1744180 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0049D13, complete sequence.
          Length = 282

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 49/182 (26%), Positives = 84/182 (46%), Gaps = 5/182 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I +YDR+L+P+A R  G         R+G G  +    AV    +  +RR  AI+   ++
Sbjct: 55  IPVYDRVLVPLARRRTGEPRGITLLQRLGVGSALQV-AAVACACLVELRRMRAIRAASAT 113

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXXX 351
                  MSI W++PQY L+G+    ++V   +FF  + P+ M    +T           
Sbjct: 114 AAHDTVPMSIFWMLPQYILIGVGDVFSSVGILEFFYEQSPQGMQSLGTTFFTSGLGVGNF 173

Query: 352 XXXXXXXXINELSINSGNG-SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                   ++  +   G G SWI  ++N+ H DY+Y  L  L+++N  +F+  +  Y   
Sbjct: 174 LNSLLVTAVDRATRGGGAGKSWIGDNLNDSHLDYYYAFLLLLAVINLAVFVWVATRYEYK 233

Query: 529 KD 534
           K+
Sbjct: 234 KE 235



>gb:OSJN00149_1695685 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0060P14, complete sequence.
          Length = 592

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 46/165 (27%), Positives = 74/165 (44%), Gaps = 2/165 (1%)
 Frame = +1

Query: 16  DRLLLPVASRIRGNTVHXGTKS--RMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +RLL+P+A R+       G  S  R+G G+ ++     +   VE  RR  +      +  
Sbjct: 395 ERLLVPLARRLMITRRPQGLTSLQRVGAGLVLATLAMAVSALVEKKRRDAS----GGAGG 450

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
            G + +S  W+VPQ+ L+G       V Q +FFI E P  M ++                
Sbjct: 451 GGVAMISAFWLVPQFFLVGAGEAFAYVGQLEFFIREAPERMKSMSTGLFLATLAMGFFLS 510

Query: 370 XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLI 504
             +      +  G+WI   +++G  D FYW+LA L + NF  FL+
Sbjct: 511 SLLVSAVDAATRGAWIRDGLDDGRLDLFYWMLAALGVANFAAFLV 555



>gb:AP004994_1846927 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846964 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 535

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 46/178 (25%), Positives = 81/178 (45%), Gaps = 8/178 (4%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           LYD +++P+A  + G+        R+G G+ +S     +   VE+ R    ++   SS +
Sbjct: 364 LYDTVVVPLAGLVAGHGKGITVLQRIGVGMVLSIVAMAVAALVEARR----LRAAASSSS 419

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXX----XXXXX 357
            G  ++SI W++PQY L+G++     V   +FF ++ P +M T+                
Sbjct: 420 GG--RLSIFWLLPQYVLLGVSDVFTVVGMQEFFYTQVPSAMRTVGIALYLSVFGVGSFVG 477

Query: 358 XXXXXXINELSINSGNG----SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                 +  ++   G G     W + D  E   D +YW LA LS V+F++F    + Y
Sbjct: 478 AFLITALEMVTAGGGGGGHDHGWFSDDPREARLDKYYWFLALLSCVSFVVFTHLCKYY 535



>gb:AP004994_1846925 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846962 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 521

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 49/178 (27%), Positives = 80/178 (44%), Gaps = 8/178 (4%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           LYDR+++P+    +G TV      R+G G+ +S   A+ V  +   RR  A     S   
Sbjct: 354 LYDRVVVPLTGHGKGITV----LQRIGVGMVLSI-VAMAVAALVEARRPRAAASSSSG-- 406

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
               ++SI W++PQY L+G++     V   +FF ++ P +M T+                
Sbjct: 407 ---GRLSIFWLLPQYVLLGVSDVFTVVGMQEFFYTQVPSAMRTVGIALYLSVFGVGSFVG 463

Query: 370 XXI---NELSINSGNG-----SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             +    E++   G G      W + D  E   D +YW LA LS V+F++F    + Y
Sbjct: 464 AFLITALEMATAGGGGGGHDHGWFSDDPREARLDKYYWFLALLSCVSFVVFTHLCKYY 521



>gb:AF420016_1798605 Narcissus pseudonarcissus putative low-affinity
           nitrate transporter mRNA, partial cds.
          Length = 123

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 4/109 (3%)
 Frame = +1

Query: 205 MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX----XXXXXX 372
           MS+ W+VPQ+ L+G       + Q  FF+ E P+ M T+                     
Sbjct: 3   MSVFWLVPQFFLVGAGEAFCYIGQLDFFLRECPKGMKTMSTGMFLSTLSLGFFLSSALVT 62

Query: 373 XINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
            +++++  SG G+W+  D+N G    FYW+LA LS VN + FL+ +R Y
Sbjct: 63  IVHKVTGESGQGAWLPDDLNRGKLYDFYWLLAVLSAVNLVAFLVSARWY 111



>gb:AC133002_1741241 Oryza sativa chromosome 11 BAC OJ1123_D06
           genomic sequence, complete sequence.
          Length = 660

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 50/195 (25%), Positives = 87/195 (44%), Gaps = 10/195 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           ++LYDR+++P   R+ G         R+G G F++   A  V  V  IRR  A  +   +
Sbjct: 343 LILYDRVIVPPLRRLTGYVGGVTHLQRIGVG-FIATIMATAVAAVVEIRRKSAADESSLA 401

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
           D      +S+ W+ PQ+ L+GI   ++ V   +FF SE    M +I              
Sbjct: 402 DGTAGIPLSVFWLTPQFFLIGIFDVTSFVGLLEFFCSEVSMGMKSIGSSIFYCILGVSAW 461

Query: 364 XXXXINELSI---------NSGNGSWIT-SDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
               + +++          N G+G W+  +++N G  + FY VL  + +V  L ++  +R
Sbjct: 462 LGSLLIQVTNRVTRRGGKGNGGSGGWLDGANLNNGKLERFYVVLCIIEVVALLSYVFFAR 521

Query: 514 SYGPSKDEKPVAMEE 558
            Y    ++K V   E
Sbjct: 522 RYVYRNEQKVVHTRE 536



>gb:AE016959_1023998 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC018727_1538379
           Oryza sativa chromosome 10 BAC OSJNBa0056G17 genomic
           sequence, complete sequence.>gb:AE017123_1753817 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           77 of 77 of the complete sequence.
          Length = 571

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 51/189 (26%), Positives = 85/189 (44%), Gaps = 8/189 (4%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFG---IFVSFWYAVLVGKVESIRRSLAIKQ 171
           W++L+D +++PVA R    +       RMG G   + V+   A LV +    RR    K+
Sbjct: 392 WVLLHDVVVMPVARRW-WRSGGLTQLQRMGVGRVLVVVAMATAALVER----RRLRGEKR 446

Query: 172 EHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXX 351
                      MSILW VPQ+ ++  +   + +AQ +FF  E P SM +I          
Sbjct: 447 S----------MSILWQVPQFVVLAGSDVFSGIAQLEFFYGEAPGSMRSICSAFSFLALS 496

Query: 352 XXXXXXXXINELSI-----NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRS 516
                   +  +       + G+G W+  D++  H DY++W+ A +S+ N  L+L+ +  
Sbjct: 497 LGFYVNSLVVTIVAAVTKRSDGSGGWLAPDLDTAHLDYYFWLWALISLANLALYLLLAAR 556

Query: 517 YGPSKDEKP 543
           Y   K   P
Sbjct: 557 YKSKKPSPP 565



>gb:AE016959_1020935 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091665_1734851
           Oryza sativa chromosome 10 clone OSJNBb0016M10, complete
           sequence.>gb:AE017056_1750754 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 10 of 77 of the
           complete sequence.
          Length = 553

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 44/184 (23%), Positives = 77/184 (41%), Gaps = 6/184 (3%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YDR+++P+A R+ G         R+G G+        +   VE+ R  +A      +  
Sbjct: 370 VYDRMVVPLARRLTGGGGGITMLQRIGAGMATGCLAMAVAALVEARRLRVARDAGLVNRP 429

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
                M + W+VPQ+ L+G+A     +   +FF  +    + ++                
Sbjct: 430 GATVPMGVWWLVPQHVLIGVAEVLAVIGLEEFFYDQVAGELHSVGLAVSQGVMGVGSYAS 489

Query: 370 XXINEL-----SINSGNG-SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
             +        +  SG G SW   D+N  H DYFYW+LA L+ +   +F+  ++ Y    
Sbjct: 490 GALVAAIDWATAARSGGGESWFADDLNRAHLDYFYWLLAALAALEVAVFVYLAQRYDYKN 549

Query: 532 DEKP 543
             KP
Sbjct: 550 KSKP 553



>gb:AE016959_1023035 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC026815_1539702
           Oryza sativa chromosome 10 BAC OSJNBa0079L16 genomic
           sequence, complete sequence.>gb:AE017103_1752854 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           57 of 77 of the complete sequence.
          Length = 607

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 50/177 (28%), Positives = 76/177 (42%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           IVLYDR L+P   R   N        R+  G+ +     V+   VES R   A +    +
Sbjct: 396 IVLYDRFLVPAVRRRTKNPRGITLLQRISLGMLLQIVTMVVTSVVESQRLGYARRHGLVA 455

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
              G   ++I  ++PQ+ L+G+A     V Q +FF  + P SM ++              
Sbjct: 456 TG-GQLPVTIFILLPQFVLLGVADAFLVVGQIEFFYDQAPESMKSLGTAMSLTAYGAGNL 514

Query: 364 XXXXIN---ELSINSGNGS--WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
               I    E     G G   W+T+++N    DY+Y  LA L+  N L F++ S  Y
Sbjct: 515 LSSAILAAVERVTGGGKGRTPWVTNNLNASRLDYYYAFLATLAAANLLAFVVLSCKY 571



>gb:AE016959_1020662 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079685_1732730
           Oryza sativa chromosome 10 clone OSJNBb0012A20, complete
           sequence.>gb:AC098694_1736851 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OJ1014H12, complete
           sequence.>gb:AE017049_1750481 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 3 of 77 of the
           complete sequence.
          Length = 556

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 46/175 (26%), Positives = 70/175 (40%), Gaps = 6/175 (3%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           YD  L+P+A R+ G+        R+G G+ +S         +E+ RR  A          
Sbjct: 389 YDAALMPLARRVTGDRRGLSQLQRLGVGLALSALAMAYSALLEASRRRRAAT-------- 440

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXX 372
                SI+W  P Y  +G A    +V   +FF  + P ++ ++                 
Sbjct: 441 -----SIVWQAPSYMALGAAEVFTSVGLLEFFYDQAPDTIKSLCTAVSLVAVAAGSYLNS 495

Query: 373 XINELSI------NSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
            I  +          G G WI  D+N G  D F+W++ GLS VN L F+  S  Y
Sbjct: 496 AIVAVVAWATAPEKGGGGGWIPDDLNRGRLDCFFWLMFGLSCVNLLAFVYSSTRY 550



>pir|E84798|E84798 probable peptide/amino acid transporter
           [imported] - Arabidopsis thaliana>gb:AC007661_1536102
           Arabidopsis thaliana chromosome II section 205 of 255 of
           the complete sequence. Sequence from clones F13M22,
           T8P21, F16M14.
          Length = 575

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 46/184 (25%), Positives = 78/184 (42%), Gaps = 4/184 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y++LL+P+   I  N        R+G G+  S    ++   VE        KQ    
Sbjct: 397 LTVYEKLLVPLLRSITRNQRGINILQRIGTGMIFSLITMIIAALVE--------KQRLDR 448

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
            N  +  MS++W+ PQ+ ++G A     V   ++F  + P SM ++              
Sbjct: 449 TN-NNKPMSVIWLAPQFMVIGFADAFTLVGLQEYFYHQVPDSMRSLGIAFYLSVIGAASF 507

Query: 364 XX----XXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   ++ L+ N    SW   D+N    D FYW LAG+   N  +F+I ++   P K
Sbjct: 508 LNNLLITAVDTLAENFSGKSWFGKDLNSSRLDRFYWFLAGVIAANICVFVIVAKRC-PYK 566

Query: 532 DEKP 543
             +P
Sbjct: 567 SVQP 570



>gb:AP004669_1843007 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0491F11.
          Length = 662

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 3/173 (1%)
 Frame = +1

Query: 10   LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
            +YDR L+P+A R+  +     T  R+G G+ +S     +   VE+ R   A         
Sbjct: 482  VYDRALVPLARRLTRHLAGITTLQRVGAGMAMSGLAMAVAALVEAKRLRAASDAGLVDRP 541

Query: 190  LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
                  S+ W+VPQ+ L+G +     +   +FF  + P  + ++                
Sbjct: 542  DATVPTSVWWLVPQFVLLGTSKVFGLIGLEEFFYDQVPVELCSVGLAVSLSVLGVGSYAS 601

Query: 370  XXINELS--INSGNG-SWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
              +      +  G G SW + ++N  H DYFYW+LA L+ +   +F+  ++ Y
Sbjct: 602  GVLVSAIDWVTRGEGESWFSDNLNRAHLDYFYWILATLAALEVAIFVYIAKRY 654



>gb:AF213936_1777806 Prunus dulcis amino acid/peptide transporter
           (PTR2) mRNA, complete cds.
          Length = 559

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 41/155 (26%), Positives = 64/155 (41%), Gaps = 4/155 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YDR ++P+A +  G         RMG G+F+S         VE  R  LA +    
Sbjct: 403 WVPIYDRFIVPIARKFTGKERGFSELQRMGIGLFLSVLCMSAAAVVEMKRLQLATELGLV 462

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXX 348
              +    +SI W +PQY L+G A     + Q +FF  +   +M    S +         
Sbjct: 463 DKEVA-VPLSIFWQIPQYFLLGAAEIFTFIGQLEFFYDQSSDAMRSLCSALSASDDFIGK 521

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYF 453
                    +   +   G   WI  ++N+GH DYF
Sbjct: 522 LSELFDSDIVTYFTTQGGKAGWIPDNLNDGHLDYF 556



>gb:AP004669_1843010 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0491F11.
          Length = 542

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 47/178 (26%), Positives = 80/178 (44%), Gaps = 5/178 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YDR+ +PVA R   N     T  R+G G+ +S    ++   VE   R L I ++  
Sbjct: 357 FLPIYDRIFIPVARRYTKNPSGITTLQRIGVGLVLSIITMIVAAMVEM--RRLRIARDFG 414

Query: 181 SDNLGDS--KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX 354
             +  ++   MS LW+VPQ  L  I+     +   +FF  E P S+ +            
Sbjct: 415 LVDKPEAVVPMSFLWIVPQNILAAISDMFAVIGLQEFFYGEAPESLRSFSMALFLSIIGV 474

Query: 355 XXXXXXXIN---ELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  I    +   +S   SW +++ N GH DYFY ++  L+ ++   FL  ++ Y
Sbjct: 475 GNFISSFIVYAIDRVTSSFGDSWFSNNPNRGHVDYFYLLITVLNALSLACFLYFAKMY 532



>gb:AP003566_1830929 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 574

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 47/178 (26%), Positives = 80/178 (44%), Gaps = 5/178 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           ++ +YDR+ +PVA R   N     T  R+G G+ +S    ++   VE   R L I ++  
Sbjct: 389 FLPIYDRIFIPVARRYTKNPSGITTLQRIGVGLVLSIITMIVAAMVEM--RRLRIARDFG 446

Query: 181 SDNLGDS--KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX 354
             +  ++   MS LW+VPQ  L  I+     +   +FF  E P S+ +            
Sbjct: 447 LVDKPEAVVPMSFLWIVPQNILAAISDMFAVIGLQEFFYGEAPESLRSFSMALFLSIIGV 506

Query: 355 XXXXXXXIN---ELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  I    +   +S   SW +++ N GH DYFY ++  L+ ++   FL  ++ Y
Sbjct: 507 GNFISSFIVYAIDRVTSSFGDSWFSNNPNRGHVDYFYLLITVLNALSLACFLYFAKMY 564



>gb:AC093018_1735829 Oryza sativa chromosome 3 BAC OSJNBb0081B07
           genomic sequence, complete sequence.
          Length = 585

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 42/177 (23%), Positives = 74/177 (41%), Gaps = 5/177 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YD++L P   R+ G         R+G GI  +     +   VE  R   A       
Sbjct: 389 VAVYDKVLEPYLRRLTGGERGLSILKRIGVGIAFTIVAMAVAATVERQRLRSA------- 441

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST----IXXXXXXXXXX 351
                + MS+ W+VPQ+ LMGI  G   V   ++F  + P SM +    +          
Sbjct: 442 ---SPASMSVFWLVPQFLLMGIGDGFALVGLQEYFYDQVPDSMRSLGIGLYLSVIGAGSF 498

Query: 352 XXXXXXXXINELSINSGNGS-WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                   ++ ++ + G  + W   D+N    D FYW+LA + + N + +++ +  Y
Sbjct: 499 LSSQLITAVDRVTSHGGAAAGWFGKDLNSSRLDLFYWLLACIGVANLVFYVVIATRY 555



>gb:BT000720_1634993 Arabidopsis thaliana clone RAFL09-73-M24
           (R19648) putative nitrate transporter (NTL1) (At1g69850)
           mRNA, complete cds.
          Length = 585

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 46/175 (26%), Positives = 74/175 (42%), Gaps = 5/175 (2%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YD L++P A +            R+G G+ +S   A+ V  +  I+R    K     D+
Sbjct: 403 IYDHLIIPFARKATKTETGVTHLQRIGVGLVLSI-LAMAVAALVEIKRKGVAKDSGLLDS 461

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
                ++ LW+  QY  +G A         ++F +E P SM ++                
Sbjct: 462 KETLPVTFLWIALQYLFLGSADLFTLAGLLEYFFTEAPSSMRSLATSLSWASLAMGYYLS 521

Query: 370 XXI----NELSINSGNGSWITS-DINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             I    N ++ +SGN  W+    IN    DYFYW++  LS  NFL +L  +  Y
Sbjct: 522 SVIVSIVNSITGSSGNTPWLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 576



>gb:AY062453_1565109 Arabidopsis thaliana nitrate transporter (NTL1)
           (At1g69850; T17F3.12) mRNA, complete
           cds.>gb:BT002561_1636164 Arabidopsis thaliana nitrate
           transporter (NTL1) (At1g69850) mRNA, complete cds.
          Length = 585

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 46/175 (26%), Positives = 74/175 (42%), Gaps = 5/175 (2%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YD L++P A +            R+G G+ +S   A+ V  +  I+R    K     D+
Sbjct: 403 IYDHLIIPFARKATKTETGVTHLQRIGVGLVLSI-LAMAVAALVEIKRKGVAKDSGLLDS 461

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
                ++ LW+  QY  +G A         ++F +E P SM ++                
Sbjct: 462 KETLPVTFLWIALQYLFLGSADLFTLAGLLEYFFTEAPSSMRSLATSLSWASLAMGYYLS 521

Query: 370 XXI----NELSINSGNGSWITS-DINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             I    N ++ +SGN  W+    IN    DYFYW++  LS  NFL +L  +  Y
Sbjct: 522 SVIVSIVNSITGSSGNTPWLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 576



>pir|G96720|G96720 nitrate transporter (NTL1), 53025-56402
           [imported] - Arabidopsis thaliana>gb:AE005173_894569
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010675_1537005 Arabidopsis thaliana
           chromosome 1 BAC T17F3 genomic sequence, complete
           sequence.
          Length = 600

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 46/175 (26%), Positives = 74/175 (42%), Gaps = 5/175 (2%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YD L++P A +            R+G G+ +S   A+ V  +  I+R    K     D+
Sbjct: 418 IYDHLIIPFARKATKTETGVTHLQRIGVGLVLSI-LAMAVAALVEIKRKGVAKDSGLLDS 476

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
                ++ LW+  QY  +G A         ++F +E P SM ++                
Sbjct: 477 KETLPVTFLWIALQYLFLGSADLFTLAGLLEYFFTEAPSSMRSLATSLSWASLAMGYYLS 536

Query: 370 XXI----NELSINSGNGSWITS-DINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             I    N ++ +SGN  W+    IN    DYFYW++  LS  NFL +L  +  Y
Sbjct: 537 SVIVSIVNSITGSSGNTPWLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 591



>gb:OSJN00261_1697580 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 557

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 44/191 (23%), Positives = 82/191 (42%), Gaps = 5/191 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR L+P   +  G         R+G G       + +   VE  R+  A++     
Sbjct: 375 LAVYDRFLVPFMRKRTGYACGITHLQRVGLGFASMIVASAVAAVVERKRKEAAVQ----- 429

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXXX 351
                  MS+ W+ PQ+ L+G++  ++ V   +FF SE P+ M +I              
Sbjct: 430 -------MSLFWLAPQFFLLGVSDVTSFVGLLEFFNSEAPKDMKSIGTALFWCELGLASW 482

Query: 352 XXXXXXXXINELSINSGNGSWIT-SDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                   +N+ + +  +  W+  + +N  H D FYWV+A + ++ FL +L  ++ Y   
Sbjct: 483 MGTFLVELVNKATRHGHHRGWLEGTSLNNSHLDLFYWVVAVIGLLGFLNYLYWAKKYAYR 542

Query: 529 KDEKPVAMEED 561
            + + V    D
Sbjct: 543 HNPRMVTPSAD 553



>pir|T51361|T51361 nitrate transporter NTL1 [validated] -
           Arabidopsis thaliana>gb:AF073361_1765921 Arabidopsis
           thaliana nitrate transporter NTL1 (NRT1:2) mRNA,
           complete cds.
          Length = 585

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 46/175 (26%), Positives = 74/175 (42%), Gaps = 5/175 (2%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YD L++P A +            R+G G+ +S   A+ V  +  I+R    K     D+
Sbjct: 403 IYDHLIIPFARKATKTETGVTHLQRIGVGLVLSI-LAMAVAALVEIKRKGVAKDSGLLDS 461

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
                ++ LW+  QY  +G A         ++F +E P SM ++                
Sbjct: 462 KETLPVTFLWIGLQYLFLGSADLFTLAGLLEYFFTEAPSSMRSLATSLSWASLAMGYYLS 521

Query: 370 XXI----NELSINSGNGSWITS-DINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             I    N ++ +SGN  W+    IN    DYFYW++  LS  NFL +L  +  Y
Sbjct: 522 SVIVSIVNSITGSSGNTPWLRGKSINRYKLDYFYWLMCVLSAANFLHYLFWAMRY 576



>gb:AP003372_1828661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OJ1014_G12.>gb:AP003443_1829452 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1144D11.
          Length = 587

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 39/170 (22%), Positives = 77/170 (45%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +YDR+ +P+   + G       + ++G G+ +S          E  R ++A+    ++
Sbjct: 399 LAVYDRVFIPLCRVLTGKQGFTNLE-KIGIGLALSILGMAAAALCEKKRLAVAV----AA 453

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXX 363
                + +S+  + PQ+ L+G         Q  FFI+  P+ M T+              
Sbjct: 454 TTGNSTPISVFLLTPQFLLVGAGEAFIYTGQLDFFITRSPKGMKTMSTGLFLTTLSLGFF 513

Query: 364 XXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
               +  +S+  G  +W+   I+    DYFYW+LA LS++N   +L+C++
Sbjct: 514 FSSVL--VSLVKGATTWLGDTIDRSRLDYFYWLLAVLSVLNLAAYLVCAK 561



>gb:AB052787_1521246 Glycine max mRNA for putative nitrate
           transporter NRT1-4, partial cds.
          Length = 228

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 39/110 (35%), Positives = 58/110 (52%), Gaps = 3/110 (2%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKS---RMGFGIFVSFWYAVLVGKVESIRRSLAIKQ 171
           W+  YDR+L+P   ++R  T H G  +   R+G G+  S    V+ G VE +RR  A   
Sbjct: 95  WLPFYDRILVP---KLRKMTKHEGGITLLLRIGIGMVFSILSMVVAGYVEKVRRDSA--- 148

Query: 172 EHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTI 321
             +   LG + MS+LW+ P   LMG+    N + Q +FF  +FP  M +I
Sbjct: 149 NSNPTPLGIAPMSVLWLAPHLILMGLCEAFNIIGQIEFFNRQFPEHMRSI 198



>gb:AGL488290_1811026 Alnus glutinosa mRNA for dicarboxylate
           transporter (ptr1 gene).
          Length = 583

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 44/182 (24%), Positives = 74/182 (40%), Gaps = 4/182 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +++YDRLL P   +            ++G  IF+S          E  R  +      S+
Sbjct: 390 LIMYDRLL-PFLRQSSNGVQGFTNLQKIGIAIFLSILGMAAASFAEMKRLEVVRANRGST 448

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
                  ++  +++PQ+ L+GI  G     Q  FFI+E P+ M  I              
Sbjct: 449 STSSTLPITAFYLLPQFVLVGIGDGFMYTGQLDFFITESPKGMKAISTGLFLTTNALGFF 508

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   I +++       W+ S IN+   D+FY +LA L  +N + +L+ +  Y PS 
Sbjct: 509 GSSILVTIITKVTGEEVGHGWLLSRINDSRLDFFYALLAVLGFINLVFYLVLASWYKPSP 568

Query: 532 DE 537
            E
Sbjct: 569 VE 570



>gb:CAR489612_1645347 Cicer arietinum partial mRNA for nitrate
           transporter (ntp gene).
          Length = 201

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 42/187 (22%), Positives = 83/187 (44%), Gaps = 4/187 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + + DR+++P+  +++G       + R+  G+ +S +        E  R S+A   +   
Sbjct: 6   LAVNDRIIMPLWKKMKGKPGFTNLQ-RIAIGLLLSTFGMAAASLCEVKRLSVA---KSVK 61

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX--- 354
            N     +S+  ++PQ+ L+G         Q  FFI++ P+ M T+              
Sbjct: 62  GNQATIPISVFLLIPQFFLVGSGEAFIYTGQLDFFITQSPKGMKTMSTGLFLTTLSLGFF 121

Query: 355 -XXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSK 531
                   + +++       W+  +IN+G  D F+ +L  LS +NF+ FL+C+  Y P K
Sbjct: 122 ISSFLVSVVKKVTGTRDGQGWLADNINKGRLDLFFALLTILSFINFVAFLVCAFWYKPKK 181

Query: 532 DEKPVAM 552
            +  + M
Sbjct: 182 AKPSMQM 188



>gb:AP003630_1831755 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0566A10.
          Length = 590

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/175 (24%), Positives = 71/175 (40%), Gaps = 5/175 (2%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YD +++P A R  G  +      R+G G+ +S   A+ V  V  ++R          D 
Sbjct: 407 VYDHIIIPFARRATGTEMGITHLQRIGTGLVLSI-VAMAVAAVVEVKRKNVASNAGMLDA 465

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX----X 357
                ++  W+  QY  +G A         +FF SE P  M ++                
Sbjct: 466 AAPLPITFFWIAFQYLFLGSADLFTLAGLLEFFFSEAPARMRSLATSLSWASLALGYYLS 525

Query: 358 XXXXXXINELSINSGNGSWITSD-INEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                 +N  +   G  +W+  + +N  H + FYWV+  LS +N+L FL  +  Y
Sbjct: 526 SVLVTVVNSATGRGGRRAWLQGENLNHYHLERFYWVMCVLSTLNYLFFLFWAIRY 580



>gb:AP003076_1824650 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0481E12.
          Length = 595

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 47/182 (25%), Positives = 84/182 (46%), Gaps = 10/182 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + +Y+R  +P A RI G+        R+G G+ +S     +   VE  R+ +A +     
Sbjct: 399 VPIYERGFVPFARRITGHPNGIPHLQRVGVGLVLSIVSMAIAAVVEVRRKRVAARHGMLD 458

Query: 184 DN--LGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX 354
            N  LG    +S  W+ PQ+ + G+A     +   +FF S+ P ++ ++           
Sbjct: 459 ANPILGKQLPISCFWLAPQFTVFGVADMFTFIGLLEFFYSQAPPALKSMSSSFLWCPMSL 518

Query: 355 XXXXXXXINELSINSG------NGSWIT-SDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                  I + ++N+       +G W+  ++IN  H D F+W+LA LS +NFL +L  + 
Sbjct: 519 GYFLSTIIVK-AVNAATRGATASGGWLAGNNINRNHLDLFFWLLAVLSFLNFLNYLFWAS 577

Query: 514 SY 519
            Y
Sbjct: 578 WY 579



>gb:AP004750_1844346 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0421H01.
          Length = 606

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/174 (25%), Positives = 74/174 (42%), Gaps = 8/174 (4%)
 Frame = +1

Query: 22  LLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDS 201
           +L+P A+R+  N    G   RMG G+ ++    V    VE  RR  +          G  
Sbjct: 419 VLVPAAARLTKNPRGVGELKRMGAGLVIALLGMVAAAVVEVHRRRRS--------GAGGR 470

Query: 202 KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXI- 378
            MS+LW  PQYA+MG +     V Q +FF  + P  + ++                  + 
Sbjct: 471 AMSVLWQAPQYAVMGASEVFVYVGQLEFFNVQSPEGVKSLGSSLCMASISLGNYASMVMV 530

Query: 379 -------NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                  +      G   WI ++++ GH D  +  LA LS V+ ++F++ +R +
Sbjct: 531 SAISGVASRRRTGGGTAGWILAELDRGHLDRSFITLAVLSAVDLVVFIVFARLF 584



>gb:AC149302_1745016 Solanum demissum chromosome 11 clone PGEC400L14
           map MAP_LOC, complete sequence.
          Length = 567

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 46/173 (26%), Positives = 72/173 (41%), Gaps = 1/173 (0%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I + DR L P  ++    T       R+G G  ++     +   VES R  +    +   
Sbjct: 385 IFIIDRFLYPFLAKY--TTFSLTPLQRIGIGHVITIISMAVSALVESRRLRIVRTHKLQG 442

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-STIXXXXXXXXXXXXX 360
            N     MS+ W+VPQ AL GI  G +      F+  EFP S+ ST              
Sbjct: 443 QNNDIVPMSVFWLVPQLALNGIGEGFHFPGHIAFYYQEFPTSLKSTSTAMVALFIGIAHY 502

Query: 361 XXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                I+ +   SG   W+  +IN+G  D  +W+   L   NF+ +++C+  Y
Sbjct: 503 LGNTLIDLVQRLSG---WLPDNINKGRTDNVFWLCCILGSANFMYYVVCASLY 552



>gb:AP003566_1830927 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBb0008G24.
          Length = 678

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 40/159 (25%), Positives = 68/159 (42%), Gaps = 3/159 (1%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YDR L+P+A R+  +     T  R+G G+ +S     +   VE+ R   A         
Sbjct: 485 VYDRALVPLARRLTRHLAGITTLQRVGAGMAMSGLAMAVAALVEAKRLRAASDAGLVDRP 544

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
                 S+ W+VPQ+ L+G +     +   +FF  + P  + ++                
Sbjct: 545 DATVPTSVWWLVPQFVLLGTSKVFGLIGLEEFFYDQVPVELCSVGLAVSLSVLGVGSYAS 604

Query: 370 XXINELS--INSGNG-SWITSDINEGHYDYFYWVLAGLS 477
             +      +  G G SW + ++N  H DYFYW+LA L+
Sbjct: 605 GVLVSAIDWVTRGEGESWFSDNLNRAHLDYFYWILATLA 643



>gb:AC149302_1745015 Solanum demissum chromosome 11 clone PGEC400L14
           map MAP_LOC, complete sequence.
          Length = 543

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 46/173 (26%), Positives = 72/173 (41%), Gaps = 1/173 (0%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I + DR L P  ++    T       R+G G  ++     +   VES R  +    +   
Sbjct: 361 IFIIDRFLYPFLAK--HTTFSLTPLQRIGIGHVITIISMAVSALVESRRLRIVRTHKLQG 418

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-STIXXXXXXXXXXXXX 360
            N     MS+ W+VPQ AL GI  G +      F+  EFP S+ ST              
Sbjct: 419 QNNDIVPMSVFWLVPQLALNGIGEGFHFPGHIAFYYQEFPTSLKSTSTAMVALFIGIAYY 478

Query: 361 XXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                I+ +   SG   W+  +IN+G  D  +W+   L   NF+ +++C+  Y
Sbjct: 479 LGNTLIDLVQRLSG---WLPDNINKGRTDNVFWLCCILGSANFMYYVVCASLY 528



>gb:AC149302_1745014 Solanum demissum chromosome 11 clone PGEC400L14
           map MAP_LOC, complete sequence.
          Length = 375

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 44/174 (25%), Positives = 72/174 (41%), Gaps = 2/174 (1%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I + DR+L P  ++    T       R+G G  ++     +   VES  R L + + H  
Sbjct: 193 ISIIDRILNPFLAKY--TTFSLTPLQRVGIGHALTISCMAVSALVES--RRLRVARSHHL 248

Query: 184 DNLGDS--KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXX 357
               D+   MS+ W++PQ AL GI  G +      F+  EFP S+               
Sbjct: 249 QGQKDAIVPMSVFWLLPQLALNGIGEGFHFPGHIAFYYQEFPTSLKNTSTAMVSLFIGIA 308

Query: 358 XXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                 +  + +      W+  +IN+G  D  +W+   L  VNF+ FL+ +  Y
Sbjct: 309 FYLGNVL--IDVVQRETGWLPDNINDGRMDNVFWLCCTLGSVNFIYFLLVASFY 360



>gb:BNU17987_1633659 Brassica napus RCH2 protein mRNA, complete cds.
          Length = 589

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 2/172 (1%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YDRL +P+  ++           R+G G+ ++     +   VE  R   A     +   
Sbjct: 397 VYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTAHAHGPTVKT 456

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
           L    +    ++PQY ++GI        Q  FF+ E P+ M T+                
Sbjct: 457 L---PLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFS 513

Query: 370 XXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             +  +   +      WI  D+N+G    FYW++A +  +NFL+FL+ S+ Y
Sbjct: 514 SVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWY 565



>gb:BNA278966_1633311 Brassica napus mRNA for nitrate transporter
           (nrt1 gene).
          Length = 588

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 41/172 (23%), Positives = 72/172 (41%), Gaps = 2/172 (1%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YDRL +P+  ++           R+G G+ ++     +   VE  R   A     +   
Sbjct: 396 VYDRLAIPLCKKLFNYPHGLRPLQRIGLGLLLAAMGMAVAALVEIKRLRTAHAHGPTVKT 455

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
           L    +    ++PQY ++GI        Q  FF+ E P+ M T+                
Sbjct: 456 L---PLGFSLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKTMSTGLLLSTLALGFFFS 512

Query: 370 XXINEL--SINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             +  +   +      WI  D+N+G    FYW++A +  +NFL+FL+ S+ Y
Sbjct: 513 SVLVTIVEKVTDKAHPWIADDLNKGRLYNFYWLVAVIVALNFLVFLVFSKWY 564



>pir|T47505|T47505 hypothetical protein F9K21.230 - Arabidopsis
           thaliana>gb:ATF9K21_1551423 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F9K21.
          Length = 558

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 42/173 (24%), Positives = 73/173 (42%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I++ DR+L P   ++ G   H     R+G G   +     +   VE+ R  + +++ H 
Sbjct: 373 FIIVNDRVLYPFYQKLTGK--HLTPLQRVGIGHAFNILSMAVTAIVEAKRLKI-VQKGHF 429

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
             +   + MS+LW+ P   ++GI    +          EFP SM +              
Sbjct: 430 LGSSSVADMSVLWLFPPLVIVGIGEAFHFPGNVALCYQEFPESMRSTATSITSVVIGICF 489

Query: 361 XXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                + +L   +   +W+  DIN G  D  YW+L    ++N   FL+CS  Y
Sbjct: 490 YTSTALIDLIQRTT--AWLPDDINHGRVDNVYWILVIGGVLNLGYFLVCSWLY 540



>gb:AP003621_1831573 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0621D05.>gb:AP003761_1833090 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0018H04.
          Length = 421

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 42/150 (28%), Positives = 59/150 (39%), Gaps = 4/150 (2%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           I LYDR  +P A R+ G         R+G G+ ++         VE+ R   A       
Sbjct: 274 IPLYDRAFVPAARRLTGREKGISDLLRIGGGLAMAALAMAAAALVETRRARAA------- 326

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXX----XXXXXXX 351
            + G    SILW  PQY L+G+      V Q  FF S+ P +M T+              
Sbjct: 327 -HAGMEPTSILWQAPQYVLVGVGELLATVGQLDFFYSQAPPAMKTVCTALGFISVAAGEY 385

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGH 441
                   ++  +   G   WI  D+NEGH
Sbjct: 386 LSSLVVTAVSWATATGGRPGWIPDDLNEGH 415



>gb:OSJN00261_1697577 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 572

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 45/188 (23%), Positives = 79/188 (42%), Gaps = 9/188 (4%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YDR L+P+  R  G         R+G G       + +   VE  RR+         D 
Sbjct: 383 VYDRFLVPLLRRRTGYASGVTHLQRVGAGFAAVILASAIAAVVERKRRA---------DA 433

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
               +MS+ W+ PQ+ L+G++  ++     + F SE PR M +I                
Sbjct: 434 AAAGQMSLFWLAPQFFLLGVSDVTSFPGLLELFSSEAPRGMKSIASALFWCELGLSSWLA 493

Query: 370 XXINELSIN--------SGNGSWIT-SDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYG 522
             + ++ +N         G G W+  + +N    D FYWV+A + ++ F+ +L  +  Y 
Sbjct: 494 TLLVQV-VNRATRRHGGGGGGGWLEGATLNTSRLDLFYWVVAAVGLLGFVNYLYWASRYI 552

Query: 523 PSKDEKPV 546
             +D + V
Sbjct: 553 YRQDPRVV 560



>gb:AB009053_1510684 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQB2.
          Length = 558

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 9/178 (5%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIK--QEHSSD 186
           Y+ LLLP+A +            R+G G+ +S     +   VE+ R+ + +     ++S 
Sbjct: 374 YNHLLLPLARKSTKTETGITHLQRIGTGLVLSIVAMAVAALVETKRKHVVVSCCSNNNSS 433

Query: 187 NLGDSKMSI--LWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXX-- 354
           +   S + I  LWV  QY  +G A         +FF +E P +M ++             
Sbjct: 434 SYSSSPLPITFLWVAIQYVFLGSADLFTLAGMMEFFFTEAPSTMRSLATSLSWASLAMGY 493

Query: 355 --XXXXXXXINELSINSGNGSWITSD-INEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                    +N ++  + +  W+  + +N+ H + FYW++  LS +NFL +L  +  Y
Sbjct: 494 YFSSVLVSAVNFVTGLNHHNPWLLGENLNQYHLERFYWLMCVLSGINFLHYLFWASRY 551



>pir|T47511|T47511 probable transporter protein - Arabidopsis
           thaliana>gb:ATT6D9_1556277 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6D9.
          Length = 556

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 31/109 (28%), Positives = 46/109 (42%)
 Frame = +1

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXX 372
           G   MS+LW+VP   ++GI    +  A    F  EFP S+                    
Sbjct: 431 GGHPMSVLWLVPALVMVGIGEAFHFPANVAVFYGEFPESLKNTATSLTSVVIGISFYLST 490

Query: 373 XINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
            +  + +     SW+ +DIN G  D  YWV+    ++N   FL+CS  Y
Sbjct: 491 AV--IDVIQRTTSWLPNDINHGRVDNVYWVVVIGGVLNLGYFLVCSWFY 537



>pir|T47506|T47506 hypothetical protein F9K21.240 - Arabidopsis
           thaliana>gb:ATF9K21_1551424 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F9K21.
          Length = 557

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 41/173 (23%), Positives = 71/173 (41%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           +I++ DR L P   ++ G         R+G G   +     +   VE+ R  + +++ H 
Sbjct: 372 FIIVNDRFLYPFYQKLTGK--FPTPIQRVGIGHVFNILSMAVTAIVEAKRLKI-VQKGHF 428

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXX 360
             +   + MS+LW+ P   ++GI    +          EFP SM +              
Sbjct: 429 LGSSSVADMSVLWLFPPLVIVGIGEAFHFPGNVALCYQEFPESMRSTATSITSVLIGICF 488

Query: 361 XXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                + +L   +   +W+  DIN G  D  YW+L    ++N   FL+CS  Y
Sbjct: 489 YTSTALIDLIQKTT--AWLPDDINHGRVDNVYWILVIGGVLNLGYFLVCSWFY 539



>gb:BC028394_1979253 Homo sapiens solute carrier family 15, member
           4, mRNA (cDNA clone IMAGE:4820163), partial cds.
          Length = 512

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 51/200 (25%), Positives = 95/200 (47%), Gaps = 20/200 (10%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES R 
Sbjct: 303 WLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRL 362

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-S 315
           +L +K++  +  +G+     + +S+ W VPQY L+GI+    ++A  +F  S  P+SM S
Sbjct: 363 NL-VKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQS 421

Query: 316 TIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSM 480
            I                  +  +SI +    W++S     +IN  + +Y++++LA +  
Sbjct: 422 AIMGLFFFFSGVGSFVGSGLLALVSIKA--IGWMSSHTDFGNINGCYLNYYFFLLAAIQG 479

Query: 481 VNFLLFLICSRSYGPSKDEK 540
              LLFLI S  Y   +D +
Sbjct: 480 ATLLLFLIISVKYDHHRDHQ 499



>gb:AY050629_1935247 Homo sapiens peptide/histidine transporter
           mRNA, complete cds.
          Length = 633

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 51/200 (25%), Positives = 95/200 (47%), Gaps = 20/200 (10%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES R 
Sbjct: 368 WLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRL 427

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-S 315
           +L +K++  +  +G+     + +S+ W VPQY L+GI+    ++A  +F  S  P+SM S
Sbjct: 428 NL-VKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQS 486

Query: 316 TIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSM 480
            I                  +  +SI +    W++S     +IN  + +Y++++LA +  
Sbjct: 487 AIMGLFFFFSGVGSFVGSGLLALVSIKA--IGWMSSHTDFGNINGCYLNYYFFLLAAIQG 544

Query: 481 VNFLLFLICSRSYGPSKDEK 540
              LLFLI S  Y   +D +
Sbjct: 545 ATLLLFLIISVKYDHHRDHQ 564



>gb:AY038999_1934821 Homo sapiens peptide/histidine transporter
           (PTR4) mRNA, complete cds.
          Length = 577

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 51/200 (25%), Positives = 95/200 (47%), Gaps = 20/200 (10%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES R 
Sbjct: 368 WLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRL 427

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-S 315
           +L +K++  +  +G+     + +S+ W VPQY L+GI+    ++A  +F  S  P+SM S
Sbjct: 428 NL-VKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQS 486

Query: 316 TIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSM 480
            I                  +  +SI +    W++S     +IN  + +Y++++LA +  
Sbjct: 487 AIMGLFFFFSGVGSFVGSGLLALVSIKA--IGWMSSHTDFGNINGCYLNYYFFLLAAIQG 544

Query: 481 VNFLLFLICSRSYGPSKDEK 540
              LLFLI S  Y   +D +
Sbjct: 545 ATLLLFLIISVKYDHHRDHQ 564



>sp|Q05085|CHL1_ARATH Nitrate/chlorate
           transporter.>pir|A45772|A45772 nitrate-inducible nitrate
           transporter - Arabidopsis thaliana>gb:ATHCHL1A_1553107
           Arabidopsis thaliana chlorate/nitrate transporter (CHL1)
           mRNA, complete cds.>gb:BT002016_1635619 Arabidopsis
           thaliana putative NPK1-related protein kinase 2
           (At1g12110) mRNA, complete cds.>gb:BT008783_1639979
           Arabidopsis thaliana At1g12110 gene, complete
           cds.>gb:F12F1_1677332 Arabidopsis thaliana chromosome 1
           BAC F12F1 sequence, complete sequence.
          Length = 590

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 41/173 (23%), Positives = 70/173 (40%), Gaps = 3/173 (1%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           +YDR+ + +  ++           R+G G+F       +   VE  R   A     +   
Sbjct: 398 VYDRVAIRLCKKLFNYPHGLRPLQRIGLGLFFGSMAMAVAALVELKRLRTAHAHGPTVKT 457

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXX 369
           L    +    ++PQY ++GI        Q  FF+ E P+ M  +                
Sbjct: 458 L---PLGFYLLIPQYLIVGIGEALIYTGQLDFFLRECPKGMKGMSTGLLLSTLALGFFFS 514

Query: 370 XXINELSINSGNGS---WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
             +  + +    G    WI  D+N+G    FYW++A L  +NFL+FL+ S+ Y
Sbjct: 515 SVLVTI-VEKFTGKAHPWIADDLNKGRLYNFYWLVAVLVALNFLIFLVFSKWY 566



>gb:AK117660_1815682 Arabidopsis thaliana At3g45680 mRNA for
           putative transporter protein, complete cds, clone:
           RAFL17-32-D16.
          Length = 558

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 30/105 (28%), Positives = 46/105 (43%)
 Frame = +1

Query: 205 MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINE 384
           MS+LW+ P   ++GI       A  + F  EFP S+                     + +
Sbjct: 437 MSVLWLFPPLVIVGIGEAFQFPANIELFYGEFPESLRNTATSLTSVVIGISFYLSTALID 496

Query: 385 LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           L   +   +W+ +DIN G  D  YW+L    ++NF  FL+CS  Y
Sbjct: 497 LIQRTT--AWLPNDINHGRVDNVYWLLVIGGILNFGYFLVCSWVY 539



>pir|T47508|T47508 probable transporter protein - Arabidopsis
           thaliana>gb:ATT6D9_1556274 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6D9.
          Length = 558

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 30/105 (28%), Positives = 46/105 (43%)
 Frame = +1

Query: 205 MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINE 384
           MS+LW+ P   ++GI       A  + F  EFP S+                     + +
Sbjct: 437 MSVLWLFPPLVIVGIGEAFQFPANIELFYGEFPESLRNTATSLTSVVIGISFYLSTALID 496

Query: 385 LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           L   +   +W+ +DIN G  D  YW+L    ++NF  FL+CS  Y
Sbjct: 497 LIQRTT--AWLPNDINHGRVDNVYWLLVIGGILNFGYFLVCSWVY 539



>pir|T47512|T47512 probable transporter protein - Arabidopsis
           thaliana>gb:ATT6D9_1556278 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6D9.
          Length = 555

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 31/131 (23%), Positives = 54/131 (41%)
 Frame = +1

Query: 118 AVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISE 297
           ++ +  +   +R   ++ EH         MS+LW++P   ++GI    + +A    F  E
Sbjct: 414 SMAISAIVEAKRLKTVENEHP--------MSVLWLLPPLVIVGIGDAFHYMANVAVFYGE 465

Query: 298 FPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLS 477
           FP SM                     +  +++     +W+  DIN G  D  YWVL    
Sbjct: 466 FPESMRNTATSVTSVAFGISFYLSTAL--INLIQRTTAWLPDDINHGRVDNVYWVLVIGG 523

Query: 478 MVNFLLFLICS 510
           ++N   F +CS
Sbjct: 524 VLNLGYFFVCS 534



>gb:BC037974_1982267 Homo sapiens solute carrier family 15, member
           3, mRNA (cDNA clone MGC:46085 IMAGE:5213632), complete
           cds.
          Length = 581

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 46/182 (25%), Positives = 79/182 (43%), Gaps = 10/182 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + L DRL+ P+  R +   +      +M  G+F  F   ++ G +E  R       E  S
Sbjct: 387 VPLKDRLIDPLLLRCK---LLPSALQKMALGMFFGFTSVIVAGVLEMERLHYIHHNETVS 443

Query: 184 DNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
             +G+     + +SI W +PQY L+GI+    ++   +F  SE PRSM            
Sbjct: 444 QQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLS 503

Query: 349 XXXXXXXXXINELSINSGNGSWI-----TSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                    +  +++ S  G W+       +IN    D ++++LAG+  V  LLF+  + 
Sbjct: 504 GVGSLLGSSL--VALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIAG 561

Query: 514 SY 519
            Y
Sbjct: 562 RY 563



>gb:AB020598_1865221 Homo sapiens mRNA for peptide transporter 3,
           complete cds.
          Length = 581

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 46/182 (25%), Positives = 79/182 (43%), Gaps = 10/182 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           + L DRL+ P+  R +   +      +M  G+F  F   ++ G +E  R       E  S
Sbjct: 387 VPLKDRLIDPLLLRCK---LLPSALQKMALGMFFGFTSVIVAGVLEMERLHYIHHNETVS 443

Query: 184 DNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
             +G+     + +SI W +PQY L+GI+    ++   +F  SE PRSM            
Sbjct: 444 QQIGEVLYNAAPLSIWWQIPQYLLIGISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLS 503

Query: 349 XXXXXXXXXINELSINSGNGSWI-----TSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                    +  +++ S  G W+       +IN    D ++++LAG+  V  LLF+  + 
Sbjct: 504 GVGSLLGSSL--VALLSLPGGWLHCPKDFGNINNCRMDLYFFLLAGIQAVTALLFVWIAG 561

Query: 514 SY 519
            Y
Sbjct: 562 RY 563



>gb:AP003238_1825994 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0401G10.>gb:AP003263_1826637 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0483G10.
          Length = 543

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 41/171 (23%), Positives = 69/171 (40%), Gaps = 1/171 (0%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           L+DR+  P+ +      +      R+G G  ++     +   VE  RR +   +  ++  
Sbjct: 358 LFDRVAAPLCAA--AGKLAITPLRRVGLGHALNVASMAVAALVE--RRRIGAARGRAAAA 413

Query: 190 LGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-STIXXXXXXXXXXXXXXX 366
                MS+LW+VPQ AL G     +       F  E P S+  T                
Sbjct: 414 AAVVPMSVLWLVPQLALTGAEEALHLPGNTALFYGELPASLRGTATAMPPLFIAAGSYLS 473

Query: 367 XXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
              ++ +   +   +W+  D+N    D  YW LA L+ VN   FL+C+ +Y
Sbjct: 474 AAAVDAVKRGT---TWLPDDLNASRLDCVYWTLAVLAAVNLGYFLLCATTY 521



>gb:BC016233_2092243 Mus musculus solute carrier family 15, member
           4, mRNA (cDNA clone MGC:28803 IMAGE:4502184), complete
           cds.
          Length = 574

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 19/192 (9%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES R 
Sbjct: 369 WLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRL 428

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST 318
            L +K++  +  +G      + + I W +PQY L+GI+    ++A  +F  S  P+SM +
Sbjct: 429 DL-VKEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQS 487

Query: 319 IXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSMV 483
                              +  L      G W++S     +IN  H  Y++++LA +   
Sbjct: 488 AIMGLFFFFSGIGSFVGSGLLALVSLKAIG-WMSSHTDFGNINSCHLHYYFFLLAAIQGA 546

Query: 484 NFLLFLICSRSY 519
             LLFLI S  Y
Sbjct: 547 TLLLFLIVSVKY 558



>gb:BC056821_2552004 Danio rerio zgc:63767, mRNA (cDNA clone
           MGC:63767 IMAGE:2641824), complete cds.
          Length = 501

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 48/197 (24%), Positives = 86/197 (43%), Gaps = 20/197 (10%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTK---------SRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D +L+ +   ++   V    K          R+  G+F     AV  G +E+ R 
Sbjct: 294 WLTMFDAVLILMLIPLKDKVVDPILKRKGLLPSSLKRIAVGMFFVMCSAVAAGILETKRL 353

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-S 315
            +   +     +LG      + + I W VPQY L+G++    ++A  +F  S  PRSM S
Sbjct: 354 DIVRTRGPIPQSLGGVIYYAADLPIWWQVPQYVLIGVSEIFASIAGLEFAYSAAPRSMQS 413

Query: 316 TIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSM 480
            I                  +  +S+ +    W++S     +INE   +Y++++LA +  
Sbjct: 414 AIMGLFFFFSGIGSFVGSGLLAIVSLKA--IGWMSSHQDFGNINECRLNYYFFLLAAIQG 471

Query: 481 VNFLLFLICSRSYGPSK 531
           +  L+FLI S  Y   K
Sbjct: 472 ITLLIFLIVSVKYDKQK 488



>gb:AL627256_2504206 Zebrafish DNA sequence from clone RP71-1L10 in
           linkage group 8 Contains part of a gene for a novel
           peptide transporter, complete sequence.
          Length = 263

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 48/197 (24%), Positives = 86/197 (43%), Gaps = 20/197 (10%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTK---------SRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D +L+ +   ++   V    K          R+  G+F     AV  G +E+ R 
Sbjct: 56  WLTMFDAVLILMLIPLKDKVVDPILKRKGLLPSSLKRIAVGMFFVMCSAVAAGILETKRL 115

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM-S 315
            +   +     +LG      + + I W VPQY L+G++    ++A  +F  S  PRSM S
Sbjct: 116 DIVRTRGPIPQSLGGVIYYAADLPIWWQVPQYVLIGVSEIFASIAGLEFAYSAAPRSMQS 175

Query: 316 TIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSM 480
            I                  +  +S+ +    W++S     +INE   +Y++++LA +  
Sbjct: 176 AIMGLFFFFSGIGSFVGSGLLAIVSLKA--IGWMSSHQDFGNINECRLNYYFFLLAAIQG 233

Query: 481 VNFLLFLICSRSYGPSK 531
           +  L+FLI S  Y   K
Sbjct: 234 ITLLIFLIVSVKYDKQK 250



>gb:BC087709_2110176 Rattus norvegicus peptide/histidine
           transporter, mRNA (cDNA clone MGC:105315 IMAGE:7315369),
           complete cds.
          Length = 572

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 19/192 (9%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES R 
Sbjct: 367 WLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVTCSAFAAGILESKRL 426

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST 318
            L +K++  +  +G      + + I W +PQY L+GI+    ++A  +F  S  P+SM +
Sbjct: 427 DL-VKEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQS 485

Query: 319 IXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSMV 483
                              +  L      G W++S     +IN  H  Y++++LA +   
Sbjct: 486 AIMGLFFFFSGIGSFVGSGLLALVSLKAIG-WMSSHTDFGNINSCHLHYYFFLLAAIQGA 544

Query: 484 NFLLFLICSRSY 519
             LLFLI S  Y
Sbjct: 545 TLLLFLIVSVKY 556



>gb:AB000280_2042987 Rattus norvegicus mRNA for peptide/histidine
           transporter, complete cds.
          Length = 572

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 48/192 (25%), Positives = 85/192 (44%), Gaps = 19/192 (9%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES R 
Sbjct: 367 WLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVTCSAFAAGILESKRL 426

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST 318
            L +K++  +  +G      + + I W +PQY L+GI+    ++A  +F  S  P+SM +
Sbjct: 427 DL-VKEKTINQTIGGVVYHAADLPIWWQIPQYVLIGISEIFASIAGLEFAYSAAPKSMQS 485

Query: 319 IXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSMV 483
                              +  L      G W++S     +IN  H  Y++++LA +   
Sbjct: 486 AIMGLFFFFSGIGSFVGSGLLALVSLKAIG-WMSSHTDFGNINSCHLHYYFFLLAAIQGA 544

Query: 484 NFLLFLICSRSY 519
             LLFLI S  Y
Sbjct: 545 TLLLFLIVSVKY 556



>gb:BT005911_1638833 Arabidopsis thaliana At3g45700 gene, complete
           cds.>gb:AK117193_1815238 Arabidopsis thaliana At3g45700
           mRNA for putative transporter protein, complete cds,
           clone: RAFL16-73-F02.
          Length = 548

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 30/105 (28%), Positives = 43/105 (40%)
 Frame = +1

Query: 205 MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINE 384
           MS+LW+VP   + GI    +  A    F  EFP S+                     +  
Sbjct: 427 MSVLWLVPALVINGIGEAFHFPANIAIFYGEFPESLRNTATSLTSVVMGISFYLSTAL-- 484

Query: 385 LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           + +      W+ +DIN G  D  Y VL  + + NF  FL+CS  Y
Sbjct: 485 IDVIQRTTKWLPNDINHGRVDNVYLVLVIIGVSNFGYFLVCSWFY 529



>pir|T47510|T47510 probable transporter protein - Arabidopsis
           thaliana>gb:ATT6D9_1556276 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6D9.
          Length = 548

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 30/105 (28%), Positives = 43/105 (40%)
 Frame = +1

Query: 205 MSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINE 384
           MS+LW+VP   + GI    +  A    F  EFP S+                     +  
Sbjct: 427 MSVLWLVPALVINGIGEAFHFPANIAIFYGEFPESLRNTATSLTSVVMGISFYLSTAL-- 484

Query: 385 LSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           + +      W+ +DIN G  D  Y VL  + + NF  FL+CS  Y
Sbjct: 485 IDVIQRTTKWLPNDINHGRVDNVYLVLVIIGVSNFGYFLVCSWFY 529



>gb:AY050630_2074568 Mus musculus peptide/histidine transporter
           mRNA, complete cds.
          Length = 576

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 46/192 (23%), Positives = 85/192 (44%), Gaps = 19/192 (9%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES + 
Sbjct: 371 WLTMFDAVLILLLIPLKDKLVDPVLRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKKL 430

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST 318
            L +K++  +  +G      + + I W + QY L+GI+    ++A+ +F  S  P+SM +
Sbjct: 431 DL-VKEKTINQTIGGVVFHAADLPIWWQILQYVLIGISEIFASIARQEFAYSAAPKSMQS 489

Query: 319 IXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSMV 483
                              +  L      G W++S     +IN  H  Y++++LA +   
Sbjct: 490 AIMGLFFFFSCIGSFVGSGLLALVSLKAIG-WMSSHTDFGNINSCHLHYYFFLLAAIQGA 548

Query: 484 NFLLFLICSRSY 519
             LLFLI S  Y
Sbjct: 549 TLLLFLIVSVKY 560



>gb:AC134342_1741730 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0053E01, complete sequence.
          Length = 583

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 42/174 (24%), Positives = 67/174 (38%), Gaps = 4/174 (2%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDN 189
           L DR LLP+   + G         R+G G  ++         VE  RR LA  + H    
Sbjct: 407 LIDRALLPLWRALTGGRRAPTPLQRIGVGHVLTVLSMAASAAVE--RRRLATVRAHGEAA 464

Query: 190 LGD----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXX 357
             D    S +   W+V  +AL G     +  AQ   +  EFP S+               
Sbjct: 465 RDDPAWVSPLPAAWLVLPFALSGAGEAFHFPAQVTLYYQEFPPSLKNTASGMVAMIVALG 524

Query: 358 XXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
                 + +    +   +W+  ++N    +  YW+LA L  +NF  +L C++ Y
Sbjct: 525 FYLSTALVDAVRRAT--AWLPDNMNASRLENLYWLLAVLVAINFGYYLACAKLY 576



>gb:AC003028_1530967 Arabidopsis thaliana chromosome 2 clone F16M14
           map ve018, complete sequence.
          Length = 521

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 41/170 (24%), Positives = 64/170 (37%), Gaps = 5/170 (2%)
 Frame = +1

Query: 73  TKSRMGF--GIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMG 246
           TK+  G    I +S +   +   VES R  +   Q    + +    MS+ W++PQY L+G
Sbjct: 353 TKTPYGIPVSIILSIFCCSIAAHVESRRLKVVSTQGLLHETV---PMSVFWLLPQYILLG 409

Query: 247 IAVGSNAVAQNQFFI---SEFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWI 417
              G   + +N F +      P  +S                    +  L  +   G W 
Sbjct: 410 SITG---IYENSFALYLEETVPEELSQYMVLLNVGVCGVGIMSNIALVSLVGSVSGGKWF 466

Query: 418 TSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED*R 567
              IN+   D +YWV+    M N LL+ I +  Y     +     E D R
Sbjct: 467 QDTINKSRVDNYYWVITVFCMFNLLLYFIVTYRYTVCNKKDGATQENDRR 516



>pir|T01242|T01242 peptide transport protein homolog At2g38100 -
           Arabidopsis thaliana
          Length = 521

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 41/170 (24%), Positives = 64/170 (37%), Gaps = 5/170 (2%)
 Frame = +1

Query: 73  TKSRMGF--GIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMG 246
           TK+  G    I +S +   +   VES R  +   Q    + +    MS+ W++PQY L+G
Sbjct: 353 TKTPYGIPVSIILSIFCCSIAAHVESRRLKVVSTQGLLHETV---PMSVFWLLPQYILLG 409

Query: 247 IAVGSNAVAQNQFFI---SEFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWI 417
              G   + +N F +      P  +S                    +  L  +   G W 
Sbjct: 410 SITG---IYENSFALYLEETVPEELSQYMVLLNVGVCGVGIMSNIALVSLVGSVSGGKWF 466

Query: 418 TSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEED*R 567
              IN+   D +YWV+    M N LL+ I +  Y     +     E D R
Sbjct: 467 QDTINKSRVDNYYWVITVFCMFNLLLYFIVTYRYTVCNKKDGATQENDRR 516



>gb:BC079971_2561410 Xenopus laevis MGC80026 protein, mRNA (cDNA
           clone MGC:80026 IMAGE:3401976), complete cds.
          Length = 569

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 41/192 (21%), Positives = 85/192 (44%), Gaps = 19/192 (9%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSR---------MGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D +L+ +   ++   V    K R         +  G+F      +  G +ES R 
Sbjct: 369 WLTMFDAVLILILIPLKDKLVDPFLKKRGLLPSPLKRIAVGMFFVMCSVLAAGILESERL 428

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST 318
            + +K++     +G+     + +++ W +PQY L+GI+    ++A  +F  S  P+SM +
Sbjct: 429 EI-VKRDKIQQQIGNVTYYAANLTVWWQLPQYILIGISEIFASIAGLEFAYSAAPKSMQS 487

Query: 319 IXXXXXXXXXXXXXXXXXXINELSINSGNGSWITS-----DINEGHYDYFYWVLAGLSMV 483
           +                  +  L ++     W+++     +IN    +Y++++LA +   
Sbjct: 488 VIMGLFFFFSGIGSFVGSGLLAL-VSIPQIGWMSNHSDLGNINGCTLNYYFFLLAAVQAA 546

Query: 484 NFLLFLICSRSY 519
             LLFLI S  Y
Sbjct: 547 TLLLFLIISVKY 558



>gb:AF000392_1760498 Lotus japonicus peptide transporter (LjNOD65)
           mRNA, complete cds.
          Length = 574

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 46/180 (25%), Positives = 77/180 (42%), Gaps = 10/180 (5%)
 Frame = +1

Query: 10  LYDRLLLPVASRIRGNTVHXGTK--SRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           +YD   +P   R  GN  H G K   R+G G+ +      +   VE+ R S+ IK+ H +
Sbjct: 383 IYDHYFIPFMRRRTGN--HRGIKLLQRVGIGMAIQVIAMAVTYAVETQRMSV-IKKHHIA 439

Query: 184 DNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSM----STIXXXXXXXXXX 351
                  MSI W++PQ  ++G++    A    +FF  + P  M    +T+          
Sbjct: 440 GPEETVPMSIFWLLPQNIILGVSFAFLATGMLEFFYDQSPEEMKGLGTTLCTSCVAAGSY 499

Query: 352 XXXXXXXXINELSINSGNGSWITSDINEGHYDY----FYWVLAGLSMVNFLLFLICSRSY 519
                   I++L       +WI +++N+         F+ V++ L   NF +FL  S  Y
Sbjct: 500 INTFLVTMIDKL-------NWIGNNLNDSQSRITIMPFFSVISAL---NFGVFLWVSSGY 549



>gb:AF121080_2055355 Mus musculus cAMP inducible 1 protein (Ci1)
           mRNA, complete cds.
          Length = 578

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 43/188 (22%), Positives = 81/188 (43%), Gaps = 10/188 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVES-----IRRSLAIK 168
           I + D L+ P+  R +   +   +  +M  G+F  F   ++ G +E      I  +  + 
Sbjct: 384 IPVKDHLIDPLLLRCK---LLPSSLQKMALGMFFGFTSIIVAGVLEKERLQYIAANQTVP 440

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
           Q    D    + +SI W +PQY L+G++    ++   +F  SE PRSM            
Sbjct: 441 QLIGKDLYYAAPLSIWWQIPQYLLIGVSEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLS 500

Query: 349 XXXXXXXXXINELSINSGNGSWI-----TSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                    +  +++ S  G W+       +IN    D ++++LAG+  V  +LFL  + 
Sbjct: 501 GVGSLLGSGL--VALLSFPGGWMYCPKDFGNINNCQMDRYFFLLAGIEAVTAVLFLWIAG 558

Query: 514 SYGPSKDE 537
            Y  ++ +
Sbjct: 559 RYERTRQD 566



>gb:AB026665_2044421 Rattus norvegicus mRNA for peptide histidine
           transporter 1 homolog rPHT2, complete cds.
          Length = 582

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 39/162 (24%), Positives = 70/162 (43%), Gaps = 10/162 (6%)
 Frame = +1

Query: 82  RMGFGIFVSFWYAVLVGKVES-----IRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMG 246
           +M  G+F  F   ++ G +E      I  +  + Q    D    + +SI W +PQY L+G
Sbjct: 411 KMALGMFFGFTSIIVAGVLEKERLQYIAANQTVPQLIGKDLYYAAPLSIWWQIPQYLLIG 470

Query: 247 IAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWI--- 417
           I+    ++   +F  SE PRSM                     +  +++ S  G W+   
Sbjct: 471 ISEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLSGVGSLLGSGL--VALLSLPGGWMYCP 528

Query: 418 --TSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE 537
               +IN    D ++++LAG+  V  +LFL  +  Y  ++ +
Sbjct: 529 KDFGNINNCRMDLYFFLLAGIQAVTAVLFLWIAGRYERTRQD 570



>gb:AK051941_1169864 Mus musculus 12 days embryo eyeball cDNA, RIKEN
           full-length enriched library, clone:D230021J08
           product:cAMP inducible gene 1, full insert
           sequence.>gb:BC051940_2100845 Mus musculus solute
           carrier family 15, member 3, mRNA (cDNA clone MGC:62183
           IMAGE:5717926), complete cds.
          Length = 578

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 43/188 (22%), Positives = 81/188 (43%), Gaps = 10/188 (5%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVES-----IRRSLAIK 168
           I + D L+ P+  R +   +   +  +M  G+F  F   ++ G +E      I  +  + 
Sbjct: 384 IPVKDHLIDPLLLRCK---LLPSSLQKMALGMFFGFTSIIVAGVLEKERLQYIAANQTVP 440

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
           Q    D    + +SI W +PQY L+G++    ++   +F  SE PRSM            
Sbjct: 441 QLIGKDLYYAAPLSIWWQIPQYLLIGVSEIFASIPGLEFAYSEAPRSMQGAIMGIFFCLS 500

Query: 349 XXXXXXXXXINELSINSGNGSWI-----TSDINEGHYDYFYWVLAGLSMVNFLLFLICSR 513
                    +  +++ S  G W+       +IN    D ++++LAG+  V  +LFL  + 
Sbjct: 501 GVGSLLGSGL--VALLSFPGGWMYCPKDFGNINNCQMDRYFFLLAGIEAVTAVLFLWIAG 558

Query: 514 SYGPSKDE 537
            Y  ++ +
Sbjct: 559 RYERTRQD 566



>gb:AB026647_1517209 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJL12.
          Length = 515

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 30/146 (20%), Positives = 65/146 (44%)
 Frame = +1

Query: 82  RMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGS 261
           R+G+G+ ++     +   VE       +K++H + +  + K+S+ W+  Q+ ++ ++   
Sbjct: 380 RIGYGLALTSISMAVAAIVE-------VKRKHEAVH-NNIKISVFWLELQFVMLSLSDML 431

Query: 262 NAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGH 441
                 +FF  E P SM ++                  + E  + +G   W+  D+NE  
Sbjct: 432 TVGGMLEFFFRESPASMRSMSTALGWCSTAMGFFLSSVLVE--VVNGITGWLRDDLNESR 489

Query: 442 YDYFYWVLAGLSMVNFLLFLICSRSY 519
            + FY VL  L+ +N   ++  ++ Y
Sbjct: 490 LELFYLVLCVLNTLNLFNYIFWAKRY 515



>gb:AY187878_1588173 Zea mays nitrate transporter (Nrt1.1) mRNA,
           partial cds.
          Length = 455

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 29/107 (27%), Positives = 47/107 (43%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+  Y+ +L P+A R  GN        R+  G  +S     L   VE+ R ++A +    
Sbjct: 332 WVAAYEIVLAPLARRFTGNEKGFSQWQRLAIGQALSILTMALAALVETRRLAIA-EASGL 390

Query: 181 SDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTI 321
                   MSILW  P + + G A    A+   +FF  + P +M ++
Sbjct: 391 RHREVPVPMSILWQGPVFFVHGAAEVFGAIGMTEFFYDQAPATMKSL 437



>gb:AF080545_1766448 Nepenthes alata peptide transporter (PTR1)
           mRNA, partial cds.
          Length = 297

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = +1

Query: 1   WIVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHS 180
           W+ +YD++L+P+A +  G         RMG G+F+S         VE  R  LA K+   
Sbjct: 220 WVPVYDKILVPLARKSTGKQRGFSELQRMGIGLFISILSMAAAALVEMKRLQLA-KELGL 278

Query: 181 SDNLGDSKMSILWVVPQY 234
            D      +SI W +P Y
Sbjct: 279 VDEDVAVPLSIFWQIPPY 296



>gb:AF461893_1151003 Homo sapiens FP12591 mRNA, complete cds.
          Length = 188

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 32/120 (26%), Positives = 62/120 (51%), Gaps = 14/120 (11%)
 Frame = +1

Query: 1   WIVLYDR----LLLPVASRI-----RGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRR 153
           W+ ++D     LL+P+  ++     R + +   +  R+  G+F     A   G +ES R 
Sbjct: 31  WLTMFDAVLILLLIPLKDKLVDPILRRHGLLPSSLKRIAVGMFFVMCSAFAAGILESKRL 90

Query: 154 SLAIKQEHSSDNLGD-----SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMST 318
           +L +K++  +  +G+     + +S+ W VPQY L+GI+    ++A  +F  S  P+SM +
Sbjct: 91  NL-VKEKTINQTIGNVVYHAADLSLWWQVPQYLLIGISEIFASIAGLEFAYSAAPKSMQS 149



>gb:HVU495773_1682726 Hordeum vulgare partial mRNA for putative
           peptide transporter protein.
          Length = 59

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 13/48 (27%), Positives = 29/48 (60%)
 Frame = +1

Query: 376 INELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           +   + +  +  WI+ D+N+GH DYF+W +  +  +NF+++    ++Y
Sbjct: 5   VEAFTASGDSPGWISDDLNKGHLDYFFWAMVAMCTLNFVVYSGIVKNY 52



>gb:AY289623_1594950 Vicia faba peptide transporter 2 (PTR2) mRNA,
           partial cds.
          Length = 317

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 28/101 (27%), Positives = 53/101 (52%), Gaps = 1/101 (0%)
 Frame = +1

Query: 4   IVLYDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSS 183
           IV+YDR  +P+  R   N        R+G G+ +    A++V    + R+ L + +E++ 
Sbjct: 219 IVVYDRAFVPMVRRYTKNPRGITMLQRLGIGLVLHI--AIMVTACLAERKRLRVARENNL 276

Query: 184 DNLGDS-KMSILWVVPQYALMGIAVGSNAVAQNQFFISEFP 303
               D+  ++I  ++PQ+AL G+A     +A+ +FF  + P
Sbjct: 277 FGRHDTIPLTIFILLPQFALGGVADSFVEIAKLEFFYDQSP 317



>gb:OSJN00261_1697578 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0076N16, complete sequence.
          Length = 448

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 40/188 (21%), Positives = 73/188 (38%), Gaps = 5/188 (2%)
 Frame = +1

Query: 13  YDRLLLPVASRIRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNL 192
           Y R+L+P+     G+T        +G         A +   VE+ +R + ++Q+  +   
Sbjct: 258 YRRILIPLLRIFTGHTNGITPLQHIGVASACGIMAACIAMLVEA-KRLMVVEQQGLTLVA 316

Query: 193 GDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRS---MSTIXXXXXXXXXXXXXX 363
               MS+ W+V Q+ L+ I   +      QF  SE P +      +              
Sbjct: 317 DGVPMSVFWLVMQFFLLSIMDIAYIGGLVQFIKSEAPEAKHIAPAVQSLLVGIAAWSGCA 376

Query: 364 XXXXINELSINSGNG-SWIT-SDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDE 537
               +N ++    NG  W+  ++ N    D F+ +LA   +V F+ +   +R Y   K  
Sbjct: 377 FVQLVNRMTRLGDNGRGWLDGTNFNRTRLDRFFLLLATFELVAFINYAFWARRYANKKRV 436

Query: 538 KPVAMEED 561
             V  + D
Sbjct: 437 STVRSDGD 444



>gb:BC026899_2095622 Mus musculus hypothetical protein 9830102E05,
           mRNA (cDNA clone IMAGE:4008601), partial cds.
          Length = 227

 Score = 40.0 bits (92), Expect = 0.052
 Identities = 31/124 (25%), Positives = 54/124 (43%)
 Frame = +1

Query: 121 VLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEF 300
           V+ G +E I R LA +Q  S      S M+ + +VPQY L+G++     V  N       
Sbjct: 84  VMAGFLE-IYRKLAREQSPSGKLFSVSSMACVCLVPQYVLLGVS----EVLVNPAVSMVT 138

Query: 301 PRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSM 480
            R +                     + +L      G+W  + +++G+ + F++VLA L +
Sbjct: 139 HRVIPGASMAFLTLSHGSACFAGAMLIKLLYLISEGNWFPNTLDKGNLENFFFVLASLML 198

Query: 481 VNFL 492
           +N L
Sbjct: 199 LNIL 202



>gb:AB026647_1517211 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MJL12.
          Length = 521

 Score = 40.0 bits (92), Expect = 0.052
 Identities = 35/151 (23%), Positives = 67/151 (44%), Gaps = 5/151 (3%)
 Frame = +1

Query: 82  RMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGS 261
           R+G G+ +S     +   VE+ R     K E   +N    ++S+LW+V QY ++ ++   
Sbjct: 380 RIGLGLALSSVSMAVSAIVEAKR-----KHEVVHNNF---RISVLWLVFQYLMLSVSDML 431

Query: 262 NAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNG----SWI-TSD 426
                 +FF  E P +M +I                  + E++ N+  G     W+   D
Sbjct: 432 TLGGMLEFFYREAPSNMKSISTALGWCSTALGFFLSTTLVEVT-NAVTGRLGHQWLGGED 490

Query: 427 INEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           +N+   + FY +L  L+ +N L ++  ++ Y
Sbjct: 491 LNKTRLELFYVLLCVLNTLNLLNYIFWAKRY 521



>gb:AY679588_1622018 Fragaria x ananassa putative nitrate
           transporter mRNA, partial cds.
          Length = 112

 Score = 39.3 bits (90), Expect = 0.089
 Identities = 29/92 (31%), Positives = 43/92 (46%)
 Frame = +1

Query: 46  IRGNTVHXGTKSRMGFGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVV 225
           I G+        R+G G+ +S     + G VE  RR+ A+   HS   L    +S+ W+ 
Sbjct: 2   ITGHPAGITQLQRVGIGLVLSAVSMAVAGIVEVKRRNYALA--HSP--LAPGGISLFWLS 57

Query: 226 PQYALMGIAVGSNAVAQNQFFISEFPRSMSTI 321
            QYA+ GIA     V   +FF  E P  M ++
Sbjct: 58  FQYAIFGIADMFTLVGLLEFFYREAPAGMKSL 89



>gb:AK036413_1164464 Mus musculus adult male bone cDNA, RIKEN
           full-length enriched library, clone:9830102E05
           product:hypothetical protein, full insert sequence.
          Length = 447

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/116 (24%), Positives = 49/116 (42%)
 Frame = +1

Query: 145 IRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIX 324
           I R LA +Q  S      S M+ + +VPQY L+G++     V  N        R +    
Sbjct: 280 IYRKLAREQSPSGKLFSVSSMACVCLVPQYVLLGVS----EVLVNPAVSMVTHRVIPGAS 335

Query: 325 XXXXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFL 492
                            + +L      G+W  + +++G+ + F++VLA L ++N L
Sbjct: 336 MAFLTLSHGSACFAGAMLIKLLYLISEGNWFPNTLDKGNLENFFFVLASLMLLNIL 391



>gb:AE014298_1124220 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003429_1209402 Drosophila melanogaster
            chromosome X, section 13 of 74 of the complete sequence.
          Length = 803

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 34/137 (24%), Positives = 55/137 (40%)
 Frame = +1

Query: 115  YAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFIS 294
            YA+L+G+      S  I  E +S N     M +LW+VPQY +M +     +V   +F  S
Sbjct: 658  YALLIGQSHGTFVSRII--EVTSPN----SMHMLWLVPQYVVMTLGEVMFSVTGLEFSYS 711

Query: 295  EFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGL 474
            + P SM ++                  + EL       S              +++ AGL
Sbjct: 712  QSPPSMKSVLQACWLLTVAFGNVIVVVVAELKFFDSQAS-------------EFFLFAGL 758

Query: 475  SMVNFLLFLICSRSYGP 525
              V+ L+F+  +  Y P
Sbjct: 759  MFVDMLVFMFVAYYYKP 775



>pir|T21870|T21870 hypothetical protein F36G9.13 - Caenorhabditis
           elegans>gb:CEF36G9_1363535 Caenorhabditis elegans cosmid
           F36G9, complete sequence.
          Length = 917

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 26/89 (29%), Positives = 39/89 (43%)
 Frame = -1

Query: 269 TALDPTAIPMSAYCGTTHSIDILLSPRLSDECSCLIARLRRMLSTLPTRTAYQKDTKIPN 90
           + LDP +   S       S D++ +  L D  S  +  L++ L TL +        K   
Sbjct: 155 STLDPLSTIASWDLSVLKSFDLISTLHLIDSESPSVLDLKKKLETLTSAVKKLPTPKKMK 214

Query: 89  PILDLVPKWTVFPLILDATGRSSLSYNTI 3
           P +DL+ KWT F    D  G   L Y++I
Sbjct: 215 PFIDLLKKWTPFDQFADIVG-LHLGYSSI 242



>gb:SSU37262_191478 Serratia sp. MK1 phospholipase A1 (plaA) and
           accessory protein (plaS) genes, complete cds.
          Length = 251

 Score = 35.8 bits (81), Expect = 0.99
 Identities = 25/74 (33%), Positives = 42/74 (56%), Gaps = 9/74 (12%)
 Frame = +1

Query: 118 AVLVGKVESIRRSLAIKQEHS-SDNLGDSKMSILWVV--PQYALMGIAVGSNAVAQN--- 279
           AVL G+ E +R  L    + + SD LGD+ + +   +  PQ ALM +  G++A A+N   
Sbjct: 150 AVLAGREEQVRLLLVSGADVTLSDRLGDTPLHLAAKINAPQLALMLLQAGADAKARNQQG 209

Query: 280 ---QFFISEFPRSM 312
              QF++S+ P ++
Sbjct: 210 VAFQFYLSQTPTAL 223



>gb:AE017340_457551 Idiomarina loihiensis L2TR, complete genome.
          Length = 350

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 2/85 (2%)
 Frame = -1

Query: 305 RGNSEMKNWFCATALDPTAIPMSAYCGTTHSIDILLS--PRLSDECSCLIARLRRMLSTL 132
           R  SEM  W C  AL P  +  S + G+     ILL+    ++ E +C +AR R   S L
Sbjct: 15  RNTSEMMRWVCY-ALVPGVLLHSYFFGSGIWFQILLAVVTAIAAEMACTVARERPAFSAL 73

Query: 131 PTRTAYQKDTKIPNPILDLVPKWTV 57
              TA      +   I  L P W +
Sbjct: 74  RDNTAIVTAVLLAISIPSLAPWWII 98



>pir|T47509|T47509 probable transporter protein - Arabidopsis
           thaliana>gb:ATT6D9_1556275 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6D9.
          Length = 516

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +1

Query: 412 WITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSY 519
           W+ +DIN G  D  YW+L  + ++N+  FL+C+  Y
Sbjct: 463 WLPNDINHGRVDNVYWLLVIVGVLNY--FLVCAWFY 496



>gb:DMU97114_1381143 Drosophila melanogaster opt1 (opt) gene,
           alternative splice products, complete cds; and
           non-coding nuclear RNA roX1, complete sequence.
          Length = 737

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 31/131 (23%), Positives = 52/131 (39%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
           Q +  + +  S +SILW +PQ  +M  A    +V   +F  S+ P SM ++         
Sbjct: 573 QHNVIEVVAPSTVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSV 632

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    I E    S      T             + A L +V+ ++FL  +RSY   
Sbjct: 633 AIGNMLVVVIAEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QY 678

Query: 529 KDEKPVAMEED 561
           KD++    ++D
Sbjct: 679 KDQREDFEDDD 689



>gb:DMU97114_1381142 Drosophila melanogaster opt1 (opt) gene,
           alternative splice products, complete cds; and
           non-coding nuclear RNA roX1, complete sequence.
          Length = 743

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 31/131 (23%), Positives = 52/131 (39%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
           Q +  + +  S +SILW +PQ  +M  A    +V   +F  S+ P SM ++         
Sbjct: 579 QHNVIEVVAPSTVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSV 638

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    I E    S      T             + A L +V+ ++FL  +RSY   
Sbjct: 639 AIGNMLVVVIAEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QY 684

Query: 529 KDEKPVAMEED 561
           KD++    ++D
Sbjct: 685 KDQREDFEDDD 695



>gb:AF181635_1248302 Drosophila melanogaster BcDNA.GH06717
           (BcDNA.GH06717) mRNA, complete cds.
          Length = 810

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/114 (21%), Positives = 46/114 (40%)
 Frame = +1

Query: 199 SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXI 378
           + + ILW+VPQY +M +     +V   +F  ++ P SM ++                  I
Sbjct: 678 NSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVI 737

Query: 379 NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK 540
            E ++     S              +++ AGL   + L+F++ +  Y P+   K
Sbjct: 738 AEAALFESQAS-------------EFFLFAGLMFADMLIFMVMAYYYVPNDPNK 778



>gb:AE014298_1124221 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1124222 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003429_1209403
           Drosophila melanogaster chromosome X, section 13 of 74
           of the complete sequence.>gb:AE003429_1209404 Drosophila
           melanogaster chromosome X, section 13 of 74 of the
           complete sequence.
          Length = 810

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/114 (21%), Positives = 46/114 (40%)
 Frame = +1

Query: 199 SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXI 378
           + + ILW+VPQY +M +     +V   +F  ++ P SM ++                  I
Sbjct: 678 NSVKILWLVPQYVVMTLGEVMFSVTGLEFSYAQAPPSMKSVLQACWLLTVAFGNVIVVVI 737

Query: 379 NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEK 540
            E ++     S              +++ AGL   + L+F++ +  Y P+   K
Sbjct: 738 AEAALFESQAS-------------EFFLFAGLMFADMLIFMVMAYYYVPNDPNK 778



>pir|T13674|T13674 hypothetical protein EG0002.1 - fruit fly
           (Drosophila melanogaster)>gb:DMCEG0002_1378530
           Drosophila melanogaster sequence EG0002: concatenation
           of cosmids 170B5:1-5779, 163A7:1-41145.
          Length = 734

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 31/131 (23%), Positives = 52/131 (39%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
           Q +  + +  S +SILW +PQ  +M  A    +V   +F  S+ P SM ++         
Sbjct: 570 QHNVIEVVAPSTVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSV 629

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    I E    S      T             + A L +V+ ++FL  +RSY   
Sbjct: 630 AIGNMLVVVIAEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QY 675

Query: 529 KDEKPVAMEED 561
           KD++    ++D
Sbjct: 676 KDQREDFEDDD 686



>pir|T13673|T13673 hypothetical protein EG0002.1 - fruit fly
           (Drosophila melanogaster)>gb:DMCEG0002_1378529
           Drosophila melanogaster sequence EG0002: concatenation
           of cosmids 170B5:1-5779, 163A7:1-41145.
          Length = 743

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 31/131 (23%), Positives = 52/131 (39%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
           Q +  + +  S +SILW +PQ  +M  A    +V   +F  S+ P SM ++         
Sbjct: 579 QHNVIEVVAPSTVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSV 638

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    I E    S      T             + A L +V+ ++FL  +RSY   
Sbjct: 639 AIGNMLVVVIAEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QY 684

Query: 529 KDEKPVAMEED 561
           KD++    ++D
Sbjct: 685 KDQREDFEDDD 695



>sp|P91679|OPT1_DROME Oligopeptide transporter 1 (YIN
           protein).>gb:DMU85982_1381090 Drosophila melanogaster
           oligopeptide transporter 1 (opt1) mRNA, complete cds.
          Length = 737

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 31/131 (23%), Positives = 52/131 (39%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXX 348
           Q +  + +  S +SILW +PQ  +M  A    +V   +F  S+ P SM ++         
Sbjct: 573 QHNVIEVVAPSTVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSV 632

Query: 349 XXXXXXXXXINELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPS 528
                    I E    S      T             + A L +V+ ++FL  +RSY   
Sbjct: 633 AIGNMLVVVIAEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QY 678

Query: 529 KDEKPVAMEED 561
           KD++    ++D
Sbjct: 679 KDQREDFEDDD 689



>gb:AY058467_1291621 Drosophila melanogaster GH27264 full length
           cDNA.
          Length = 358

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 30/121 (24%), Positives = 48/121 (39%)
 Frame = +1

Query: 199 SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXI 378
           S +SILW +PQ  +M  A    +V   +F  S+ P SM ++                  I
Sbjct: 204 STVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSVAIGNMLVVVI 263

Query: 379 NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEE 558
            E    S      T             + A L +V+ ++FL  +RSY   KD++    ++
Sbjct: 264 AEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QYKDQREDFEDD 309

Query: 559 D 561
           D
Sbjct: 310 D 310



>gb:AE014298_1124219 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003429_1209401 Drosophila melanogaster
           chromosome X, section 13 of 74 of the complete sequence.
          Length = 737

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 30/121 (24%), Positives = 48/121 (39%)
 Frame = +1

Query: 199 SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXI 378
           S +SILW +PQ  +M  A    +V   +F  S+ P SM ++                  I
Sbjct: 583 STVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSVAIGNMLVVVI 642

Query: 379 NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEE 558
            E    S      T             + A L +V+ ++FL  +RSY   KD++    ++
Sbjct: 643 AEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QYKDQREDFEDD 688

Query: 559 D 561
           D
Sbjct: 689 D 689



>gb:AE014298_1124218 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003429_1209400 Drosophila melanogaster
           chromosome X, section 13 of 74 of the complete sequence.
          Length = 734

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 30/121 (24%), Positives = 48/121 (39%)
 Frame = +1

Query: 199 SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXI 378
           S +SILW +PQ  +M  A    +V   +F  S+ P SM ++                  I
Sbjct: 580 STVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSVAIGNMLVVVI 639

Query: 379 NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEE 558
            E    S      T             + A L +V+ ++FL  +RSY   KD++    ++
Sbjct: 640 AEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QYKDQREDFEDD 685

Query: 559 D 561
           D
Sbjct: 686 D 686



>gb:AE014298_1124217 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003429_1209399 Drosophila melanogaster
           chromosome X, section 13 of 74 of the complete sequence.
          Length = 743

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 30/121 (24%), Positives = 48/121 (39%)
 Frame = +1

Query: 199 SKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXI 378
           S +SILW +PQ  +M  A    +V   +F  S+ P SM ++                  I
Sbjct: 589 STVSILWQLPQIVVMTAAEVMFSVTGLEFSYSQSPPSMKSVLQACWLLSVAIGNMLVVVI 648

Query: 379 NELSINSGNGSWITSDINEGHYDYFYWVLAGLSMVNFLLFLICSRSYGPSKDEKPVAMEE 558
            E    S      T             + A L +V+ ++FL  +RSY   KD++    ++
Sbjct: 649 AEFKFTSSQSGEFT-------------LFASLMLVDMMIFLWLARSY-QYKDQREDFEDD 694

Query: 559 D 561
           D
Sbjct: 695 D 695



>gb:AY289935_1942819 Macaca mulatta proton-dependent dipeptide
           transporter PEPT2 mRNA, complete cds.
          Length = 729

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 17/51 (33%), Positives = 29/51 (56%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTI 321
           Q   ++++  +KMSI W +PQYAL+       +V   +F  S+ P SM ++
Sbjct: 594 QAWKTEDIPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSV 644



>gb:AL158049_1921262 Human DNA sequence from clone RP3-482C21 on
           chromosome 6 Contains the 3' end of the gene for a novel
           protein similar to integral inner nuclear membrane
           protein (MAN1) and the 3' end of the MLN gene for
           motilin and a CpG island, complete sequence.
          Length = 283

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +2

Query: 404 MGVG*QAT*TRVTMITSTGFLLG*AWLTFSCF*FVAGLMVLLKTRNQWPWRKIEEEHES 580
           MGVG + +   +T +T+         + F C  F+ GL++LLK R    WRK+EEE ++
Sbjct: 227 MGVGCRLSRALLTAVTNV-------LIFFWCLAFLWGLLILLKYR----WRKLEEEEQA 274



>gb:AL158049_1921261 Human DNA sequence from clone RP3-482C21 on
           chromosome 6 Contains the 3' end of the gene for a novel
           protein similar to integral inner nuclear membrane
           protein (MAN1) and the 3' end of the MLN gene for
           motilin and a CpG island, complete sequence.
          Length = 500

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +2

Query: 404 MGVG*QAT*TRVTMITSTGFLLG*AWLTFSCF*FVAGLMVLLKTRNQWPWRKIEEEHES 580
           MGVG + +   +T +T+         + F C  F+ GL++LLK R    WRK+EEE ++
Sbjct: 360 MGVGCRLSRALLTAVTNV-------LIFFWCLAFLWGLLILLKYR----WRKLEEEEQA 407



>gb:YSCPTR2_1730389 Saccharomyces cerevisiae S288C permease (PTR2)
           gene, complete cds.
          Length = 601

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 29/152 (19%), Positives = 56/152 (36%), Gaps = 3/152 (1%)
 Frame = +1

Query: 91  FGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAV 270
           FG F   W AVL   V            H++ N     + + W +P Y L+  +    ++
Sbjct: 430 FGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPN----HVHVCWQIPAYVLISFSEIFASI 485

Query: 271 AQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDY 450
              ++  S+ P SM +                   ++ ++++                  
Sbjct: 486 TGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVD----------------PK 529

Query: 451 FYWVLAGLSMVNFL---LFLICSRSYGPSKDE 537
           F W+  GL++  F+   LF +C R Y  +++E
Sbjct: 530 FTWLFTGLAVACFISGCLFWLCFRKYNDTEEE 561



>gb:CQ782927_1452217 Sequence 3067 from Patent
           EP1396543.>gb:AK074959_1912802 Homo sapiens cDNA
           FLJ90478 fis, clone NT2RP3002790.>gb:AL158049_1921260
           Human DNA sequence from clone RP3-482C21 on chromosome 6
           Contains the 3' end of the gene for a novel protein
           similar to integral inner nuclear membrane protein
           (MAN1) and the 3' end of the MLN gene for motilin and a
           CpG island, complete sequence.>gb:BC051803_1984669 Homo
           sapiens LEM domain containing 2, mRNA (cDNA clone
           MGC:57747 IMAGE:5240212), complete cds.
          Length = 503

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 21/59 (35%), Positives = 33/59 (55%)
 Frame = +2

Query: 404 MGVG*QAT*TRVTMITSTGFLLG*AWLTFSCF*FVAGLMVLLKTRNQWPWRKIEEEHES 580
           MGVG + +   +T +T+         + F C  F+ GL++LLK R    WRK+EEE ++
Sbjct: 363 MGVGCRLSRALLTAVTNV-------LIFFWCLAFLWGLLILLKYR----WRKLEEEEQA 410



>sp|P32901|PTR2_YEAST Peptide transporter PTR2 (Peptide permease
           PTR2).>pir|S38171|S38171 peptide transport protein PTR2
           - yeast (Saccharomyces cerevisiae)>gb:SCDNACHXI_1707690
           S.cerevisiae DNA of chromosome XI, right
           arm.>gb:SCYKR093W_1713307 S.cerevisiae chromosome XI
           reading frame ORF YKR093w.
          Length = 601

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 29/152 (19%), Positives = 56/152 (36%), Gaps = 3/152 (1%)
 Frame = +1

Query: 91  FGIFVSFWYAVLVGKVESIRRSLAIKQEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAV 270
           FG F   W AVL   V            H++ N     + + W +P Y L+  +    ++
Sbjct: 430 FGSFAMTWAAVLQSFVYKAGPWYNEPLGHNTPN----HVHVCWQIPAYVLISFSEIFASI 485

Query: 271 AQNQFFISEFPRSMSTIXXXXXXXXXXXXXXXXXXINELSINSGNGSWITSDINEGHYDY 450
              ++  S+ P SM +                   ++ ++++                  
Sbjct: 486 TGLEYAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVD----------------PK 529

Query: 451 FYWVLAGLSMVNFL---LFLICSRSYGPSKDE 537
           F W+  GL++  F+   LF +C R Y  +++E
Sbjct: 530 FTWLFTGLAVACFISGCLFWLCFRKYNDTEEE 561



>gb:AP005878_1859539 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OSJNBb0012I09.>gb:AP005893_1859764 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0030K05.
          Length = 180

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 18/54 (33%), Positives = 28/54 (51%)
 Frame = -1

Query: 233 YCGTTHSIDILLSPRLSDECSCLIARLRRMLSTLPTRTAYQKDTKIPNPILDLV 72
           Y   + S  +L +P LS    CL    RRM+S +P  +   ++ +IP P+ D V
Sbjct: 80  YAWASSSPPLLSTPLLSPCLGCL----RRMMSAMPLSSCLHREPEIPPPLCDFV 129



>gb:AF257711_2060757 Mus musculus proton-dependent high affinity
           oligopeptide transporter (Pept2) gene, complete cds.
          Length = 729

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTI 321
           Q   ++++  +K+SI W +PQY L+  A    +V   +F  S+ P SM ++
Sbjct: 594 QAWKAEDIPANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSV 644



>gb:AF111811_2054910 Mus musculus proton-dependent high affinity
           oligopeptide transporter PepT2 mRNA, complete cds.
          Length = 740

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTI 321
           Q   ++++  +K+SI W +PQY L+  A    +V   +F  S+ P SM ++
Sbjct: 605 QAWKAEDIPANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSV 655



>pir|JC7501|JC7501 oligopeptide transporter PEPT2, kidney isoform -
           mouse
          Length = 729

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +1

Query: 169 QEHSSDNLGDSKMSILWVVPQYALMGIAVGSNAVAQNQFFISEFPRSMSTI 321
           Q   ++++  +K+SI W +PQY L+  A    +V   +F  S+ P SM ++
Sbjct: 594 QAWKAEDIPANKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSV 644


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 810,100,877
Number of Sequences: 1806583
Number of extensions: 15782064
Number of successful extensions: 43246
Number of sequences better than 10.0: 244
Number of HSP's better than 10.0 without gapping: 41910
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42881
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 53504197652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)