BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13341
         (1063 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T51484|T51484 CRS2-like protein - Arabidopsis thaliana>gb:AT...   323   4e-87   Arabidopsis thaliana [mouse-ear cress]
gb:AF225708_1778603 Zea mays CRS2 mRNA, complete cds; nuclear ge...   315   1e-84   
gb:AB011481_1511459 Arabidopsis thaliana genomic DNA, chromosome...   315   1e-84   
gb:AK118408_1816386 Arabidopsis thaliana At5g38290 mRNA for puta...   313   3e-84   
gb:AP003214_1825320 Oryza sativa (japonica cultivar-group) genom...   310   2e-83   
gb:BT011605_1641127 Arabidopsis thaliana At5g19830 mRNA, complet...   238   1e-61   
gb:BT005284_1638224 Arabidopsis thaliana At1g18440 mRNA, complet...   221   2e-56   
gb:AC152123_1745196 Genomic sequence for broccoli [Brassica oler...   221   3e-56   
gb:AP003248_1826227 Oryza sativa (japonica cultivar-group) genom...   218   2e-55   
gb:AC136492_1743220 Oryza sativa (japonica cultivar-group) chrom...   204   2e-51   
pir|C86318|C86318 protein F15H18.8 [imported] - Arabidopsis thal...   181   3e-44   Arabidopsis thaliana [mouse-ear cress]
sp|Q8R757|PTH_THETN|PTH_THETN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   157   4e-37   
sp|Q97E97|PTH_CLOAB|PTH_CLOAB Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   150   4e-35   Clostridium acetobutylicum
gb:BA000043_736623 Geobacillus kaustophilus HTA426 DNA, complete...   148   2e-34   
sp|Q899I4|PTH_CLOTE|PTH_CLOTE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   147   3e-34   Clostridium tetani
sp|Q9F8Q3|PTH_CARHY|PTH_CARHY Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   145   1e-33   Carboxydothermus hydrogenoformans
gb:AE017333_446008 Bacillus licheniformis DSM 13, complete genom...   144   3e-33   
gb:BX842653_825527 Bdellovibrio bacteriovorus complete genome, s...   143   5e-33   
sp|Q9K3T8|PTH_STRCO|PTH_STRCO Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   143   5e-33   
sp|P37470|PTH_BACSU|PTH_BACSU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH) ...   143   5e-33   Bacillus subtilis
sp|Q8XHJ8|PTH_CLOPE|PTH_CLOPE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   139   7e-32   Clostridium perfringens
gb:AE017230_411683 Mycobacterium avium subsp. paratuberculosis s...   139   1e-31   
gb:AE016998_375110 Bacillus cereus ATCC 14579 section 1 of 18 of...   138   2e-31   
gb:AE016822_340715 Leifsonia xyli subsp. xyli str. CTCB07, compl...   137   3e-31   
sp|Q8CXP8|PTH_OCEIH|PTH_OCEIH Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   137   3e-31   Oceanobacillus iheyensis
gb:AE017340_456693 Idiomarina loihiensis L2TR, complete genome.       137   4e-31   
gb:AE017264_421284 Bacillus cereus ATCC 10987, section 1 of 18 o...   137   4e-31   
sp|Q81VY9|PTH_BACAN|PTH_BACAN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   137   4e-31   Bacillus anthracis [anthrax]
gb:CP000001_850683 Bacillus cereus ZK, complete genome.               136   8e-31   
sp|Q81J96|PTH_BACCR|PTH_BACCR Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).      136   8e-31   Bacillus cereus
sp|Q82HE5|PTH_STRAW|PTH_STRAW Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   135   2e-30   Streptomyces avermitilis
sp|P96386|PTH_MYCTU|PTH_MYCTU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   135   2e-30   Mycobacterium tuberculosis
gb:AP006627_562408 Bacillus clausii KSM-K16 DNA, complete genome.     134   4e-30   
gb:AP006618_561294 Nocardia farcinica IFM 10152 DNA, complete ge...   134   4e-30   
sp|Q9KGJ3|PTH_BACHD|PTH_BACHD Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   133   5e-30   Bacillus halodurans
gb:AY142895_592078 Heliobacillus mobilis Peptidyl-tRNA hydrolase...   131   2e-29   
gb:AE016827_342185 Mannheimia succiniciproducens MBEL55E, comple...   130   6e-29   
gb:AP006840_570424 Symbiobacterium thermophilum DNA, complete ge...   129   8e-29   
gb:AE017283_430321 Propionibacterium acnes KPA171202, complete g...   128   2e-28   
sp|P44682|PTH_HAEIN|PTH_HAEIN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   127   3e-28   Haemophilus influenzae
sp|Q7NN75|PTH_GLOVI|PTH_GLOVI Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   127   4e-28   Gloeobacter violaceus
gb:CP000027_79598 Dehalococcoides ethenogenes 195, complete genome.   127   5e-28   
sp|Q9CD49|PTH_MYCLE|PTH_MYCLE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   126   6e-28   Mycobacterium leprae
sp|Q59989|PTH_SYNY3|PTH_SYNY3 Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   126   8e-28   Synechocystis sp.
gb:AP008231_580981 Synechococcus elongatus PCC 6301 DNA, complet...   125   1e-27   
sp|Q8DJ45|PTH_SYNEL|PTH_SYNEL Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   125   1e-27   Synechococcus elongatus
sp|Q8G5I6|PTH_BIFLO|PTH_BIFLO Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   123   5e-27   Bifidobacterium longum
sp|Q92N67|PTH_RHIME|PTH_RHIME Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   123   7e-27   Sinorhizobium meliloti
sp|P57820|PTH_PASMU|PTH_PASMU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   123   7e-27   Pasteurella multocida
gb:AE017314_439824 Desulfovibrio vulgaris subsp. vulgaris str. H...   122   9e-27   
gb:AE017282_427830 Methylococcus capsulatus str. Bath, complete ...   122   9e-27   
gb:AE017153_392479 Haemophilus ducreyi strain 35000HP section 3 ...   122   1e-26   
sp|Q7VMI1|PTH_HAEDU|PTH_HAEDU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).      122   1e-26   [Haemophilus] ducreyi
gb:CR555306_106172 Azoarcus sp. EbN1 complete genome.                 122   2e-26   
sp|Q7U9I5|PTH_SYNPX|PTH_SYNPX Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   122   2e-26   Synechococcus sp.
sp|Q8CQU9|PTH_STAEP|PTH_STAEP Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   122   2e-26   Staphylococcus epidermidis
sp|Q839C0|PTH_ENTFA|PTH_ENTFA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   122   2e-26   Enterococcus faecalis
gb:AE017180_398966 Geobacter sulfurreducens PCA, complete genome.     121   2e-26   
sp|O66677|PTH_AQUAE|PTH_AQUAE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   121   2e-26   Aquifex aeolicus
gb:CP000023_873983 Streptococcus thermophilus LMG 18311, complet...   120   5e-26   
sp|Q92F62|PTH_LISIN|PTH_LISIN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   120   5e-26   
sp|Q88Z39|PTH_LACPL|PTH_LACPL Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   120   6e-26   Lactobacillus plantarum
gb:AE017322_442662 Listeria monocytogenes str. 4b F2365, section...   119   8e-26   
sp|Q82TQ6|PTH_NITEU|PTH_NITEU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   119   8e-26   Nitrosomonas europaea
sp|Q8YAD1|PTH_LISMO|PTH_LISMO Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   119   8e-26   
gb:STU31571_193777 Salmonella typhi peptidyl-tRNA hydrolase (pth...   119   1e-25   
sp|O85235|PTH_LACSK|PTH_LACSK Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   119   1e-25   Lactobacillus sakei
pir|C97627|C97627 stage v sporulation protein c (peptidyl-tRNA h...   119   1e-25   Agrobacterium fabrum str. C58
sp|Q8UD97|PTH_AGRT5|PTH_AGRT5 Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   119   1e-25   Agrobacterium tumefaciens
sp|Q99WA1|PTH_STAAM|PTH_STAAM Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   118   2e-25   Staphylococcus aureus
pir|AI0720|AI0720 aminoacyl-tRNA hydrolase (EC 3.1.1.29) - Salmo...   117   3e-25   Salmonella enterica subsp. enterica serovar Typhi
sp|Q60001|PTH_SALTY|PTH_SALTY Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).      117   3e-25   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q7MXK9|PTH_PORGI|PTH_PORGI Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   117   4e-25   Porphyromonas gingivalis
sp|Q9RRW3|PTH_DEIRA|PTH_DEIRA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   117   4e-25   Deinococcus radiodurans
sp|Q8YYK4|PTH_ANASP|PTH_ANASP Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   117   4e-25   Anabaena sp.
sp|Q7UKV0|PTH_RHOBA|PTH_RHOBA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   117   5e-25   Rhodopirellula baltica
sp|Q888C8|PTH_PSESM|PTH_PSESM Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   117   5e-25   Pseudomonas syringae pv. tomato
sp|Q8FQV6|PTH_COREF|PTH_COREF Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   117   5e-25   Corynebacterium efficiens
gb:AE017201_403648 Lactobacillus johnsonii NCC 533, section 2 of...   116   7e-25   
gb:CP000031_84862 Silicibacter pomeroyi DSS-3, complete genome.       116   7e-25   
gb:CP000033_88580 Lactobacillus acidophilus NCFM, complete genome.    116   9e-25   
gb:AE017305_436858 Thermus thermophilus HB27 section 5 of 7 of t...   115   1e-24   
gb:BX897699_827786 Bartonella henselae strain Houston-1, complet...   115   2e-24   
gb:CR543861_104724 Acinetobacter sp. ADP1 complete genome.            115   2e-24   
sp|Q8NRV3|PTH1_CORGL|PTH1_CORGL Peptidyl-tRNA hydrolase 1 (EC 3.1.1.29) (PT...   115   2e-24   Corynebacterium glutamicum
gb:BX897700_828569 Bartonella quintana str. Toulouse, complete g...   114   3e-24   
sp|Q8E7Y8|PTH_STRA3|PTH_STRA3 Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   114   3e-24   
gb:BA000037_721751 Vibrio vulnificus YJ016 DNA, chromosome I, co...   114   4e-24   
gb:AE016797_335047 Vibrio vulnificus CMCP6 chromosome I section ...   114   4e-24   
sp|Q8DFF4|PTH_VIBVU|PTH_VIBVU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   114   4e-24   Vibrio vulnificus
sp|Q87RN9|PTH_VIBPA|PTH_VIBPA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   114   4e-24   
sp|Q8DRQ2|PTH_STRR6|PTH_STRR6 Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   114   4e-24   Streptococcus pneumoniae
sp|Q83LE1|PTH_SHIFL|PTH_SHIFL Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   114   4e-24   Shigella flexneri
sp|Q7M7U8|PTH_WOLSU|PTH_WOLSU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   113   6e-24   Wolinella succinogenes
sp|Q97TD1|PTH_STRPN|PTH_STRPN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   113   6e-24   
sp|Q98HV6|PTH_RHILO|PTH_RHILO Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   113   6e-24   Mesorhizobium loti
sp|Q8RIJ5|PTH_FUSNN|PTH_FUSNN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   113   6e-24   Fusobacterium nucleatum subsp. nucleatum
sp|Q8YIG4|PTH_BRUME|PTH_BRUME Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   113   6e-24   
sp|Q9AEQ5|PTH_BRUAB|PTH_BRUAB Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   113   6e-24   Brucella abortus bv. 1
gb:AE004969_60152 Neisseria gonorrhoeae FA 1090, complete genome.     113   7e-24   
sp|P23932|PTH_ECOLI|PTH_ECOLI Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   113   7e-24   Escherichia coli [E. coli]
gb:CR378672_96194 Photobacterium profundum SS9; segment 10/12.        112   2e-23   
sp|Q9KQ21|PTH_VIBCH|PTH_VIBCH Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   112   2e-23   
sp|Q83AP0|PTH_COXBU|PTH_COXBU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   112   2e-23   Coxiella burnetii
sp|Q9X1W1|PTH_THEMA|PTH_THEMA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   111   2e-23   Thermotoga maritima
sp|Q9K029|PTH_NEIMB|PTH_NEIMB Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   111   2e-23   Neisseria meningitidis serogroup B
sp|Q9JV42|PTH_NEIMA|PTH_NEIMA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   111   2e-23   
gb:CP000010_867220 Burkholderia mallei ATCC 23344 chromosome 1, ...   111   3e-23   
gb:BX950851_840923 Erwinia carotovora subsp. atroseptica SCRI104...   111   3e-23   
gb:BX248356_762184 Corynebacterium diphtheriae gravis NCTC13129,...   111   3e-23   
gb:AJ749949_531137 Francisella tularensis subsp. tularensis comp...   111   3e-23   
sp|P47329|PTH_MYCGE|PTH_MYCGE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   111   3e-23   Mycoplasma genitalium
gb:CP000003_859930 Streptococcus pyogenes MGAS10394, complete ge...   110   4e-23   
sp|Q8P327|PTH_STRP8|PTH_STRP8 Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   110   4e-23   Streptococcus pyogenes serotype M18
sp|Q9HVC3|PTH_PSEAE|PTH_PSEAE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   110   5e-23   Pseudomonas aeruginosa
sp|Q7V4V4|PTH_PROMM|PTH_PROMM Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   110   5e-23   Prochlorococcus marinus
sp|Q8EHN5|PTH_SHEON|PTH_SHEON Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   110   6e-23   Shewanella oneidensis
sp|Q7NQT1|PTH_CHRVO|PTH_CHRVO Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   110   6e-23   Chromobacterium violaceum
sp|Q9A206|PTH_STRPY|PTH_STRPY Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   109   8e-23   Streptococcus pyogenes
sp|Q8K8Z7|PTH_STRP3|PTH_STRP3 Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   109   8e-23   Streptococcus pyogenes serotype M3
sp|Q8F3Q2|PTH_LEPIN|PTH_LEPIN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   109   1e-22   
gb:BX571965_790297 Burkholderia pseudomallei strain K96243, chro...   108   1e-22   
sp|Q8KD05|PTH_CHLTE|PTH_CHLTE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   108   1e-22   Chlorobaculum tepidum
gb:AP006841_571723 Bacteroides fragilis YCH46 DNA, complete genome.   108   2e-22   
gb:AL646059_545321 Ralstonia solanacearum GMI1000 chromosome, co...   108   2e-22   
sp|Q8Y2E3|PTH_RALSO|PTH_RALSO Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).      108   2e-22   Ralstonia solanacearum
sp|Q88PX8|PTH_PSEPK|PTH_PSEPK Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   108   2e-22   Pseudomonas putida
gb:BX927150_832520 Corynebacterium glutamicum ATCC 13032, IS fin...   107   4e-22   
gb:AE017263_420629 Mesoplasma florum L1 complete genome.              107   4e-22   
sp|Q8DWN5|PTH_STRMU|PTH_STRMU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   107   4e-22   Streptococcus mutans serotype C
sp|Q8NRV6|PTH2_CORGL|PTH2_CORGL Peptidyl-tRNA hydrolase 2 (EC 3.1.1.29) (PT...   107   4e-22   Corynebacterium glutamicum
gb:BX248356_762181 Corynebacterium diphtheriae gravis NCTC13129,...   107   5e-22   
sp|Q7VDT7|PTH_PROMA|PTH_PROMA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   107   5e-22   Prochlorococcus marinus
gb:AE017197_402563 Rickettsia typhi str. Wilmington complete gen...   106   7e-22   
sp|Q9CJI1|PTH_LACLA|PTH_LACLA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   106   7e-22   Lactococcus lactis subsp. lactis
gb:AE013832_300598 Yersinia pestis KIM section 232 of 415 of the...   106   9e-22   
sp|Q8ZEY4|PTH_YERPE|PTH_YERPE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   106   9e-22   Yersinia pestis
sp|Q7N5A1|PTH_PHOLL|PTH_PHOLL Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   106   9e-22   Photorhabdus laumondii subsp. laumondii
sp|Q8EWQ8|PTH_MYCPE|PTH_MYCPE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   106   9e-22   Mycoplasma penetrans
sp|Q89YZ2|PTH_BACTN|PTH_BACTN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   106   9e-22   Bacteroides thetaiotaomicron
gb:AP006628_566587 Onion yellows phytoplasma OY-M DNA, complete ...   105   2e-21   
gb:CR925677_117344 Ehrlichia ruminantium str. Gardel, complete g...   105   2e-21   
sp|Q9ZCV4|PTH_RICPR|PTH_RICPR Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   105   2e-21   Rickettsia prowazekii
gb:BX572607_803968 Rhodopseudomonas palustris CGA009 complete ge...   104   3e-21   
gb:CR925678_118298 Ehrlichia ruminantium str. Welgevonden, compl...   104   3e-21   
gb:CR767821_116438 Ehrlichia ruminantium strain Welgevonden, com...   104   3e-21   
gb:BA000035_715789 Corynebacterium efficiens YS-314 DNA, complet...   103   8e-21   
gb:AE016969_369935 Mycoplasma gallisepticum strain R section 3 o...   103   8e-21   
sp|Q8RLD7|PTH_MYCGA|PTH_MYCGA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   103   8e-21   
gb:BX640420_807518 Bordetella pertussis strain Tohama I, complet...   102   1e-20   
sp|Q7VUH3|PTH_BORPE|PTH_BORPE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).      102   1e-20   Bordetella pertussis
gb:CR628336_112823 Legionella pneumophila str. Paris complete ge...   102   1e-20   
sp|O84806|PTH_CHLTR|PTH_CHLTR Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   102   1e-20   Chlamydia trachomatis
sp|Q89DJ9|PTH_BRAJA|PTH_BRAJA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   102   1e-20   Bradyrhizobium japonicum
sp|Q7WNY2|PTH_BORBR|PTH_BORBR Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   102   1e-20   Bordetella bronchiseptica
gb:AE011537_274055 Leptospira interrogans serovar lai str. 56601...   102   2e-20   
gb:AE017308_438165 Mycoplasma mobile 163K complete genome.            101   3e-20   
gb:CR628337_115783 Legionella pneumophila str. Lens complete gen...   101   3e-20   
sp|P78034|PTH_MYCPN|PTH_MYCPN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   101   3e-20   Mycoplasma pneumoniae
gb:AF533231_519878 Western X phytoplasma tRNA-Ser gene, complete...   100   4e-20   
gb:AE017354_460997 Legionella pneumophila subsp. pneumophila str...   100   4e-20   
sp|Q9PR67|PTH_UREPA|PTH_UREPA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   100   4e-20   Ureaplasma parvum serovar 3
sp|Q92H41|PTH_RICCN|PTH_RICCN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....   100   6e-20   Rickettsia conorii
gb:CP000030_84057 Anaplasma marginale str. St. Maries, complete ...   100   8e-20   
gb:BC047012_1983769 Homo sapiens chromosome 9 open reading frame...    99   1e-19   
gb:AX418200_1468152 Sequence 1 from Patent WO0200859.                  99   1e-19   
sp|Q7VG29|PTH_HELHP|PTH_HELHP Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    99   2e-19   Helicobacter hepaticus
sp|Q8K9V3|PTH_BUCAP|PTH_BUCAP Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    98   2e-19   
gb:CP000013_870014 Borrelia garinii PBi, complete genome.              98   3e-19   
gb:AE008692_241649 Zymomonas mobilis subsp. mobilis ZM4, complet...    98   3e-19   
sp|P47714|PTH_BORBU|PTH_BORBU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    98   3e-19   Borreliella burgdorferi
sp|Q83FR1|PTH_TROWT|PTH_TROWT Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    97   7e-19   Tropheryma whipplei
sp|Q83HD8|PTH_TROW8|PTH_TROW8 Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    97   7e-19   Tropheryma whipplei
sp|Q9PA78|PTH_XYLFA|PTH_XYLFA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    96   1e-18   Xylella fastidiosa
sp|Q8PNT8|PTH_XANAC|PTH_XANAC Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    96   1e-18   Xanthomonas citri
gb:CP000009_863153 Gluconobacter oxydans 621H, complete genome.        95   2e-18   
gb:AE013598_297302 Xanthomonas oryzae pv. oryzae KACC10331, comp...    95   2e-18   
sp|Q87A24|PTH_XYLFT|PTH_XYLFT Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    95   2e-18   Xylella fastidiosa
sp|Q9Z6V6|PTH_CHLPN|PTH_CHLPN Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    95   2e-18   Chlamydia pneumoniae
gb:AK075833_1171043 Mus musculus adult male stomach cDNA, RIKEN ...    95   3e-18   
sp|P57287|PTH_BUCAI|PTH_BUCAI Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    95   3e-18   
sp|Q821W6|PTH_CHLCV|PTH_CHLCV Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    94   4e-18   Chlamydia caviae
sp|Q8PC61|PTH_XANCP|PTH_XANCP Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    94   5e-18   Xanthomonas campestris pv. campestris
gb:AE017256_417977 Wolbachia endosymbiont of Drosophila melanoga...    94   6e-18   
sp|O83975|PTH_TREPA|PTH_TREPA Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    94   6e-18   Treponema pallidum
gb:AE017321_441729 Wolbachia endosymbiont strain TRS of Brugia m...    93   1e-17   
gb:AE017248_415695 Treponema denticola ATCC 35405, section 3 of ...    93   1e-17   
gb:CP000020_870939 Vibrio fischeri ES114 chromosome I, complete ...    92   1e-17   
sp|P56077|PTH_HELPY|PTH_HELPY Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    92   2e-17   Helicobacter pylori
sp|Q98PE2|PTH_MYCPU|PTH_MYCPU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    92   2e-17   Mycoplasma pulmonis
gb:BX842645_822947 Mycoplasma mycoides subsp. mycoides SC genomi...    91   3e-17   
sp|Q9AAV9|PTH_CAUCR|PTH_CAUCR Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    91   3e-17   Caulobacter vibrioides
gb:BX248585_763956 Blochmannia floridanus complete genome; segme...    91   5e-17   
sp|Q9ZJC3|PTH_HELPJ|PTH_HELPJ Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    91   5e-17   Helicobacter pylori
sp|P49607|PTH_CHLMU|PTH_CHLMU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    90   9e-17   Chlamydia muridarum [agent of mouse pneumonitis]
sp|Q9PII7|PTH_CAMJE|PTH_CAMJE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    89   2e-16   
sp|P59490|PTH_BUCBP|PTH_BUCBP Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    89   2e-16   
gb:CP000025_878129 Campylobacter jejuni RM1221, complete genome.       87   4e-16   
gb:CTU31570_119670 Chlamydia muridarum peptidyl-tRNA hydrolase (...    87   4e-16   
sp|Q7V342|PTH_PROMP|PTH_PROMP Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    87   6e-16   Prochlorococcus marinus subsp. pastoris [high-light adapted Prochlorococcus]
gb:CR522870_101577 Desulfotalea psychrophila LSv54 chromosome.         85   3e-15   
sp|Q8D2K4|PTH_WIGBR|PTH_WIGBR Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    85   3e-15   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
gb:BX908798_831149 Parachlamydia-related symbiont UWE25, complet...    83   8e-15   
gb:AE017332_445437 Mycoplasma hyopneumoniae 232, complete genome.      83   8e-15   
gb:AC137000_1743330 Oryza sativa (japonica cultivar-group) chrom...    82   2e-14   
sp|P38876|PTH_YEAST|PTH_YEAST Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)....    77   6e-13   Saccharomyces cerevisiae [brewer's yeast]
gb:AF244656_492194 Carboxydothermus hydrogenoformans peptidyl-tR...    70   9e-11   
gb:MGU02185_143677 Mycoplasma genitalium random genomic clone sf...    67   6e-10   
gb:CR382134_1667324 Debaryomyces hansenii chromosome B of strain...    66   1e-09   
gb:CHTHSPORF_846282 Chlamydia muridarum putative heat shock prot...    65   3e-09   
pir|C37840|C37840 hypothetical protein (S18 5' region) - Chlamyd...    65   3e-09   Chlamydia muridarum [agent of mouse pneumonitis]
gb:CR380959_1653957 Candida glabrata strain CBS138 chromosome M ...    62   1e-08   
gb:AE016819_1749280 Ashbya gossypii (= Eremothecium gossypii) AT...    58   3e-07   
sp|O74806|PTH_SCHPO|PTH_SCHPO Putative peptidyl-tRNA hydrolase (EC 3.1.1.2...    57   8e-07   Schizosaccharomyces pombe
gb:CR382134_1667124 Debaryomyces hansenii chromosome B of strain...    55   2e-06   
gb:CR382123_1655745 Kluyveromyces lactis strain NRRL Y-1140 chro...    53   9e-06   
gb:AX972822_1488131 Sequence 3625 from Patent EP1104808.               51   3e-05   
gb:NCB14A6_1689294 Neurospora crassa DNA linkage group V BAC con...    49   2e-04   
gb:AP005869_1859336 Oryza sativa (japonica cultivar-group) genom...    39   0.18    
sp|P59573|SYGB_BUCBP|SYGB_BUCBP Glycyl-tRNA synthetase beta chain (EC 6.1.1...    36   1.5     
gb:AP005290_1849959 Oryza sativa (japonica cultivar-group) genom...    35   2.0     
gb:AB125167_1873844 Macaca fascicularis FCMD mRNA for Fukuyama t...    35   2.6     
gb:AB008226_1864081 Homo sapiens FCMD mRNA for fukutin, complete...    35   2.6     
gb:AP003488_1829888 Oryza sativa (japonica cultivar-group) genom...    35   2.6     
sp|O75072|FCMD_HUMAN|FCMD_HUMAN Fukutin (EC 2.-.-.-) (Fukuyama-type congeni...    35   2.6     Homo sapiens [man]
gb:AP004267_1839446 Oryza sativa (japonica cultivar-group) genom...    35   3.3     
gb:AY071243_1295327 Drosophila melanogaster RE28421 full length ...    34   4.4     
gb:AC125735_1208090 Leishmania major strain Friedlin chromosome ...    34   4.4     
gb:AE013599_1131787 Drosophila melanogaster chromosome 2R, compl...    34   4.4     
gb:BC017538_2092485 Mus musculus Fukuyama type congenital muscul...    34   5.7     
sp|Q8R507|FCMD_MOUSE|FCMD_MOUSE Fukutin (EC 2.-.-.-).>gb:AK085931_1174623 M...    34   5.7     Mus musculus [mouse]
gb:AE016789_333502 Pseudomonas putida KT2440 section 16 of 21 of...    33   7.4     
gb:BA000030_703421 Streptomyces avermitilis MA-4680 genomic DNA,...    33   9.7     


>pir|T51484|T51484 CRS2-like protein - Arabidopsis
           thaliana>gb:ATT21H19_1555115 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T21H19 (ESSA
           project).>gb:BT010650_1640596 Arabidopsis thaliana
           At5g16140 mRNA, complete cds.>gb:AK175292_1817280
           Arabidopsis thaliana mRNA for CRS2-like protein,
           complete cds, clone: RAFL21-73-B17.
          Length = 240

 Score =  323 bits (828), Expect = 4e-87
 Identities = 153/215 (71%), Positives = 186/215 (86%)
 Frame = -1

Query: 733 RIRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQ 554
           R+ +S S  E +  KVEYTPWL+ GLGNPGNKYHGTRHNVGFEMID ++++EG+L+NTIQ
Sbjct: 26  RVCSSTSGGEDDRFKVEYTPWLIVGLGNPGNKYHGTRHNVGFEMIDVLARKEGVLMNTIQ 85

Query: 553 SKALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLR 374
           SKALIGIG+I +VP++LAKPQTYMNFSGESVG LA++Y+VPLRHIL+++DEM+LPNGVLR
Sbjct: 86  SKALIGIGAIEDVPILLAKPQTYMNFSGESVGSLASHYRVPLRHILMIYDEMALPNGVLR 145

Query: 373 LKPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDE 194
           L+PK G G+HNGVKSVM HLDG   FPRL IGIG PPG MDMKAFLLQKFS  E+KQ++E
Sbjct: 146 LQPKGGQGYHNGVKSVMGHLDGRRNFPRLSIGIGKPPGNMDMKAFLLQKFSPLEQKQIEE 205

Query: 193 ALKEGAEAVRTLVREGVGSRLSRFNIGQKYKYHKV 89
           AL++G+EAV+TLV  G    +SRFN+ QKYK+HKV
Sbjct: 206 ALEQGSEAVKTLVLNGFNQGISRFNLVQKYKFHKV 240



>gb:AF225708_1778603 Zea mays CRS2 mRNA, complete cds; nuclear gene
           for chloroplast product.
          Length = 256

 Score =  315 bits (807), Expect = 1e-84
 Identities = 152/238 (63%), Positives = 188/238 (78%)
 Frame = -1

Query: 802 PAKSCMVPYPRCPCSHPRHLAPVRIRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTR 623
           P KS   P  R     PR    V     +S+P+P    VEYTPWL+AGLGNPGNKY+GTR
Sbjct: 26  PRKSLTAPLHRI--RRPRPFTVV-----SSVPDPAAGPVEYTPWLIAGLGNPGNKYYGTR 78

Query: 622 HNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAY 443
           HNVGFEM+D+I+ EEGI +NTIQSK+L+GIGSIGEVPV++ KPQ+YMN+SGE++G LAAY
Sbjct: 79  HNVGFEMVDRIAAEEGITMNTIQSKSLLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAY 138

Query: 442 YQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPP 263
           YQVPLRHILL++D+ SLPNGVLRL+ K GHG HNG+++V+EHLDG  +FPRL IGIG+PP
Sbjct: 139 YQVPLRHILLIYDDTSLPNGVLRLQKKGGHGRHNGLQNVIEHLDGRREFPRLSIGIGSPP 198

Query: 262 GAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRLSRFNIGQKYKYHKV 89
           G MD +AFLLQKFS  ER Q+D AL++G +AVRTLV +G      RFN+ QKYK+H+V
Sbjct: 199 GKMDPRAFLLQKFSSEERVQIDTALEQGVDAVRTLVLKGFSGSTERFNLVQKYKFHRV 256



>gb:AB011481_1511459 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSI17.
          Length = 246

 Score =  315 bits (806), Expect = 1e-84
 Identities = 146/214 (68%), Positives = 176/214 (82%)
 Frame = -1

Query: 730 IRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS 551
           +RAS  + +    K EYTPWL+ GLGNPG KY+GTRHN+GFEMID I++   I +NTIQS
Sbjct: 33  LRASLPVSDNKLLKFEYTPWLIVGLGNPGLKYYGTRHNIGFEMIDHIARATDISMNTIQS 92

Query: 550 KALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRL 371
           KAL+GIGS+GEVP++L KPQ YMNFSGESVG LAAYYQ+PLRHIL+++D+M L NGVLRL
Sbjct: 93  KALVGIGSVGEVPILLVKPQGYMNFSGESVGPLAAYYQIPLRHILMIYDDMGLSNGVLRL 152

Query: 370 KPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEA 191
           +PK GH  HNG+K+V EHL+GC  +PRL IGIGNPPG MDMKAFLLQKFS  ERKQ+DE 
Sbjct: 153 QPKGGHSQHNGLKNVTEHLNGCRGYPRLSIGIGNPPGNMDMKAFLLQKFSPLERKQMDEG 212

Query: 190 LKEGAEAVRTLVREGVGSRLSRFNIGQKYKYHKV 89
           L++G E V+TLV EG    +SRFN+GQKYK+HKV
Sbjct: 213 LEQGVEGVKTLVEEGFSDSISRFNLGQKYKFHKV 246



>gb:AK118408_1816386 Arabidopsis thaliana At5g38290 mRNA for
           putative CRS2, complete cds, clone: RAFL19-66-F04.
          Length = 246

 Score =  313 bits (803), Expect = 3e-84
 Identities = 145/214 (67%), Positives = 176/214 (82%)
 Frame = -1

Query: 730 IRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS 551
           +RAS  + +    K EYTPWL+ GLGNPG KY+GTRHN+GFEMID I++   I +NTIQS
Sbjct: 33  LRASLPVSDNKLLKFEYTPWLIVGLGNPGLKYYGTRHNIGFEMIDHIARATDISMNTIQS 92

Query: 550 KALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRL 371
           KAL+GIGS+GEVP++L KPQ YMNFSGESVG LAAYYQ+PLRHIL+++D++ L NGVLRL
Sbjct: 93  KALVGIGSVGEVPILLVKPQGYMNFSGESVGPLAAYYQIPLRHILMIYDDLGLSNGVLRL 152

Query: 370 KPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEA 191
           +PK GH  HNG+K+V EHL+GC  +PRL IGIGNPPG MDMKAFLLQKFS  ERKQ+DE 
Sbjct: 153 QPKGGHSQHNGLKNVTEHLNGCRGYPRLSIGIGNPPGNMDMKAFLLQKFSPLERKQMDEG 212

Query: 190 LKEGAEAVRTLVREGVGSRLSRFNIGQKYKYHKV 89
           L++G E V+TLV EG    +SRFN+GQKYK+HKV
Sbjct: 213 LEQGVEGVKTLVEEGFSDSISRFNLGQKYKFHKV 246



>gb:AP003214_1825320 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0083M16.
          Length = 259

 Score =  310 bits (795), Expect = 2e-83
 Identities = 144/215 (66%), Positives = 180/215 (83%)
 Frame = -1

Query: 733 RIRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQ 554
           RI   AS+P+P     EYTPWL+AGLGNPG+KYHGTRHNVGFEM+D+I+++EGI +NTIQ
Sbjct: 45  RIAVVASVPDPAARPAEYTPWLIAGLGNPGSKYHGTRHNVGFEMVDRIARDEGITMNTIQ 104

Query: 553 SKALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLR 374
           SK+L+GIGSIGEVPV+L KPQ+Y+N+SGE++G LAAYYQVPLRHIL+++DEMSLPNGVLR
Sbjct: 105 SKSLLGIGSIGEVPVLLVKPQSYINYSGEAIGPLAAYYQVPLRHILVMYDEMSLPNGVLR 164

Query: 373 LKPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDE 194
           L+ K GHG HNG+++VME LD   + PRL IGIG+PPG MD +AFLLQKFS  ER Q+D 
Sbjct: 165 LQRKGGHGRHNGLQNVMECLDSSRELPRLSIGIGSPPGKMDTRAFLLQKFSSEERLQIDT 224

Query: 193 ALKEGAEAVRTLVREGVGSRLSRFNIGQKYKYHKV 89
           AL++G +AVRTLV +G    + RFN+ QKYK+H V
Sbjct: 225 ALEQGVDAVRTLVLKGFSGSIERFNLVQKYKFHSV 259



>gb:BT011605_1641127 Arabidopsis thaliana At5g19830 mRNA, complete
           cds.>gb:BT012252_1641458 Arabidopsis thaliana At5g19830
           gene, complete cds.
          Length = 219

 Score =  238 bits (608), Expect = 1e-61
 Identities = 113/197 (57%), Positives = 146/197 (74%)
 Frame = -1

Query: 682 YTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVL 503
           + PWL  GLGNPG+KY GTRHN+GFEMID  ++  GI +N +  KA++G G + ++PV+L
Sbjct: 16  HRPWLFLGLGNPGDKYKGTRHNIGFEMIDVFAESVGIQMNLVNFKAIMGQGFVADLPVIL 75

Query: 502 AKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVM 323
           AKPQTYMN SGES G LAAYY++PL  +L+VHD+M LP GVLRL+ K GHG HNG+KSVM
Sbjct: 76  AKPQTYMNLSGESSGPLAAYYKLPLNRVLVVHDDMQLPCGVLRLQEKGGHGCHNGLKSVM 135

Query: 322 EHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGV 143
            H  G  +F RL IGIG PPG MD KAFLLQKFS   R+++D+AL EG +A++ ++ +  
Sbjct: 136 NHFRGNREFARLRIGIGKPPGQMDPKAFLLQKFSMPARERMDKALAEGVDALKLVLAKDF 195

Query: 142 GSRLSRFNIGQKYKYHK 92
           G     FN+ QKYK+ K
Sbjct: 196 GESWRLFNVEQKYKHLK 212



>gb:BT005284_1638224 Arabidopsis thaliana At1g18440 mRNA, complete
           cds.>gb:AK119054_1816999 Arabidopsis thaliana At1g18440
           mRNA for unknown protein, complete cds, clone:
           RAFL21-39-I07.
          Length = 288

 Score =  221 bits (563), Expect = 2e-56
 Identities = 97/177 (54%), Positives = 135/177 (76%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAK 497
           PWL+ GLGNPG KY GTRHNVGFEM+D ++  EGI +NT+  KAL G G IG +P++LAK
Sbjct: 94  PWLIVGLGNPGKKYQGTRHNVGFEMVDALADAEGISMNTVNFKALFGKGVIGNIPIMLAK 153

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQT+M+ SGESVGQ+ ++Y++PL+ +L+V+D++ LP G LRL PK GHG HNG++S+++ 
Sbjct: 154 PQTFMDLSGESVGQIVSFYKIPLKQVLVVYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDR 213

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
           L G   FPRL IGIG PPG MD   F+L++F+  E++++D   + G EA+R L+ EG
Sbjct: 214 LKGSRDFPRLRIGIGRPPGKMDTANFVLRQFNRQEQEELDHTFQTGLEAIRILLLEG 270



>gb:AC152123_1745196 Genomic sequence for broccoli [Brassica
           oleracea L. (Italica group)] BAC clone B21F5, complete
           sequence.
          Length = 291

 Score =  221 bits (562), Expect = 3e-56
 Identities = 104/232 (44%), Positives = 150/232 (64%)
 Frame = -1

Query: 841 SPSTFMSMLYSLSPAKSCMVPYPRCPCSHPRHLAPVRIRASASLPEPNGAKVEYTPWLVA 662
           S   F S+  S S      +P  + P   P+   P                    PWL+ 
Sbjct: 60  SSQLFSSLSNSFSSQSESELPQVQLPSPKPKSPPP------------------QLPWLIV 101

Query: 661 GLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTYM 482
           GLGNPG KY GTRHNVGFEM+D +++ EGI +NT+  KAL G G IG +P++LAKPQT+M
Sbjct: 102 GLGNPGKKYQGTRHNVGFEMVDALAEAEGISMNTVNFKALFGKGVIGNIPIMLAKPQTFM 161

Query: 481 NFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDGCH 302
           N SGESVGQ+ ++Y++PL+ +L+++D++ LP G LRL PK GHG HNG++S+++ L G  
Sbjct: 162 NASGESVGQIVSFYKIPLKQVLVIYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDRLKGSR 221

Query: 301 QFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
            FPRL IGIG PPG MD   ++L++F++ E++++D   + G EA+R ++ EG
Sbjct: 222 DFPRLRIGIGRPPGKMDTANYVLRQFNKQEQEELDYTFQTGLEAIRIMLLEG 273



>gb:AP003248_1826227 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0431H09.
          Length = 250

 Score =  218 bits (555), Expect = 2e-55
 Identities = 117/260 (45%), Positives = 157/260 (60%)
 Frame = -1

Query: 889 REIRGFRDDRLPCRPCSPSTFMSMLYSLSPAKSCMVPYPRCPCSHPRHLAPVRIRASASL 710
           R + G    R+PC           L SL+ A++  +P P          A     AS+S 
Sbjct: 2   RLLSGASASRIPCP----------LLSLARARARCLPVPAS--------ATACRAASSSA 43

Query: 709 PEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIG 530
               G      PWL  GLGNPG  Y GTRHNVGFEMID I++ EGI L+++Q KA++G G
Sbjct: 44  AAAAGDGGALKPWLFVGLGNPGKVYQGTRHNVGFEMIDVIAEAEGISLSSMQFKAMVGKG 103

Query: 529 SIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHG 350
            IG+ P++LAKPQT+MN SGESVGQL +Y+++PL  +L+++D++ LP   LRL PK GHG
Sbjct: 104 RIGDAPIMLAKPQTFMNASGESVGQLVSYFKIPLNQVLVMYDDLDLPFAKLRLLPKGGHG 163

Query: 349 HHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEA 170
            HNGV+S++ HL     FPRL IGIG PPG MD   F+L+ F+  E++++D A   G EA
Sbjct: 164 GHNGVRSIINHLKQNRDFPRLRIGIGRPPGKMDPANFVLRPFNRKEQEELDFAFHRGLEA 223

Query: 169 VRTLVREGVGSRLSRFNIGQ 110
           VR +  EG     +  N  Q
Sbjct: 224 VRIMALEGFNKSATYVNTAQ 243



>gb:AC136492_1743220 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0554F08, complete sequence.
          Length = 235

 Score =  204 bits (519), Expect = 2e-51
 Identities = 97/205 (47%), Positives = 140/205 (68%)
 Frame = -1

Query: 724 ASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKA 545
           ASA+    +G      PWL+ GLGNPG  Y GTRHNVGFEMID I++ EGI +++ Q K+
Sbjct: 24  ASAAAAAGDGGGGAQKPWLLIGLGNPGRMYKGTRHNVGFEMIDAIAEAEGISVSSKQFKS 83

Query: 544 LIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKP 365
           ++G G IG+VPV+LAKPQTYMN SGESV QL +Y+++PL  +L+++D++ +P   LRL P
Sbjct: 84  MVGKGLIGDVPVMLAKPQTYMNASGESVAQLVSYFKIPLSQVLVIYDDLDIPFAKLRLLP 143

Query: 364 KRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALK 185
           K GHG HNG++S++ HL     FPRL IGIG P G +D   F+L+ F++ E+++++  + 
Sbjct: 144 KGGHGGHNGMRSIINHLKQSRDFPRLRIGIGRPTGKLDAIGFVLRSFTKEEQEELNLTIN 203

Query: 184 EGAEAVRTLVREGVGSRLSRFNIGQ 110
              +AVR ++ EG     +  N  Q
Sbjct: 204 RSLQAVRIMLLEGFNKGATFVNTPQ 228



>pir|C86318|C86318 protein F15H18.8 [imported] - Arabidopsis
           thaliana>gb:AE005172_890805 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC013354_1537896 Genomic sequence for
           Arabidopsis thaliana BAC F15H18 from chromosome I,
           complete sequence.
          Length = 777

 Score =  181 bits (458), Expect = 3e-44
 Identities = 85/166 (51%), Positives = 112/166 (67%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAK 497
           PWL+ GLGNPG KY GTRHNVGFEM+D ++  EGI +NT+  KAL G G IG +P++LAK
Sbjct: 94  PWLIVGLGNPGKKYQGTRHNVGFEMVDALADAEGISMNTVNFKALFGKGVIGNIPIMLAK 153

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQT+MN SGES                 V+D++ LP G LRL PK GHG HNG++S+++ 
Sbjct: 154 PQTFMNLSGES-----------------VYDDLDLPFGKLRLLPKGGHGGHNGMRSIIDR 196

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEG 179
           L G   FPRL IGIG PPG MD   F+L++F+  E++++D   + G
Sbjct: 197 LKGSRDFPRLRIGIGRPPGKMDTANFVLRQFNRQEQEELDHTFQTG 242



>sp|Q8R757|PTH_THETN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE013197_290116 Thermoanaerobacter
           tengcongensis MB4, section 224 of 244 of the complete
           genome.>gb:AE008691_1112181 Thermoanaerobacter
           tengcongensis strain MB4, complete genome.
          Length = 185

 Score =  157 bits (396), Expect = 4e-37
 Identities = 77/185 (41%), Positives = 124/185 (67%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +++AGLGNPG +Y GTRHNVGF +ID +S++ GI ++ ++ K+L+G G      V+L KP
Sbjct: 2   YIIAGLGNPGKEYEGTRHNVGFMVIDALSKKLGIEVSRLKFKSLMGEGHFKGEKVILLKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QT+MN SGE++     +Y++PL ++++V+D+  L  G +R++ K   G HNG+ S++ +L
Sbjct: 62  QTFMNLSGEALYDAVNFYKIPLENVIVVYDDKDLEVGKIRIRRKGSSGGHNGMNSII-YL 120

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
                FPR+ IGIG P    D+   +L +FS+ E+K +DEA++  AEAV  ++  G+   
Sbjct: 121 LNSEDFPRVRIGIGKPEDG-DLVRHVLGRFSDEEKKVIDEAVERAAEAVIDIMENGIEHA 179

Query: 133 LSRFN 119
           +SRFN
Sbjct: 180 MSRFN 184



>sp|Q97E97|PTH_CLOAB Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|F97295|F97295 stage V sporulation protein C,
           peptidyl-tRNA hydrolase [imported] - Clostridium
           acetobutylicum>gb:AE007817_230514 Clostridium
           acetobutylicum ATCC 824 section 305 of 356 of the
           complete genome.>gb:AE001437_1093469 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 187

 Score =  150 bits (379), Expect = 4e-35
 Identities = 76/185 (41%), Positives = 121/185 (65%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +L+ GLGNPG KY  TRHN+GF+ I+ I+ +  I ++    K L G G I    V+L KP
Sbjct: 2   FLIVGLGNPGLKYEHTRHNMGFDAIENIAAKHNISIDKKGFKGLYGKGIIDGEKVILLKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SGESV + A YY++   +I++++D++SL  G +R++ K   G HNG+K+++ HL
Sbjct: 62  YTYMNLSGESVVEAANYYKINKENIVVIYDDISLDVGKIRIRTKGSAGGHNGIKNIVLHL 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               +FPR+ +G+G P    ++  ++L KFS+ ERK+++E L    EAV  +V +GV + 
Sbjct: 122 SS-EEFPRVKVGVGEP--TENLVNYVLGKFSQDERKKIEEVLNIVTEAVECMVVDGVQNA 178

Query: 133 LSRFN 119
           +++FN
Sbjct: 179 MNKFN 183



>gb:BA000043_736623 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 186

 Score =  148 bits (374), Expect = 2e-34
 Identities = 75/184 (40%), Positives = 111/184 (60%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L  GLGNPG +Y  TRHNVGF +ID++++   + L T + + L G  S+    V L KP 
Sbjct: 3   LFVGLGNPGKEYEQTRHNVGFFVIDELAKRWNVSLKTAKFRGLFGTASVSGEKVALCKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGE V  L  YY + +  +++++D++ LP G +RL+ K   G HNGVKS++ HL 
Sbjct: 63  TYMNLSGECVRPLMDYYDIAIDDVIVIYDDLDLPPGKIRLRLKGSSGGHNGVKSLIHHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  QF R+ IGIG P G   +  ++L +F+E E+  VD+A+   A+A    V+      +
Sbjct: 122 GTEQFKRIRIGIGRPAGGQPVTDYVLGRFTEEEKPAVDKAVLRAADACEQAVKAPFIQVM 181

Query: 130 SRFN 119
           + FN
Sbjct: 182 NDFN 185



>sp|Q899I4|PTH_CLOTE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE015936_319404 Clostridium tetani E88,
           section 1 of 10 of the complete
           genome.>gb:AE015927_962193 Clostridium tetani E88,
           complete genome.
          Length = 188

 Score =  147 bits (372), Expect = 3e-34
 Identities = 72/185 (38%), Positives = 117/185 (63%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +L+ GLGNPG +Y  TRHN+GFE +D+IS E  I +   + K + G G I    V+L KP
Sbjct: 2   FLLVGLGNPGKEYEKTRHNIGFEAVDKISYEYNIPIKRERFKGVFGDGRISNEKVILLKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SGES+ ++  YY +P+ ++++++D++ L  G LR++ K   G HNG+KS++ +L
Sbjct: 62  TTYMNLSGESLREIIEYYNIPITNVIVIYDDVDLEVGRLRIRTKGSAGGHNGIKSIIYNL 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
           +    F RL IG+G P    DM + +L KF++ + K ++E LK   E   T++ +G    
Sbjct: 122 NS-EDFIRLRIGVGKP--QRDMVSHVLGKFAKEDEKNIEEVLKIIPELAYTIINQGPQEA 178

Query: 133 LSRFN 119
           ++++N
Sbjct: 179 MNKYN 183



>sp|Q9F8Q3|PTH_CARHY Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AF244580_492118 Carboxydothermus
           hydrogenoformans peptidyl-tRNA hydrolase gene, complete
           cds.
          Length = 186

 Score =  145 bits (367), Expect = 1e-33
 Identities = 74/182 (40%), Positives = 117/182 (64%)
 Frame = -1

Query: 658 LGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTYMN 479
           +GNPG +Y  TRHN GF ++D+++++ GIL+   + K+L+G G I  V V+L KPQTYMN
Sbjct: 6   IGNPGQEYENTRHNAGFMVVDELAKKHGILITKRKFKSLVGEGEILGVKVLLLKPQTYMN 65

Query: 478 FSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDGCHQ 299
            SG +V +  ++Y++PL  +++V+D++ LP G + L+ K   G H G+ S++  L G  +
Sbjct: 66  LSGTAVQEAVSFYKLPLSRLVVVYDDLDLPLGKICLRLKGSAGGHRGMGSIISCL-GSEE 124

Query: 298 FPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRLSRFN 119
            PRL IGIG  P   D+K ++LQ F+  ER+ ++  LK  AEA+   + EG    ++ FN
Sbjct: 125 IPRLKIGIGR-PAVGDVKDYVLQPFTGAEREILEPTLKLAAEAITVALTEGFNKAMTDFN 183

Query: 118 IG 113
            G
Sbjct: 184 RG 185



>gb:AE017333_446008 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_855830 Bacillus licheniformis ATCC
           14580, complete genome.>gb:AX930132_1483846 Sequence 88
           from Patent WO03087148.
          Length = 188

 Score =  144 bits (363), Expect = 3e-33
 Identities = 72/182 (39%), Positives = 111/182 (60%)
 Frame = -1

Query: 664 AGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTY 485
           AGLGNPG  Y  TRHNVGF  ID++S+E  I L+  +     GIG +    V+L KP TY
Sbjct: 5   AGLGNPGKTYENTRHNVGFMTIDELSKEWNIPLDKTKFNGQYGIGFVSGKKVLLVKPLTY 64

Query: 484 MNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDGC 305
           MN SGE +  L  YY++P+ ++ +++D++ LP G +RL+ K   G HNG+KS ++HL G 
Sbjct: 65  MNLSGECLRPLLDYYEIPVDNLKVIYDDLDLPTGRIRLRTKGSAGGHNGIKSTIQHL-GT 123

Query: 304 HQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRLSR 125
            +F R+ IGIG P   M +  ++L  F++ E   + EA+++ A+A    + +     ++ 
Sbjct: 124 SEFNRIRIGIGRPVNGMKVVDYVLGAFTDEEEPAIKEAVRQSAKACEASLEKPFLEVMNE 183

Query: 124 FN 119
           FN
Sbjct: 184 FN 185



>gb:BX842653_825527 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 8/11.
          Length = 187

 Score =  143 bits (361), Expect = 5e-33
 Identities = 71/186 (38%), Positives = 113/186 (60%), Gaps = 1/186 (0%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           WL+ GLGNPG +Y  TRHN+GF  +D + +  G      Q KA I    I + PV+  KP
Sbjct: 2   WLIVGLGNPGGEYKLTRHNIGFMAVDFLMEGLGNPPIKNQFKAEIAQAKIKDHPVIFCKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QTYMN SGESV  L  +Y++PL  ++++HDE+  P   ++++  RGHG HNG+KS+   L
Sbjct: 62  QTYMNLSGESVQPLMGFYKIPLERLIVIHDEIDQPFAQMKIQKNRGHGGHNGIKSI-SGL 120

Query: 313 DGCHQFPRLCIGIGNPPGA-MDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
            G   + RL +G+G P    + +  ++L KF++ E  Q+ + L +  +AV +++ +G+  
Sbjct: 121 MGSMDYTRLRLGVGRPANPNIPVPDYVLGKFTKEEFAQMPDFLNKAGDAVESIILDGIQK 180

Query: 136 RLSRFN 119
             ++FN
Sbjct: 181 ASTKFN 186



>sp|Q9K3T8|PTH_STRCO Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:SCO939115_176798 Streptomyces coelicolor A3(2)
           complete genome; segment 12/29.
          Length = 200

 Score =  143 bits (361), Expect = 5e-33
 Identities = 82/192 (42%), Positives = 115/192 (59%), Gaps = 6/192 (3%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTI-QSKALIGIGSIGEVP---- 512
           PWLVAGLGNPG +Y   RHNVGF + D +++  G       +++A +  G IG       
Sbjct: 10  PWLVAGLGNPGPEYASNRHNVGFMVADLLAERIGARFKRHGKAQAQVVEGRIGPPGPANR 69

Query: 511 -VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGV 335
            V+LAKP ++MN SG  V  L  +Y+VP+ +I+ VHDE+ +  GVLRLK   G   HNG+
Sbjct: 70  RVILAKPMSFMNVSGGPVTALRDFYKVPVGNIVAVHDELDIDYGVLRLKLGGGDNGHNGL 129

Query: 334 KSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLV 155
           KS+ + L     + R+  GIG PPG M +  F+L+ FS TERK++D  +   A+AV  LV
Sbjct: 130 KSITKSLGA--DYHRVRFGIGRPPGRMPVADFVLRDFSSTERKELDYFVDRAADAVEALV 187

Query: 154 REGVGSRLSRFN 119
            EG+    S +N
Sbjct: 188 IEGLERAQSAYN 199



>sp|P37470|PTH_BACSU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH)
           (Stage V sporulation protein C).>pir|C69715|C69715 stage
           V sporulation protein spoVC - Bacillus
           subtilis>gb:BAC180K_744672 B. subtilis DNA, 180 kilobase
           region of replication origin.>gb:BSUB0001_752018
           Bacillus subtilis complete genome (section 1 of 21):
           from 1 to 213080.
          Length = 188

 Score =  143 bits (361), Expect = 5e-33
 Identities = 72/184 (39%), Positives = 111/184 (60%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++AGLGNPG  Y  TRHNVGF +IDQ+++E  I LN  +   L G G +    V+L KP 
Sbjct: 3   VIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGLYGTGFVSGKKVLLVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGE +  L  YY V    + +++D++ LP G +RL+ K   G HNG+KS+++HL 
Sbjct: 63  TYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRTKGSAGGHNGIKSLIQHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  +F R+ IGIG P   M +  ++L  F++ E  +++EA+ +  +A    + +     +
Sbjct: 122 GTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVDKSVKACEASLSKPFLEVM 181

Query: 130 SRFN 119
           + FN
Sbjct: 182 NEFN 185



>sp|Q8XHJ8|PTH_CLOPE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000016_675525 Clostridium perfringens str.
           13 DNA, complete genome.
          Length = 188

 Score =  139 bits (351), Expect = 7e-32
 Identities = 69/184 (37%), Positives = 120/184 (65%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y  TRHN+GF++ID ++ +  I +N  + K + G G I    V+L KP 
Sbjct: 3   LIVGLGNPGKQYEQTRHNIGFDVIDYMANKYNIDVNREKFKGICGEGFIENKKVILLKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGES+ +LA +Y++    I++V+D++SL  G LR++ K   G HNG+KS++++L 
Sbjct: 63  TYMNLSGESIRELANFYKLEDDEIIVVYDDISLDIGRLRIREKGSAGGHNGIKSIIQNLG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  +FPR+ +G+G P    ++   +L KFS+ +R+ +++ +   ++A+  +V+      +
Sbjct: 123 G-DKFPRVKVGVGQPKD--NLVNHVLGKFSKEDREHIEKVIPVVSDAIVEIVKNDAKESM 179

Query: 130 SRFN 119
           ++FN
Sbjct: 180 NKFN 183



>gb:AE017230_411683 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 4 of 16 of the complete
           genome.>gb:AE016958_1055087 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 191

 Score =  139 bits (350), Expect = 1e-31
 Identities = 79/179 (44%), Positives = 105/179 (58%), Gaps = 1/179 (0%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQ-SKALIGIGSIGEVPVVLA 500
           P LV GLGNPG+ Y  TRHNVGF + D ++   G      + S A I  G +    VV+A
Sbjct: 4   PLLVVGLGNPGDNYARTRHNVGFMVADLLAARMGSKFKAHKRSGAEIVSGRLAGRSVVVA 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP+ YMN SG  VG LA +Y VP   I+++HD++ L  G +RLK   G G HNG++SV  
Sbjct: 64  KPRCYMNESGRQVGPLAKFYSVPPGDIIVIHDDLDLDFGRIRLKIGGGEGGHNGLRSVAN 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGV 143
            L G   F R+ IGIG PPG  D  AF+L+ F+ TER  V    ++ A+A   L+  G+
Sbjct: 124 AL-GSKDFQRVRIGIGRPPGRKDPAAFVLENFTSTERADVPTICEQAADATELLIELGL 181



>gb:AE016998_375110 Bacillus cereus ATCC 14579 section 1 of 18 of
           the complete genome.>gb:AE016877_1015360 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 210

 Score =  138 bits (347), Expect = 2e-31
 Identities = 72/204 (35%), Positives = 119/204 (58%)
 Frame = -1

Query: 730 IRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS 551
           +R   S  E +G +++    L+ GLGNPG +Y  TRHN+GF  ID++++   I LN  + 
Sbjct: 11  LRLFVSKKESSGTRMK----LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKF 66

Query: 550 KALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRL 371
           K + G G +    V+L KP TYMN SGES+  L  YY++ +   ++++D++ +P G LRL
Sbjct: 67  KGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVMYDDLDIPVGKLRL 126

Query: 370 KPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEA 191
           + K   G HNGVKS + HL G  +F R+ +GI  P   M +  ++L +F+  E   V+ +
Sbjct: 127 RMKGSAGGHNGVKSTISHL-GTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHS 185

Query: 190 LKEGAEAVRTLVREGVGSRLSRFN 119
           +++ A+A    + +     ++ FN
Sbjct: 186 IEKAADACEEWLNKPFLQIMNTFN 209



>gb:AE016822_340715 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 193

 Score =  137 bits (346), Expect = 3e-31
 Identities = 75/189 (39%), Positives = 109/189 (57%), Gaps = 2/189 (1%)
 Frame = -1

Query: 679 TPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSI--GEVPVV 506
           T WLV GLGNPG  Y  TRHNVG  ++D+++  + +   T ++ A +  G I  G    V
Sbjct: 3   TLWLVVGLGNPGPGYAATRHNVGQLVLDELASRDRLSFKTHKTNATVAEGRIVPGGPRFV 62

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           LAKP TYMN SG  V QL  +Y +    +++V DE+ +P   LRLK   GHG HNGV+ V
Sbjct: 63  LAKPNTYMNGSGGPVSQLLRFYSLEPSRLIVVQDELDIPFDTLRLKFGGGHGGHNGVRDV 122

Query: 325 MEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
           +  + G   F R+ +G+G PPG       +L+ FS  ERK +   + + A+AV  +  EG
Sbjct: 123 IAEV-GSGDFTRVRVGVGRPPGVQAAADHVLKGFSAAERKNLPILVADAADAVERIAAEG 181

Query: 145 VGSRLSRFN 119
           + +  +RF+
Sbjct: 182 LTAAQNRFH 190



>sp|Q8CXP8|PTH_OCEIH Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000028_694448 Oceanobacillus iheyensis
           HTE831 DNA, complete genome.
          Length = 187

 Score =  137 bits (346), Expect = 3e-31
 Identities = 66/173 (38%), Positives = 107/173 (61%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG K+  TRHN+GF +ID++ Q     LN  + +    I       V+L +PQ
Sbjct: 3   LIVGLGNPGRKFKKTRHNIGFFVIDELLQRHKWKLNNSKFEGDYSIEHFDGEKVILLQPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG+S+  L  Y+ + +  +++V+D++ LP G +RL+ K GHG HNGV+S ++HL 
Sbjct: 63  TYMNLSGKSISPLMDYFDIDVDDVIVVYDDLDLPTGKIRLRQKGGHGGHNGVRSTIDHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
           G   F R+ +GIG P  A  +  ++L KF + E   V +++++ A+A+   ++
Sbjct: 122 GTKDFKRVRLGIGRPTNATPVIDYVLGKFPKQETTAVTDSVEKAADAIEAWIK 174



>gb:AE017340_456693 Idiomarina loihiensis L2TR, complete genome.
          Length = 198

 Score =  137 bits (345), Expect = 4e-31
 Identities = 74/185 (40%), Positives = 108/185 (58%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNT-IQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG +Y  TRHN GF ++D   +   I L+   +SKALIG    G   + +  P
Sbjct: 7   LLVGLGNPGPEYERTRHNAGFWLVDDFCRRHAITLSPDTKSKALIGRWQQGAHDLRIVLP 66

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           Q +MN SG SV  LA +Y++P   IL+ +DE+ LP GV + K   G G HNG+K ++   
Sbjct: 67  QNFMNRSGFSVAALANFYKIPANEILVAYDELDLPPGVAKFKKGGGAGGHNGIKDIIAQ- 125

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G   F RL IGIG+P     +  F+L K S  E++ +D+ + E + ++ TL+ EG G+ 
Sbjct: 126 TGSQDFMRLRIGIGHPGDKTKVTGFVLGKASANEQRLIDDCIDEASRSIDTLMAEGWGTA 185

Query: 133 LSRFN 119
           L R +
Sbjct: 186 LQRLH 190



>gb:AE017264_421284 Bacillus cereus ATCC 10987, section 1 of 18 of
           the complete genome.>gb:AE017194_1059703 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 210

 Score =  137 bits (345), Expect = 4e-31
 Identities = 72/204 (35%), Positives = 119/204 (58%)
 Frame = -1

Query: 730 IRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS 551
           +R   S  E +G +++    L+ GLGNPG +Y  TRHN+GF  ID++++   I LN  + 
Sbjct: 11  LRLFVSKKESSGTRMK----LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKF 66

Query: 550 KALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRL 371
           K + G G +    V+L KP TYMN SGES+  L  YY++ +   ++++D++ +P G LRL
Sbjct: 67  KGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRL 126

Query: 370 KPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEA 191
           + K   G HNGVKS + HL G  +F R+ +GI  P   M +  ++L +F+  E   V+ +
Sbjct: 127 RMKGSAGGHNGVKSTISHL-GTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPGVNHS 185

Query: 190 LKEGAEAVRTLVREGVGSRLSRFN 119
           +++ A+A    + +     ++ FN
Sbjct: 186 IEKAADACEEWLNKPFLQIMNTFN 209



>sp|Q81VY9|PTH_BACAN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE017024_380347 Bacillus anthracis str. Ames
           section 1 of 18 of the complete
           genome.>gb:AE017225_405464 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017334_450196 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE017355_461380 Bacillus thuringiensis
           serovar konkukian str. 97-27, complete
           genome.>gb:AE016879_1010052 Bacillus anthracis str. Ames
           complete genome.
          Length = 186

 Score =  137 bits (345), Expect = 4e-31
 Identities = 69/184 (37%), Positives = 110/184 (59%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y  TRHN+GF  ID++++   I LN  + K L G G +    V+L KP 
Sbjct: 3   LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGLFGAGFVNGEKVILLKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGES+  L  YY++ +   ++++D++ +P G LRL+ K   G HNGVKS + HL 
Sbjct: 63  TYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  +F R+ +GI  P   M +  ++L +F+  E   V+ ++++ A+A    + +     +
Sbjct: 122 GTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNKPFLQIM 181

Query: 130 SRFN 119
           + FN
Sbjct: 182 NTFN 185



>gb:CP000001_850683 Bacillus cereus ZK, complete genome.
          Length = 186

 Score =  136 bits (342), Expect = 8e-31
 Identities = 68/184 (36%), Positives = 110/184 (59%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y  TRHN+GF  ID++++   I LN  + K + G G +    V+L KP 
Sbjct: 3   LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGES+  L  YY++ +   ++++D++ +P G LRL+ K   G HNGVKS + HL 
Sbjct: 63  TYMNLSGESIRPLMDYYKIDVEDFVVLYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  +F R+ +GI  P   M +  ++L +F+  E   V+ ++++ A+A    + +     +
Sbjct: 122 GTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNKPFLQIM 181

Query: 130 SRFN 119
           + FN
Sbjct: 182 NTFN 185



>sp|Q81J96|PTH_BACCR Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).
          Length = 186

 Score =  136 bits (342), Expect = 8e-31
 Identities = 68/184 (36%), Positives = 110/184 (59%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y  TRHN+GF  ID++++   I LN  + K + G G +    V+L KP 
Sbjct: 3   LIVGLGNPGREYELTRHNIGFMAIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGES+  L  YY++ +   ++++D++ +P G LRL+ K   G HNGVKS + HL 
Sbjct: 63  TYMNLSGESIRPLMDYYKIDVEDFVVMYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  +F R+ +GI  P   M +  ++L +F+  E   V+ ++++ A+A    + +     +
Sbjct: 122 GTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEIPDVNHSIEKAADACEEWLNKPFLQIM 181

Query: 130 SRFN 119
           + FN
Sbjct: 182 NTFN 185



>sp|Q82HE5|PTH_STRAW Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000030_701451 Streptomyces avermitilis
           MA-4680 genomic DNA, complete genome.
          Length = 203

 Score =  135 bits (339), Expect = 2e-30
 Identities = 76/192 (39%), Positives = 111/192 (57%), Gaps = 6/192 (3%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTI-QSKALIGIGSIGEVP---- 512
           PWL+ GLGNPG +Y   RHNVGF + D +++  G       +++A +  G IG       
Sbjct: 13  PWLIVGLGNPGPEYARNRHNVGFMVADLLAERIGGKFKRAGKAQAQVIEGRIGPPGPANR 72

Query: 511 -VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGV 335
            V+LAKP +YMN SG  V  L  +Y+VP+ +I+ VHDE+ +  GVLRLK   G   HNG+
Sbjct: 73  RVILAKPMSYMNLSGGPVNALREFYKVPVANIVAVHDELDIDYGVLRLKLGGGDNGHNGL 132

Query: 334 KSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLV 155
           KS+ + +     + R+  GIG PPG M +  F+L+ F+  ERK++D  +   A+A   LV
Sbjct: 133 KSMTKAMG--PDYHRVRFGIGRPPGRMQVADFVLKDFASAERKELDYLVDRAADAAECLV 190

Query: 154 REGVGSRLSRFN 119
            EG+      +N
Sbjct: 191 IEGLERAQGTYN 202



>sp|P96386|PTH_MYCTU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|A70622|A70622 probable peptidyl-trna
           hydrolase - Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_21065 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248337_758397
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 4/14.>gb:BX842575_819070 Mycobacterium
           tuberculosis H37Rv complete genome; segment 4/13.
          Length = 191

 Score =  135 bits (339), Expect = 2e-30
 Identities = 74/179 (41%), Positives = 105/179 (58%), Gaps = 1/179 (0%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQ-SKALIGIGSIGEVPVVLA 500
           P LV GLGNPG  Y  TRHN+GF + D ++   G      + S A +  G      +VLA
Sbjct: 4   PLLVVGLGNPGANYARTRHNLGFVVADLLAARLGAKFKAHKRSGAEVATGRSAGRSLVLA 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP+ YMN SG  +G LA +Y V   +I+++HD++ L  G +RLK   G G HNG++SV+ 
Sbjct: 64  KPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLEFGRIRLKIGGGEGGHNGLRSVVA 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGV 143
            L G   F R+ IGIG PPG  D  AF+L+ F+  ER +V    ++ A+A   L+ +G+
Sbjct: 124 AL-GTKDFQRVRIGIGRPPGRKDPAAFVLENFTPAERAEVPTICEQAADATELLIEQGM 181



>gb:AP006627_562408 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 185

 Score =  134 bits (336), Expect = 4e-30
 Identities = 69/184 (37%), Positives = 111/184 (60%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           LV GLGNPG KY  TRHN+GF++ID+ +Q+  + L+  + KA+ G   IG   VVL KP 
Sbjct: 3   LVVGLGNPGKKYEHTRHNIGFDIIDRCAQKLDLPLDKQKFKAIYGEKRIGSEKVVLLKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGE+V     Y+ +    +++++D++ LP G +RL+ K   G HNG+KS++ HL 
Sbjct: 63  TYMNLSGEAVRPFMDYFNISNDELVVIYDDLDLPVGKIRLRKKGSAGGHNGIKSLIAHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G   F R+ +GIG P     +  ++L  + + E   ++EA ++ A+A+   + +     +
Sbjct: 122 GTEDFNRIRVGIGRPAHGEPVVHYVLDTYRKEELAFMNEAAEKSAKAIEAWLEKPFLEVM 181

Query: 130 SRFN 119
           + FN
Sbjct: 182 NTFN 185



>gb:AP006618_561294 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 193

 Score =  134 bits (336), Expect = 4e-30
 Identities = 74/179 (41%), Positives = 108/179 (60%), Gaps = 1/179 (0%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQ-SKALIGIGSIGEVPVVLA 500
           P LV GLGNPG++Y  TRHNVGF + D +++  G      + S A +    +    V++A
Sbjct: 8   PALVVGLGNPGSEYERTRHNVGFLVADVLAERVGDRFAVHKKSGADLLQARLDGRQVLIA 67

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP++YMN SG  V  LA ++ VP   +++VHDE+ LP G +RLK   G G HNG++S+  
Sbjct: 68  KPRSYMNLSGRPVAALARFFSVPPTEVIVVHDELDLPFGAVRLKRGGGEGGHNGLRSISS 127

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGV 143
            L     + R  IGIG PPG  D   F+L+ F+  ERK+V   +++ A+AV  L+R G+
Sbjct: 128 ALT-TKDYLRTRIGIGRPPGRQDPADFVLKPFAAAERKEVPVIVEQAADAVELLLRVGL 185



>sp|Q9KGJ3|PTH_BACHD Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|D83658|D83658 stage V sporulation protein C
           (peptidyl-tRNA hydrolase) spoVC [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_654014 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 185

 Score =  133 bits (335), Expect = 5e-30
 Identities = 67/184 (36%), Positives = 106/184 (57%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG KY GTRHNVGF+++D +++   I +   ++  L G G I    + L KPQ
Sbjct: 3   LIVGLGNPGAKYDGTRHNVGFDVVDAVARRLNIEIKQSKANGLYGEGRIDGEKIFLLKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SGESV     YY + +  +L+++D++ LP G +RL+ K   G HNG+KS++ HL 
Sbjct: 63  TFMNRSGESVRPFLEYYNMEVEDLLVIYDDLDLPVGKIRLRQKGSAGGHNGMKSLIAHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G   F R+ +G+  P     +   +L ++   E+  + EA+   AEA     ++     +
Sbjct: 122 GTSDFKRIRVGVDRPAPGETVVQHVLGRYRPEEKDAISEAIDLSAEAAEAFTKKPFLEVM 181

Query: 130 SRFN 119
           + FN
Sbjct: 182 NTFN 185



>gb:AY142895_592078 Heliobacillus mobilis Peptidyl-tRNA hydrolase
           gene, partial cds.
          Length = 190

 Score =  131 bits (330), Expect = 2e-29
 Identities = 69/187 (36%), Positives = 107/187 (57%)
 Frame = -1

Query: 667 VAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQT 488
           + GLGNPG  Y  TRHN+GF ++DQ+++  G      + +       +G   V L KPQT
Sbjct: 4   IVGLGNPGRDYEKTRHNIGFMVVDQLAERWGHDGFKAKFQGSFSEVRLGGQKVFLLKPQT 63

Query: 487 YMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDG 308
           YMN SG++   +AA+Y++    IL+V+D++ LP G LR + K   G HNG+KS++  L G
Sbjct: 64  YMNLSGQAASAMAAFYKLAPEDILVVYDDLDLPPGKLRGRTKGSSGGHNGIKSLIACL-G 122

Query: 307 CHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRLS 128
              FPRL +GIG P       +++L+ F   E   + +A+    +AV   +  G+   ++
Sbjct: 123 SENFPRLKLGIGRPASRQPSASYVLESFRAEELADIQKAIDLACDAVELWLERGMIEVMN 182

Query: 127 RFNIGQK 107
           RFN G+K
Sbjct: 183 RFNGGEK 189



>gb:AE016827_342185 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 194

 Score =  130 bits (326), Expect = 6e-29
 Identities = 69/185 (37%), Positives = 106/185 (57%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGI-LLNTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG+KY  TRHN G  +++++++     L +  +         IG   V    P
Sbjct: 6   LIVGLGNPGDKYADTRHNAGEWLVERLARRFNFNLKDEAKFFGKTARAVIGGEEVRFLIP 65

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG++VG LA +Y++    IL++HDE+ LP GV ++K   GHG HNG+K  +  L
Sbjct: 66  TTFMNLSGKAVGALATFYRIKPEEILVIHDELDLPPGVAKIKQGGGHGGHNGLKDTIAQL 125

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
                F RL IGIG+P     + A++L K S  +R  +D+AL E A  +  L+++G+   
Sbjct: 126 ANNKNFYRLRIGIGHPGDKNLVSAYVLSKPSPIDRSAIDKALDEAASCMEILLKDGITKA 185

Query: 133 LSRFN 119
            +R N
Sbjct: 186 TNRLN 190



>gb:AP006840_570424 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 189

 Score =  129 bits (325), Expect = 8e-29
 Identities = 74/187 (39%), Positives = 108/187 (57%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGI---GSIGEVPVVLA 500
           L+ GLGNPG +Y  TRHN G+ ++D  +++ G+ +     + L G    G+  E  V+L 
Sbjct: 4   LIVGLGNPGPRYAATRHNAGWMLLDAFARKHGVAIEQRGFEGLYGELRWGAEAE-KVILL 62

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP TYMN SG SV Q A +Y++    IL++ D++ L  G LRL+ K   G HNGVKSV+ 
Sbjct: 63  KPLTYMNLSGRSVAQAARFYRIAPADILVLFDDLDLEPGRLRLRAKGSAGGHNGVKSVIA 122

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L G  +FPRL IGIG P    ++  ++L  F   +   V  AL    EAV   + EG+ 
Sbjct: 123 EL-GTAEFPRLRIGIGRPAPGWEVIDWVLAPFGPDDAAAVAAALPRAVEAVECFLTEGIL 181

Query: 139 SRLSRFN 119
           + ++R+N
Sbjct: 182 AAMNRYN 188



>gb:AE017283_430321 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 200

 Score =  128 bits (322), Expect = 2e-28
 Identities = 70/196 (35%), Positives = 114/196 (58%), Gaps = 11/196 (5%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGI-----------LLNTIQSKALIGIGS 527
           WLV GLGNPG +Y GTRHNVG ++I ++ +  G            L+ T  S A +G+ +
Sbjct: 5   WLVIGLGNPGPRYDGTRHNVGADVIAELCRRAGEKLSPARGQRAELVRTRLSSAGLGVPA 64

Query: 526 IGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGH 347
           +    V+L + +TYMN SG +V ++A++  +   H+++VHDE+ L  G LRLK   G   
Sbjct: 65  VDAQTVILMRSRTYMNESGIAVSKVASFAGITPDHLIVVHDEIDLDPGRLRLKKGGGDNG 124

Query: 346 HNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
           HNG+KS+  HL     F R+ +G+G PPG  D   ++L +    +R ++   +   A+AV
Sbjct: 125 HNGLKSIRAHL-RTGDFIRVRLGVGRPPGHQDPADWVLARVPARQRAEMGVQVALAADAV 183

Query: 166 RTLVREGVGSRLSRFN 119
            +++ +G+ +  +RFN
Sbjct: 184 ESIIIQGLAAAQNRFN 199



>sp|P44682|PTH_HAEIN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|C64065|C64065 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) - Haemophilus influenzae (strain Rd
           KW20)>gb:U32723_204066 Haemophilus influenzae Rd KW20
           section 38 of 163 of the complete
           genome.>gb:L42023_1096615 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 194

 Score =  127 bits (320), Expect = 3e-28
 Identities = 72/187 (38%), Positives = 111/187 (59%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS--IGEVPVVLAK 497
           L+ GLGNPG+KY  TRHN G  +I+++++   + LN  +SK         +    V L  
Sbjct: 6   LIVGLGNPGDKYTDTRHNAGEWLIERLARRFNVSLNP-ESKFFGKTARTLVNGKEVRLLV 64

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG++VG LA++Y++    IL++HDE+ LP G  +LK   GHG HNG+K ++  
Sbjct: 65  PTTFMNLSGKAVGALASFYRIKPEEILVIHDELDLPPGTAKLKQGGGHGGHNGLKDIVAQ 124

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKA-FLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
           L   + F RL IGIG+ PG  D+ A ++L K S  +R  +++ L E  + V  + R+G+ 
Sbjct: 125 LGNNNNFYRLRIGIGH-PGHRDLVAGYVLNKPSPADRDALEKVLDEATDCVEMIFRDGMV 183

Query: 139 SRLSRFN 119
              +R N
Sbjct: 184 KATNRLN 190



>sp|Q7NN75|PTH_GLOVI Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000045_740613 Gloeobacter violaceus PCC 7421
           DNA, complete genome.
          Length = 198

 Score =  127 bits (319), Expect = 4e-28
 Identities = 70/185 (37%), Positives = 113/185 (61%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQE-EGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           L  GLGNPG +Y  TRHN GF  +D +++  +   +   + K  +  G+      +L KP
Sbjct: 5   LFVGLGNPGLQYTQTRHNAGFLAVDALAKRWQCSWVEKSRFKGYLAEGAGPGGRAILLKP 64

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG+SV  +A Y+++P + +L+++DE++LP G +RL+P+     HNG+KS++EHL
Sbjct: 65  TTYMNHSGQSVRAVADYFRLPPQQLLVLYDEVALPLGKIRLRPEGSAAGHNGIKSLIEHL 124

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G +QF RL IGIG  P    +  ++L KF+  E++Q+   L    EAV  ++ +G+   
Sbjct: 125 -GTNQFARLRIGIGREPPPPVLTNYVLGKFAPEEQEQLPAILDGCVEAVEAVLAKGLEKA 183

Query: 133 LSRFN 119
           +S +N
Sbjct: 184 MSIYN 188



>gb:CP000027_79598 Dehalococcoides ethenogenes 195, complete genome.
          Length = 189

 Score =  127 bits (318), Expect = 5e-28
 Identities = 69/187 (36%), Positives = 108/187 (57%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y G RHNVGF+ + + +++  I  +     +  G G I +  +VLAKPQ
Sbjct: 3   LIIGLGNPGKEYSGNRHNVGFQCLSRFAKDNHISFDKKCCLSRTGSGRINDEEIVLAKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG++  QL   Y +    I++V D++ LP G +RL+     G HNG+ S++  + 
Sbjct: 63  TYMNLSGKAASQLLRRYNLKAADIIVVQDDLDLPAGKIRLRLGGSAGGHNGISSIITDI- 121

Query: 310 GCHQFPRLCIGIGNPP---GAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
           G  +F RL IGIG P       ++   +L  F   ER+ +D+A+   +EA+  L+  G+ 
Sbjct: 122 GTKEFIRLKIGIGKPDSRNNGTEVVDHVLGNFGGEEREIMDKAITRASEALTCLLTFGLD 181

Query: 139 SRLSRFN 119
           +  +RFN
Sbjct: 182 TASNRFN 188



>sp|Q9CD49|PTH_MYCLE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|D86939|D86939 probable peptidyl-tRNA
           hydrolase [imported] - Mycobacterium
           leprae>gb:MLEPRTN1_145846 Mycobacterium leprae strain TN
           complete genome; segment 1/10.
          Length = 199

 Score =  126 bits (317), Expect = 6e-28
 Identities = 79/191 (41%), Positives = 106/191 (55%), Gaps = 1/191 (0%)
 Frame = -1

Query: 712 LPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQ-SKALIG 536
           + EP  A   Y P LV GLGNPG  Y  TRHNVGF + + ++   G      + S A + 
Sbjct: 1   MAEPTLASGWY-PRLVVGLGNPGKNYGRTRHNVGFMVANLLAVRLGSKFEVHKRSGADVV 59

Query: 535 IGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRG 356
            G +    +++AKP+ YMN SG+ VG LA  Y V    I++VHD++ L  G +RLK   G
Sbjct: 60  NGRLAGCSMLVAKPRNYMNESGQQVGLLAKLYSVTPADIIIVHDDLDLDFGRIRLKLGGG 119

Query: 355 HGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGA 176
            G HNG++SV   L G   F R+ IGIG P G  D  +F+L+ F+  ER QV    K  A
Sbjct: 120 EGGHNGLRSVAAAL-GTKDFQRVRIGIGRPTGRKDPASFVLENFTTAERMQVPTICKRAA 178

Query: 175 EAVRTLVREGV 143
           +A   LV  G+
Sbjct: 179 DATELLVGLGL 189



>sp|Q59989|PTH_SYNY3 Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|S75738|S75738 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) - Synechocystis sp.  (strain PCC
           6803)>gb:BA000022_689862 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 194

 Score =  126 bits (316), Expect = 8e-28
 Identities = 71/187 (37%), Positives = 109/187 (58%), Gaps = 1/187 (0%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQE-EGILLNTIQSKALIGIGSIGEVPVVLA 500
           P L+ GLGNP  KY  TRHN+GF ++D ++   +    +  + +   G G +      L 
Sbjct: 3   PKLIVGLGNPEPKYDQTRHNIGFAVVDALAITWQCSWYDHKRFQGWFGEGLMAGQKTCLL 62

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP+TYMN SG++V  +  +Y++  + +L+V+D+M LP G LRL+     G HNG+KS++ 
Sbjct: 63  KPRTYMNRSGQAVRAVVDWYKLDPQSVLVVYDDMDLPLGRLRLRQTGSAGGHNGMKSLIS 122

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
           HL G   FPRL +GIG   G+ D  A +L KFS +E   V+++L    EA+   +  G+ 
Sbjct: 123 HL-GTQDFPRLRLGIGKSDGSKDTIAHVLGKFSPSELPIVEKSLDLATEAIAHSLHHGIA 181

Query: 139 SRLSRFN 119
             +S FN
Sbjct: 182 KTMSLFN 188



>gb:AP008231_580981 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 208

 Score =  125 bits (314), Expect = 1e-27
 Identities = 74/201 (36%), Positives = 116/201 (57%), Gaps = 12/201 (5%)
 Frame = -1

Query: 685 EYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-------KALIGIGS 527
           E  P L+ GLGNPG KY  TRHN+GF +ID+++Q+ G+ L+  +         A+ G+G 
Sbjct: 3   EDRPTLLVGLGNPGQKYAETRHNIGFMLIDRLAQDWGVKLSEDRKFQGEYGETAVPGLGK 62

Query: 526 IGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGH 347
           I      L KP T+MN SG S+  +  +Y++  + IL+++D+M LP G LRL+     G 
Sbjct: 63  IR-----LLKPTTFMNQSGRSLRAVLDWYKLTPQQILVIYDDMDLPLGRLRLRQSGSAGT 117

Query: 346 HNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMK-----AFLLQKFSETERKQVDEALKE 182
           HNG+KS++ HL     FPRL +GI  P    + +     + +L KF+ +E+  + + L  
Sbjct: 118 HNGMKSIISHLSS-KDFPRLRLGISLPRSQSNDRHDATVSHVLGKFAVSEQSLLKQVLDL 176

Query: 181 GAEAVRTLVREGVGSRLSRFN 119
             EA  T +R GV + ++R+N
Sbjct: 177 AQEATETALRSGVETAMNRYN 197



>sp|Q8DJ45|PTH_SYNEL Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000039_727168 Thermosynechococcus elongatus
           BP-1 DNA, complete genome.
          Length = 205

 Score =  125 bits (314), Expect = 1e-27
 Identities = 78/199 (39%), Positives = 111/199 (55%), Gaps = 13/199 (6%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEV-----P 512
           P ++ GLGNPG +Y  TRHNVGF ++D ++Q   + L T Q + L   G + EV      
Sbjct: 5   PCVIVGLGNPGIEYATTRHNVGFRVLDTLAQRYRVQL-TQQRRFL---GEVAEVLIQGQK 60

Query: 511 VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVK 332
           V L KP TYMN SG+S+  L  +Y++PL   L+VHD+  LP G LRL+     G HNG+K
Sbjct: 61  VRLLKPTTYMNSSGQSLHALLNFYKLPLERTLVVHDDADLPLGRLRLRLSGSTGGHNGIK 120

Query: 331 SVMEHLDGCH--QFPRLCIGIG------NPPGAMDMKAFLLQKFSETERKQVDEALKEGA 176
           S+++H   CH  QFPRL +GI          G  +   F+L  FS TE   +   L    
Sbjct: 121 SIIQH---CHSQQFPRLKVGIAFGDRLQQQTGPRNAVPFVLGHFSATELAILPAVLDLAV 177

Query: 175 EAVRTLVREGVGSRLSRFN 119
           +A+   ++ GV   ++R+N
Sbjct: 178 DAIELSIQSGVEVAMNRYN 196



>sp|Q8G5I6|PTH_BIFLO Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE014295_311407 Bifidobacterium longum
           NCC2705, complete genome.
          Length = 199

 Score =  123 bits (309), Expect = 5e-27
 Identities = 68/193 (35%), Positives = 108/193 (55%), Gaps = 8/193 (4%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIG----EVPVV 506
           WL+AGLGNPG KY  TRHN+GF   D +++   +     +  A++G   +      V   
Sbjct: 6   WLIAGLGNPGKKYEDTRHNMGFMTADVLAERWTVNFADHKGLAMLGKSVMNLDGRTVKFF 65

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           LAKP TYMN SG +V  ++AYYQ+   HI+++HD+M L  G +++K     G HNG+KS+
Sbjct: 66  LAKPLTYMNDSGNAVASISAYYQIEPDHIVVIHDDMDLEFGRIKVKAGGSAGGHNGIKSI 125

Query: 325 MEHLDGCHQFPRLCIGIGNPPGAMDMK----AFLLQKFSETERKQVDEALKEGAEAVRTL 158
              L G  ++ R+ +G+G+     +       ++L  F   +RKQ+ E L +GA+A   +
Sbjct: 126 DRSL-GTPKYARVRMGVGHSKRGANAHDNTVNWVLGGFGPDQRKQLPEFLADGADAAEDI 184

Query: 157 VREGVGSRLSRFN 119
           +  G+     +FN
Sbjct: 185 IFHGLAKTQEKFN 197



>sp|Q92N67|PTH_RHIME Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:SME591790_186373 Sinorhizobium meliloti 1021
           complete chromosome; segment 9/12.
          Length = 239

 Score =  123 bits (308), Expect = 7e-27
 Identities = 66/174 (37%), Positives = 106/174 (60%), Gaps = 1/174 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++AGLGNPG KY G RHN+GF  +D I + +G    + + K+ +  G I    V+L KPQ
Sbjct: 3   IIAGLGNPGPKYAGNRHNIGFMAVDAIQRRQGFSAWSRKFKSEVSEGEIDGERVLLMKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SGE++G    +Y++  + I++++DE+ LP G  R+K   GHG HNG+KS+  H  
Sbjct: 63  TFMNLSGEALGDAMRFYKLAPKDIVVIYDELDLPAGKARIKTGGGHGGHNGIKSIDAHCG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDM-KAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
              ++ RL +GIG+ PG  D+  A +L  F++ ++  +   L+  A+    LV+
Sbjct: 123 --KEYRRLRLGIGH-PGVKDLVHAHVLGDFAKADQAWLSLLLEAIADNAAMLVK 173



>sp|P57820|PTH_PASMU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE006051_215052 Pasteurella multocida subsp.
           multocida str. Pm70 section 18 of 204 of the complete
           genome.>gb:AE004439_1117782 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 194

 Score =  123 bits (308), Expect = 7e-27
 Identities = 65/187 (34%), Positives = 109/187 (58%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL---NTIQSKALIGIGSIGEVPVVLA 500
           L+ GLGNPG+KY  TRHN G  +I++++++    L   +    K    + +  E+  ++ 
Sbjct: 6   LIVGLGNPGDKYADTRHNAGEWLINRLARQFHFSLTPESKFSGKTARTVINGNEIRFLV- 64

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG+++  LA +Y++    IL++HDE+ LP GV ++K   GHG HNG++  + 
Sbjct: 65  -PTTFMNLSGKAISSLANFYRIKPEEILVIHDELDLPPGVAKIKQGGGHGGHNGLRDTIA 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL +GIG+P     + A++L K S T+ + +D+AL E    V  L+++G+ 
Sbjct: 124 QLGNNKNFYRLRVGIGHPGDKNLVSAYVLNKPSLTDWQLIDKALDEATSCVDILIKDGIT 183

Query: 139 SRLSRFN 119
              +R N
Sbjct: 184 KATNRLN 190



>gb:AE017314_439824 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 6 of 12 of the complete
           genome.>gb:AE017285_1072985 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 201

 Score =  122 bits (307), Expect = 9e-27
 Identities = 71/184 (38%), Positives = 106/184 (57%), Gaps = 9/184 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGI-------LLNTIQSKALIGIGSI--GE 518
           L+ GLGNPG +Y  TRHN GF  ID + +E           L+  + K  +    I  G+
Sbjct: 6   LIIGLGNPGREYDRTRHNFGFMFIDALLEEAQRNPFARCEQLSGGKKKYDLWRCDIVEGQ 65

Query: 517 VPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNG 338
            P +LAKPQT+MN SGE+V  +A++Y+V    +++ HDE+ LP G +R K   G+  HNG
Sbjct: 66  APWLLAKPQTFMNLSGEAVLAIASFYRVKPAAMVVAHDELDLPLGRMRFKMGGGNAGHNG 125

Query: 337 VKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTL 158
           +KS+ + L G   F RL +GIG PP   +   ++L +FS+++   VD  L+   + +RT 
Sbjct: 126 LKSITQCL-GTPDFHRLRLGIGKPPAGGETTGWVLGRFSQSDTAMVDAVLEAAIQGIRTF 184

Query: 157 VREG 146
             EG
Sbjct: 185 ATEG 188



>gb:AE017282_427830 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 187

 Score =  122 bits (307), Expect = 9e-27
 Identities = 70/186 (37%), Positives = 109/186 (58%), Gaps = 1/186 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEV-PVVLAKP 494
           L+ GLGNPG  Y  TRHN GF  ID+++   G +L   +S+    +G+I    PV L  P
Sbjct: 4   LIVGLGNPGPAYDRTRHNAGFWFIDRLAAAHGCVLRE-ESRFHGRVGAINLTEPVHLLAP 62

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V  +A +Y++   HIL+VHDE+    GV+R+K   GHG HNG++ +M  L
Sbjct: 63  LTFMNRSGLAVAAMARFYKIAPEHILVVHDELDFGPGVVRIKRDGGHGGHNGLRDIMAQL 122

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G   F RL IGIG P G+M +  ++L   S ++R+ +  A+++    +  L+   V   
Sbjct: 123 -GSGGFLRLRIGIGRPAGSMAVADYVLAAPSVSDRQAISGAIEKALACLSELLAGHVEQV 181

Query: 133 LSRFNI 116
           ++R ++
Sbjct: 182 MNRLHV 187



>gb:AE017153_392479 Haemophilus ducreyi strain 35000HP section 3 of
           6 of the complete genome.>gb:AE017143_1026741
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 200

 Score =  122 bits (306), Expect = 1e-26
 Identities = 63/189 (33%), Positives = 107/189 (56%), Gaps = 5/189 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVV----- 506
           L+ GL NPG KY GTRHN G  +++++++    + NT         G   ++  V     
Sbjct: 12  LIVGLANPGAKYEGTRHNAGEWLVNELAR----MYNTSLKDEAKYFGKTAKINTVNGDVW 67

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           L  P T+MN SG++VG LA ++++    IL+ HDE+ LP GV +LK   GHG HNG+K +
Sbjct: 68  LLIPTTFMNLSGKAVGALAHFFRIKAEEILIAHDELDLPPGVAKLKQGGGHGGHNGLKDI 127

Query: 325 MEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
           +  L   + F R+ +GIG+P     +  ++L K +  ++++++  + E +  +  L ++G
Sbjct: 128 ISALGNNNNFYRIRLGIGHPGHKDQVAGYVLSKPAPQDQQKINAVIDEASRCLEILFKDG 187

Query: 145 VGSRLSRFN 119
           V S  +R N
Sbjct: 188 VTSATNRLN 196



>sp|Q7VMI1|PTH_HAEDU Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).
          Length = 194

 Score =  122 bits (306), Expect = 1e-26
 Identities = 63/189 (33%), Positives = 107/189 (56%), Gaps = 5/189 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVV----- 506
           L+ GL NPG KY GTRHN G  +++++++    + NT         G   ++  V     
Sbjct: 6   LIVGLANPGAKYEGTRHNAGEWLVNELAR----MYNTSLKDEAKYFGKTAKINTVNGDVW 61

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           L  P T+MN SG++VG LA ++++    IL+ HDE+ LP GV +LK   GHG HNG+K +
Sbjct: 62  LLIPTTFMNLSGKAVGALAHFFRIKAEEILIAHDELDLPPGVAKLKQGGGHGGHNGLKDI 121

Query: 325 MEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
           +  L   + F R+ +GIG+P     +  ++L K +  ++++++  + E +  +  L ++G
Sbjct: 122 ISALGNNNNFYRIRLGIGHPGHKDQVAGYVLSKPAPQDQQKINAVIDEASRCLEILFKDG 181

Query: 145 VGSRLSRFN 119
           V S  +R N
Sbjct: 182 VTSATNRLN 190



>gb:CR555306_106172 Azoarcus sp. EbN1 complete genome.
          Length = 196

 Score =  122 bits (305), Expect = 2e-26
 Identities = 71/186 (38%), Positives = 106/186 (56%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAK 497
           P LV GLGNPG +Y  TRHN GF   ++++ + G+  +  +S+    + +  +  V L  
Sbjct: 6   PRLVVGLGNPGAEYTETRHNAGFRFCERLADKLGVRFSH-ESRFHGFVANARDAGVWLLM 64

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQTYMN SG++VG LA +Y++    IL+VHDE+ +P G LRLK   G G HNG+K    H
Sbjct: 65  PQTYMNRSGQAVGALARFYRIAPAEILVVHDELDIPPGQLRLKFGGGLGGHNGLKDTSAH 124

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           L   + + RL IGIG+P    ++  ++L+     E+ Q+DEAL     A   + R    +
Sbjct: 125 L-ATNDYWRLRIGIGHPGDRNEVVNYVLKPARREEQGQIDEALDRALAAWPMIARGEWNA 183

Query: 136 RLSRFN 119
             +R N
Sbjct: 184 ATTRLN 189



>sp|Q7U9I5|PTH_SYNPX Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX569689_775173 Synechococcus sp. WH8102
           complete genome; segment 1/7.
          Length = 203

 Score =  122 bits (305), Expect = 2e-26
 Identities = 74/183 (40%), Positives = 105/183 (57%), Gaps = 7/183 (3%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK--ALIGIGSIGEVPVVLAK 497
           LV GLGNPG KY GTRHN+GF  ++Q++  EG      QSK   L+    IGE  + L  
Sbjct: 7   LVVGLGNPGTKYEGTRHNIGFMALEQMASREGFSFRQ-QSKLHGLVAEHGIGESRLRLLM 65

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQTYMN SG S+     ++      +L++ D+M +P G LRL+ +   G HNG++S ++H
Sbjct: 66  PQTYMNDSGRSIRAALDWFGFTPEQLLVLVDDMDIPLGRLRLRGQGSAGGHNGLRSTIQH 125

Query: 316 LDGCHQFPRLCIGIGNP---PGAMDMK--AFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
           L G   FPRL IGIG P   P     +  + +L  FS  E+ +VD  L    EA++ + R
Sbjct: 126 L-GTQAFPRLRIGIGAPADNPAERRARTVSHVLGSFSRAEQPEVDVVLDGVLEAIQRIQR 184

Query: 151 EGV 143
           +G+
Sbjct: 185 QGL 187



>sp|Q8CQU9|PTH_STAEP Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:CP000029_80764 Staphylococcus epidermidis
           RP62A, complete genome.>gb:AE016751_323931
           Staphylococcus epidermidis ATCC 12228, section 8 of 9 of
           the complete genome.>gb:AE015929_1148600 Staphylococcus
           epidermidis ATCC 12228, complete genome.
          Length = 190

 Score =  122 bits (305), Expect = 2e-26
 Identities = 60/171 (35%), Positives = 101/171 (59%)
 Frame = -1

Query: 667 VAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQT 488
           + GLGN G ++  TRHN+GFE++D I +     L+  + K    I  +    V+  +P T
Sbjct: 4   IVGLGNIGKRFELTRHNIGFEVVDDILERHQFTLDKQKFKGAYTIERLNGEKVLFIEPMT 63

Query: 487 YMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDG 308
            MN SG++V  L  YY V +  +++++D++ L  G +RL+ K   G HNG+KS+++ L G
Sbjct: 64  MMNLSGQAVAPLMDYYNVDVEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKML-G 122

Query: 307 CHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLV 155
             QF R+ IG+G P   M +  ++LQKFS+ E   +++ ++  A AV + +
Sbjct: 123 TDQFKRIRIGVGRPTNGMSVPDYVLQKFSKEEMIIMEKVIEHSARAVESFI 173



>sp|Q839C0|PTH_ENTFA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016947_364382 Enterococcus faecalis V583,
           section 1 of 11 of the complete
           genome.>gb:AE016830_990870 Enterococcus faecalis V583,
           complete genome.
          Length = 188

 Score =  122 bits (305), Expect = 2e-26
 Identities = 64/167 (38%), Positives = 101/167 (60%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++ GLGNPG+KY  T+HN+GF  +D+I+  + +  N    +A I    IG   V+L KP 
Sbjct: 3   VIVGLGNPGSKYKETKHNIGFITLDEIAYRQNVSFNNSNFEADIAEFFIGTEKVLLVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG SVG L  Y+ V    +++++D++ L  G +RL+ K   G HNG+KS++ HL 
Sbjct: 63  TFMNESGRSVGPLLTYFGVDEEDLIVIYDDLDLEIGKIRLRQKGSAGGHNGIKSLIAHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEA 170
           G + FPR+ IGIG P     +   +L  F +   +++  A+K+ A+A
Sbjct: 122 GTNVFPRIKIGIGRPSKNDTVIHHVLSTFPKETHEEMLLAVKKAADA 168



>gb:AE017180_398966 Geobacter sulfurreducens PCA, complete genome.
          Length = 193

 Score =  121 bits (304), Expect = 2e-26
 Identities = 63/184 (34%), Positives = 107/184 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG KY  TRHN GF ++D+++   G  +       + G G+     ++L KPQ
Sbjct: 5   LIVGLGNPGPKYLWTRHNAGFMVLDRLAHAIGASVTRKSFSGVFGEGAWHGERLLLLKPQ 64

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG SV +   ++++PL   +++HD++ +P G +++K   GHG HNG++S+++ L 
Sbjct: 65  TYMNLSGRSVAEALRFHKLPLCDTIVIHDDLDIPFGRVKVKEGGGHGGHNGLRSLVQELG 124

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G   F R+ +GIG P    D+  ++L  FS+ E   +   L    + + +L+  G+   +
Sbjct: 125 GA-GFVRVRVGIGRPVHG-DVVNYVLTNFSQDEMADLAHLLDGTLDLLESLLTAGLPKTM 182

Query: 130 SRFN 119
           S +N
Sbjct: 183 SLYN 186



>sp|O66677|PTH_AQUAE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|A70331|A70331 peptidyl-tRNA hydrolase -
           Aquifex aeolicus>gb:AE000685_26028 Aquifex aeolicus VF5
           section 17 of 109 of the complete
           genome.>gb:AE000657_976559 Aquifex aeolicus VF5 complete
           genome.
          Length = 192

 Score =  121 bits (304), Expect = 2e-26
 Identities = 69/173 (39%), Positives = 104/173 (60%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           LV GLGNPG +Y  TRHNVGF +ID++ +         ++ + +    IG   V+LAKP 
Sbjct: 5   LVVGLGNPGKEYEKTRHNVGFMVIDELVKALRAKGPFEEALSHVYKARIGGKEVILAKPM 64

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG +V  L   Y++    +++V+D++ LP G +RL+ K   G H GV+S+++++ 
Sbjct: 65  TYMNNSGAAVYNLLEEYKLSPEQMIVVYDDLDLPLGHMRLRLKGSSGGHRGVESIIKYI- 123

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
           G   FPRL IGIG P    D+  ++L  FS  E K + + +K   +AVR L+R
Sbjct: 124 GTQNFPRLRIGIGRPKKKEDVVKYVLSPFSPEEEKVISQVIK---KAVRCLMR 173



>gb:CP000023_873983 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_875872 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 189

 Score =  120 bits (301), Expect = 5e-26
 Identities = 63/154 (40%), Positives = 93/154 (60%), Gaps = 1/154 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           LV GLGNPG+KYH TRHNVGF  ID +++E G+  +  ++ KA +    +    V   KP
Sbjct: 4   LVVGLGNPGSKYHETRHNVGFMAIDLMAKELGLTFSEEKTFKAEVASTFLNGEKVYFVKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V  L AYY +P+   ++++D++ +  G LR + K   G HNG+KS++   
Sbjct: 64  TTFMNLSGLAVRALLAYYNIPMEDFIVIYDDLDMEVGKLRFRQKGSAGGHNGIKSIIAE- 122

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETE 212
            G  +F R+ IGIG P   M +   +L KFSE +
Sbjct: 123 TGTQEFDRIKIGIGRPQKGMTVVNHVLGKFSEDD 156



>sp|Q92F62|PTH_LISIN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|AF1463|AF1463 peptidyl-tRNA hydrolase homolog
           pth [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596164_537592 Listeria innocua Clip11262
           complete genome, segment 2/12.
          Length = 184

 Score =  120 bits (301), Expect = 5e-26
 Identities = 59/184 (32%), Positives = 108/184 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+AGLGNPG KY  TRHNVGF ++D++S          +   ++   ++G   ++L KP 
Sbjct: 3   LIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGMVSEINVGGEKMILVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SGE +  L  YY + +  +L+V+D++ LP G +RL+ K   G HNG+KS+++H+ 
Sbjct: 63  TFMNASGECIRPLMDYYNIQIEDVLIVYDDLDLPVGKIRLRQKGSAGGHNGMKSIIQHVK 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
              +F R+ +G+  P    ++  ++L  F + E+  +  A+++ A+A+    +      +
Sbjct: 123 -TQEFNRIRVGVSRPLKG-EVIHYVLGDFPKAEQPDIIAAIQKSADAIEDFAQTPFIEVM 180

Query: 130 SRFN 119
           +++N
Sbjct: 181 NKYN 184



>sp|Q88Z39|PTH_LACPL Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AL935253_550502 Lactobacillus plantarum strain
           WCFS1 complete genome; segment 2/11.
          Length = 185

 Score =  120 bits (300), Expect = 6e-26
 Identities = 65/185 (35%), Positives = 107/185 (57%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++ GLGN G +Y  TRHNVGF ++D+++ +  +   T + +A +         ++L KP 
Sbjct: 3   MIVGLGNIGRQYAQTRHNVGFMIVDELASKLNVTFQTSKFEAQVATAFQDGEKILLVKPA 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG +VG L +YY V    +L++HD++ LP G +RLK K   G HNG+KS++ H+ 
Sbjct: 63  TYMNDSGRAVGPLMSYYNVDPADLLVIHDDLDLPLGKVRLKQKGSAGGHNGIKSIISHV- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRT-LVREGVGSR 134
           G   F R+ +GI +P   M +  ++L KF+  E  + D+A      AV   L  +   + 
Sbjct: 122 GDQHFKRVKVGIDHPQ-KMSVVDYVLGKFTPAEVAKFDDAKITALAAVEAWLANDDFTAV 180

Query: 133 LSRFN 119
           ++++N
Sbjct: 181 MNQYN 185



>gb:AE017322_442662 Listeria monocytogenes str. 4b F2365, section 1
           of 10 of the complete genome.>gb:AE017262_1075018
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 186

 Score =  119 bits (299), Expect = 8e-26
 Identities = 59/184 (32%), Positives = 107/184 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+AGLGNPG KY  TRHNVGF ++D++S          +   +     +G   ++L KP 
Sbjct: 3   LIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGMTSEIIVGGEKMILVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SGE +  L  YY +P+  +++V+D++ LP G +RL+ K   G HNG+KS+++H+ 
Sbjct: 63  TFMNASGECIRPLMDYYNIPIEDVVIVYDDLDLPVGKIRLRQKGSAGGHNGMKSIIQHVK 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
              +F R+ +G+  P    ++  ++L  F + E+  +  A+++ A+A+    +      +
Sbjct: 123 -TQEFNRIRVGVSRPLKG-EVIHYVLGDFPKAEQPDIIAAIQKSADAIEDFAQTPFIEVM 180

Query: 130 SRFN 119
           +++N
Sbjct: 181 NKYN 184



>sp|Q82TQ6|PTH_NITEU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX321862_774152 Nitrosomonas europaea ATCC
           19718, complete genome; segment 7/10.
          Length = 195

 Score =  119 bits (299), Expect = 8e-26
 Identities = 70/190 (36%), Positives = 103/190 (54%), Gaps = 2/190 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQI--SQEEGILLNTIQSKALIGIGSIGEVPVVLAK 497
           LV GLGNPG KY  TRHNVGF+ +D++  SQ     L T + + L     + +  + L K
Sbjct: 7   LVVGLGNPGEKYASTRHNVGFDWLDRLASSQRVAFTLET-RFRGLCARIMLADTDIWLLK 65

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQTYMN SG SV  +  YY++    +L+VHDE+ L  GV++LK   G G HNG+KS++  
Sbjct: 66  PQTYMNASGMSVAAVCRYYKIVPEQMLVVHDELDLQPGVIKLKSGGGTGGHNGLKSIVAD 125

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           L     F RL IG+G+P     +  ++L      E   +DEA+    +    + R    +
Sbjct: 126 LSS-QVFWRLRIGVGHPGDRNQVVDYVLHPPRREEAALIDEAIDHSMQVWPLIARGDFAA 184

Query: 136 RLSRFNIGQK 107
            + R +  Q+
Sbjct: 185 AMQRLHTRQE 194



>sp|Q8YAD1|PTH_LISMO Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|AF1101|AF1101 peptidyl-tRNA hydrolase homolog
           pth [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591974_534705 Listeria monocytogenes strain
           EGD, complete genome, segment 2/12.
          Length = 186

 Score =  119 bits (299), Expect = 8e-26
 Identities = 59/184 (32%), Positives = 107/184 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+AGLGNPG KY  TRHNVGF ++D++S          +   +     +G   ++L KP 
Sbjct: 3   LIAGLGNPGKKYERTRHNVGFMVVDELSFRHQTPWKKSKFNGMTSEIIVGGEKMILVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SGE +  L  YY +P+  +++V+D++ LP G +RL+ K   G HNG+KS+++H+ 
Sbjct: 63  TFMNASGECIRPLMDYYNIPIEDVVIVYDDLDLPVGKIRLRQKGSAGGHNGMKSIIQHVK 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
              +F R+ +G+  P    ++  ++L  F + E+  +  A+++ A+A+    +      +
Sbjct: 123 -TQEFNRIRVGVSRPLKG-EVINYVLGDFPKAEQPDIIAAIQKSADAIEDFAQTPFIEVM 180

Query: 130 SRFN 119
           +++N
Sbjct: 181 NKYN 184



>gb:STU31571_193777 Salmonella typhi peptidyl-tRNA hydrolase (pth)
           gene, complete cds.
          Length = 194

 Score =  119 bits (298), Expect = 1e-25
 Identities = 67/187 (35%), Positives = 101/187 (54%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D ++  +G+     +     G  S   +    V L 
Sbjct: 5   LIVGLANPGAEYAATRHNAGAWYVDLLA--DGLRAPLREEPKFFGYTSRITLEGEDVRLL 62

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++VG +A++Y++    IL+ HDE+ LP GV + K   GHG HNG+K ++ 
Sbjct: 63  VPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIIS 122

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL +GIG+P     +  F+L K   +E+K +DEA+ E A       +EG+ 
Sbjct: 123 KLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTELWFKEGLA 182

Query: 139 SRLSRFN 119
              SR +
Sbjct: 183 KATSRLH 189



>sp|O85235|PTH_LACSK Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AF054624_473925 Lactobacillus sakei
           transcription-repair coupling factor (mfd) gene, partial
           cds; L-lactate dehydrogenase (ldhL) gene, complete cds;
           and unknown genes.
          Length = 177

 Score =  119 bits (298), Expect = 1e-25
 Identities = 66/173 (38%), Positives = 101/173 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++ GLGNPG+KY  T+HN+GF +IDQ+ ++  + LN    +A  G        V+L KP 
Sbjct: 3   MIVGLGNPGSKYAKTKHNIGFMVIDQLCEKYNVTLNKHDFEAEYGSFKYEGETVLLVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG SVG L +YYQV +  +L++ D+M L  G LRL+ K   G HNG+KS++ H  
Sbjct: 63  TFMNDSGRSVGPLMSYYQVGIDELLVIQDDMDLTMGKLRLRQKGSAGGHNGIKSIIAHTK 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
               F RL IGI +P  +  +  ++L  F +     +++A+ +  E   T V+
Sbjct: 123 S-QTFKRLKIGIQHPQKSTVVN-WVLTPFDKDGAPVINQAIDQACEESTTGVK 173



>pir|C97627|C97627 stage v sporulation protein c (peptidyl-tRNA
           hydrolase)  (AP001507) [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>gb:AE008138_233912
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 196 of 254 of the complete
           sequence.>gb:AE007869_1083581 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 251

 Score =  119 bits (297), Expect = 1e-25
 Identities = 66/173 (38%), Positives = 100/173 (57%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++AGLGNPG +Y G RHN+GF  +D + +       + + KA I  G IG   V+L KP 
Sbjct: 16  IIAGLGNPGAQYAGNRHNIGFMAVDALQRLPSFAPWSKKFKAEISEGEIGGEKVLLMKPL 75

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGESVG+   ++++    I+ +HDE+ L  G  R+K   GHG HNG+KS+  H  
Sbjct: 76  TYMNLSGESVGEAMRFFKLTPADIIAIHDELDLLAGRTRIKIGGGHGGHNGLKSLDAHCG 135

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
              ++ RL +GIG+P     +   +L  F++++R  +D  L   A+    LV+
Sbjct: 136 --KEYRRLRLGIGHPGDKERVHGHVLGDFAKSDRVWLDPLLDAIADNAAMLVK 186



>sp|Q8UD97|PTH_AGRT5 Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|AE2850|AE2850 peptidyl tRNA hydrolase
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009173_249246 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 199 of 256 of the
           complete sequence.>gb:AE008688_1087089 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 238

 Score =  119 bits (297), Expect = 1e-25
 Identities = 66/173 (38%), Positives = 100/173 (57%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++AGLGNPG +Y G RHN+GF  +D + +       + + KA I  G IG   V+L KP 
Sbjct: 3   IIAGLGNPGAQYAGNRHNIGFMAVDALQRLPSFAPWSKKFKAEISEGEIGGEKVLLMKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGESVG+   ++++    I+ +HDE+ L  G  R+K   GHG HNG+KS+  H  
Sbjct: 63  TYMNLSGESVGEAMRFFKLTPADIIAIHDELDLLAGRTRIKIGGGHGGHNGLKSLDAHCG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
              ++ RL +GIG+P     +   +L  F++++R  +D  L   A+    LV+
Sbjct: 123 --KEYRRLRLGIGHPGDKERVHGHVLGDFAKSDRVWLDPLLDAIADNAAMLVK 173



>sp|Q99WA1|PTH_STAAM Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|G89816|G89816 peptidyl-tRNA hydrolase
           [imported] - Staphylococcus aureus  (strain
           N315)>gb:CP000046_90713 Staphylococcus aureus subsp.
           aureus COL, complete genome.>gb:AY035553_585977
           Staphylococcus aureus strain ISP3 peptidyl-tRNA
           hydrolase (pth) gene, complete cds.>gb:BA000017_676199
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_678872 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BA000033_710749 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_779969 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_782678 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 190

 Score =  118 bits (296), Expect = 2e-25
 Identities = 59/171 (34%), Positives = 99/171 (57%)
 Frame = -1

Query: 667 VAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQT 488
           + GLGN G ++  TRHN+GFE++D I ++    L+  + K    I  +    V+  +P T
Sbjct: 4   IVGLGNIGKRFELTRHNIGFEVVDYILEKNNFSLDKQKFKGAYTIERMNGDKVLFIEPMT 63

Query: 487 YMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDG 308
            MN SGE+V  +  YY V    +++++D++ L  G +RL+ K   G HNG+KS+++ L G
Sbjct: 64  MMNLSGEAVAPIMDYYNVNPEDLIVLYDDLDLEQGQVRLRQKGSAGGHNGMKSIIKML-G 122

Query: 307 CHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLV 155
             QF R+ IG+G P   M +  ++LQ+FS  E   +++ ++  A A+   V
Sbjct: 123 TDQFKRIRIGVGRPTNGMTVPDYVLQRFSNDEMVTMEKVIEHAARAIEKFV 173



>pir|AI0720|AI0720 aminoacyl-tRNA hydrolase (EC 3.1.1.29) -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:CP000026_75943 Salmonella enterica
           subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008779_243470 Salmonella typhimurium LT2,
           section 83 of 220 of the complete
           genome.>gb:AE016837_345223 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 4 of 16 of the
           complete genome.>gb:AL627271_542080 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 7/20.>gb:AE014613_982555 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1000552 Salmonella typhimurium LT2,
           complete genome.
          Length = 202

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/187 (35%), Positives = 100/187 (53%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D +++     L   +     G  S   +    V L 
Sbjct: 13  LIVGLANPGAEYAATRHNAGAWYVDLLAERLRAPLR--EEPKFFGYTSRITLEGEDVRLL 70

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++VG +A++Y++    IL+ HDE+ LP GV + K   GHG HNG+K ++ 
Sbjct: 71  VPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIIS 130

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL +GIG+P     +  F+L K   +E+K +DEA+ E A       +EG+ 
Sbjct: 131 KLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTELWFKEGLA 190

Query: 139 SRLSRFN 119
              SR +
Sbjct: 191 KATSRLH 197



>sp|Q60001|PTH_SALTY Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).
          Length = 194

 Score =  117 bits (294), Expect = 3e-25
 Identities = 67/187 (35%), Positives = 100/187 (53%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D +++     L   +     G  S   +    V L 
Sbjct: 5   LIVGLANPGAEYAATRHNAGAWYVDLLAERLRAPLR--EEPKFFGYTSRITLEGEDVRLL 62

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++VG +A++Y++    IL+ HDE+ LP GV + K   GHG HNG+K ++ 
Sbjct: 63  VPTTFMNLSGKAVGAMASFYRIQPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIIS 122

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL +GIG+P     +  F+L K   +E+K +DEA+ E A       +EG+ 
Sbjct: 123 KLGNNPNFHRLRVGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTELWFKEGLA 182

Query: 139 SRLSRFN 119
              SR +
Sbjct: 183 KATSRLH 189



>sp|Q7MXK9|PTH_PORGI Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE017172_396546 Porphyromonas gingivalis W83
           section 1 of 8 of the complete
           genome.>gb:AE015924_1032157 Porphyromonas gingivalis W83
           complete genome.
          Length = 185

 Score =  117 bits (293), Expect = 4e-25
 Identities = 60/185 (32%), Positives = 105/185 (56%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +L+ GLGN G +Y+GTRHNVGF M++ ++++ G+     +  A+  +  +    ++L KP
Sbjct: 3   YLIVGLGNIGGEYNGTRHNVGFRMVNALAEDGGVQFVEARYGAIARM-RVKNAELILLKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG +V        +P   +L++ D+++LP G LRLKPK     HNG+K++ E +
Sbjct: 62  NTYMNLSGNAVRYWMQQENIPREQVLVLVDDLALPFGTLRLKPKGSDAGHNGLKNIAEVM 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G   + RL  G+G+         F+L +F+  E +++ E  K   E +++    G+   
Sbjct: 122 -GSIDYARLRFGLGDEFSKGRQVDFVLGRFTPEEEEKLPELTKHAVEIIKSFCLAGIQRT 180

Query: 133 LSRFN 119
           ++R+N
Sbjct: 181 MNRYN 185



>sp|Q9RRW3|PTH_DEIRA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|B75281|B75281 peptidyl-tRNA hydrolase -
           Deinococcus radiodurans (strain R1)>gb:AE002068_42616
           Deinococcus radiodurans R1 section 205 of 229 of the
           complete chromosome 1.>gb:AE000513_883511 Deinococcus
           radiodurans R1 complete chromosome 1.
          Length = 215

 Score =  117 bits (293), Expect = 4e-25
 Identities = 64/186 (34%), Positives = 105/186 (56%), Gaps = 2/186 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKAL--IGIGSIGEVPVVLAK 497
           L+ GLGNPG KY  TRHNVG+ ++D++++  G          +  + +G+     V+L K
Sbjct: 3   LIVGLGNPGEKYAQTRHNVGWLVVDELARRAGGSWRKDGEAEVCEVRLGTAPGEKVLLVK 62

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQT+MN SG++V  L ++Y++    +L+V D++  P G+LR +    HG  NGV+ ++  
Sbjct: 63  PQTFMNTSGKAVWPLMSFYKLEGEQLLVVQDDLDSPFGLLRFRLGGRHGGQNGVRDIIAR 122

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           L G  +FPRL IGI  PP   D   ++L K+ + ER+ + E ++ G  A      +G+  
Sbjct: 123 L-GYDRFPRLKIGISRPPAGRDPADWVLSKWRDEERETLAELVRLGVGAAELWAVQGLAE 181

Query: 136 RLSRFN 119
               +N
Sbjct: 182 AQQMYN 187



>sp|Q8YYK4|PTH_ANASP Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|AB1912|AB1912 peptidyl-tRNA hydrolase
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_681835 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 203

 Score =  117 bits (293), Expect = 4e-25
 Identities = 70/193 (36%), Positives = 109/193 (56%), Gaps = 7/193 (3%)
 Frame = -1

Query: 676 PWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGI-LLNTIQSKALIGIGSI-GEVPVVL 503
           P L+ GLGNP  KY  TRHN+GF  +D +++   I L    + +   G G+  G V + L
Sbjct: 3   PQLIVGLGNPEPKYDQTRHNIGFAAVDALARAWNISLAENRKFQGQYGEGTAPGGVKIRL 62

Query: 502 AKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVM 323
            KP TYMN SG+++  + ++Y++    +L+++D++ LP G  RL+     G HNG+KS +
Sbjct: 63  LKPLTYMNRSGQAIQAVTSWYKLSGESVLVIYDDLDLPLGKTRLRLSGSAGGHNGMKSAI 122

Query: 322 EHLDGCHQFPRLCIGIGNPPGAM-----DMKAFLLQKFSETERKQVDEALKEGAEAVRTL 158
            HL     FPRL IGIG P  A+     +  + +L KFS TE + +   L+   E V   
Sbjct: 123 AHL-STQNFPRLRIGIGKPKNAVNGDNSETVSHVLGKFSATETQLMSLVLQFVVECVELS 181

Query: 157 VREGVGSRLSRFN 119
           +++GV   ++R N
Sbjct: 182 LKQGVEKAMNRCN 194



>sp|Q7UKV0|PTH_RHOBA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX294150_770489 Pirellula sp. strain 1
           complete genome; segment 18/24.
          Length = 190

 Score =  117 bits (292), Expect = 5e-25
 Identities = 65/184 (35%), Positives = 103/184 (55%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           LV GLGNPG KY  TRHN+GF + D + +       T + +  I    I    V++  PQ
Sbjct: 3   LVVGLGNPGRKYDQTRHNIGFMVADALVRRYVGSPPTTKFEGEISECRIENEKVLVLCPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG+SV +   +Y++    IL++ D+++L  G +RL+     G   G+  ++ HL 
Sbjct: 63  TYMNASGQSVRKAMDFYKLSPEDILVICDDLNLETGRVRLRRSGSAGGQKGLVDIIRHL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  Q+ RL IGIG PP    +  ++L KF +TE ++++ A+    +A    V +GV   +
Sbjct: 122 GSEQWARLKIGIGRPPAKWQVSDYVLGKFDKTELEEMEHAIVHSCDATACWVADGVTEAM 181

Query: 130 SRFN 119
           +R+N
Sbjct: 182 NRYN 185



>sp|Q888C8|PTH_PSESM Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016859_350543 Pseudomonas syringae pv.
           tomato str. DC3000 section 4 of 21 of the complete
           genome.>gb:AE016853_1035718 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 194

 Score =  117 bits (292), Expect = 5e-25
 Identities = 61/165 (36%), Positives = 98/165 (59%), Gaps = 4/165 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSI----GEVPVVL 503
           L+ GLGNPG +Y  TRHN G   +++I+  + +  N +  +   G+       G+  V L
Sbjct: 6   LIVGLGNPGAEYEQTRHNAGAFFVERIAAAQRV--NLVPERKFFGLTGRFTHQGQ-DVRL 62

Query: 502 AKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVM 323
             P TYMN SG++V  LA +Y++P+  IL+ HDE+ LP GV +LK   GHG HNG++ ++
Sbjct: 63  LIPTTYMNRSGQAVAALAGFYRIPIESILVAHDELDLPPGVAKLKVGGGHGGHNGLRDII 122

Query: 322 EHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
             L   + F RL +GIG+P  A  +  F+L +    E++++D ++
Sbjct: 123 AQLGNQNTFHRLRLGIGHPGDASKVSGFVLGRAPRAEQEKLDASI 167



>sp|Q8FQV6|PTH_COREF Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000035_715794 Corynebacterium efficiens
           YS-314 DNA, complete genome.
          Length = 177

 Score =  117 bits (292), Expect = 5e-25
 Identities = 62/177 (35%), Positives = 103/177 (58%), Gaps = 1/177 (0%)
 Frame = -1

Query: 679 TPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP-VVL 503
           +P LV GLGNPG KY GTRHN+GFE+++++        +  +         I ++P +++
Sbjct: 4   SPVLVVGLGNPGPKYVGTRHNIGFEVVEELVGRNYANFSVHKRSNT----EIAQLPGLIV 59

Query: 502 AKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVM 323
           AKP+++MN SG  +  L  ++++   ++L+VHDE+ L  G ++L+   G   HNG+KS  
Sbjct: 60  AKPRSFMNLSGTPIRALCDFFKISPANVLVVHDELDLDFGQVKLRQGGGDHGHNGLKSTS 119

Query: 322 EHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
             L G   + +L +GIG PPG MD   F+L+ FS+ E+  V     + A+ +   +R
Sbjct: 120 RSL-GTKDYWKLSVGIGRPPGRMDPATFVLKPFSKQEQDSVPIMAADAADLIEEHIR 175



>gb:AE017201_403648 Lactobacillus johnsonii NCC 533, section 2 of 7
           of the complete genome.>gb:AE017198_1122135
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 185

 Score =  116 bits (291), Expect = 7e-25
 Identities = 59/173 (34%), Positives = 101/173 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG KY  T+HN GF  +D   ++ G+ L+  + + L     I    V+  +PQ
Sbjct: 3   LITGLGNPGRKYDQTKHNTGFMALDHYLEKNGLTLDKNKFEGLWTKQKINGEDVIFLEPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG+S+ Q+A ++++    IL++HD+M +P G +R++     G HNG+KS+M  L 
Sbjct: 63  TFMNDSGKSIAQVANFFKIKPEDILVIHDDMDMPIGKIRIRANGKSGGHNGIKSIMACL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
           G + F RL IGI +P     + +++L  F+  ++K +D A +     +   ++
Sbjct: 122 GTNNFNRLKIGIRHPENE-SVVSWVLSPFNNDQQKLMDAAFETSENVINDFIK 173



>gb:CP000031_84862 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 239

 Score =  116 bits (291), Expect = 7e-25
 Identities = 60/179 (33%), Positives = 104/179 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L  GLGNPG KY   RHN+GF  +D+I+++ G     ++ +  I  G +G   V+L KP+
Sbjct: 3   LFVGLGNPGAKYARNRHNIGFMALDRIAEDHGFGPWRVKFQGQIAEGRLGREKVLLLKPE 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG+SVG+   +Y++    I ++HDE+ L  G +++K   GH  HNG++S+ +H+ 
Sbjct: 63  TFMNRSGQSVGEAMRFYKLDSTDITVLHDELDLAPGKVKVKAGGGHAGHNGLRSIHDHIG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               + R+ +GIG+P     +  ++L  F+  +   +++ L+  +E    L   G G+R
Sbjct: 123 AA--YDRVRLGIGHPGRKEAVAGYVLHDFARADEDWLEDVLRGVSEGAPHLA-AGDGAR 178



>gb:CP000033_88580 Lactobacillus acidophilus NCFM, complete genome.
          Length = 185

 Score =  116 bits (290), Expect = 9e-25
 Identities = 60/168 (35%), Positives = 100/168 (59%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++AGLGNPG KY  T+HN GF  +D    ++G+ LN  + +       I    V+  +PQ
Sbjct: 3   IIAGLGNPGQKYDKTKHNTGFMTMDHYLDKKGLTLNKDKFEGHWTKEKINGEDVIFLEPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG SV Q+A +++V    +L++ D+M +P G +R++     G HNG+KS++  L 
Sbjct: 63  TYMNESGRSVSQIANFFKVAPEDVLIIQDDMDMPIGKIRIRANGKSGGHNGIKSIIRDL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
           G  +F RL IGI +P  A  + +++L  F++ ++K +D+A     + +
Sbjct: 122 GTEKFNRLKIGIRHPKNA-TVVSWVLTPFNDEQQKLMDDAFDTSVDII 168



>gb:AE017305_436858 Thermus thermophilus HB27 section 5 of 7 of the
           complete genome.>gb:AP008226_579045 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1078836
           Thermus thermophilus HB27 complete genome.
          Length = 183

 Score =  115 bits (288), Expect = 1e-24
 Identities = 72/185 (38%), Positives = 98/185 (52%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +LV G GNPG +Y  TRHN+GF ++D++      L    + +AL+     G    +  KP
Sbjct: 2   FLVVGQGNPGERYARTRHNLGFMVLDRLG-----LSFRPRGEALVAEAEGG----LFLKP 52

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TY N +G +V  LA +Y++P   IL+VHDEM LP G +R K       + GV S+ E L
Sbjct: 53  LTYYNLTGRAVAPLARFYKIPPERILVVHDEMDLPLGRIRFKAGGSAAGNRGVLSIEEAL 112

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G   F RL +GIG PP       ++L  F E E   V+  L+   EAV   VREG+   
Sbjct: 113 -GTRAFHRLRLGIGKPPDPSRGAEYVLSPFREEELPVVERVLEAAKEAVWCWVREGLPPC 171

Query: 133 LSRFN 119
             RFN
Sbjct: 172 AGRFN 176



>gb:BX897699_827786 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 193

 Score =  115 bits (287), Expect = 2e-24
 Identities = 59/174 (33%), Positives = 102/174 (58%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           WL+AGLGNPG +Y   RHN+GF  ID I Q       + + +A I  G I      L KP
Sbjct: 2   WLIAGLGNPGLQYQNNRHNIGFMAIDAIYQSFSFSPWSKKFQAEISTGLINGKKTFLLKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QT+MN SG+++G+   +Y++ L++ ++++DE+ LP G +R+K   G+  HNG+KS+  H 
Sbjct: 62  QTFMNLSGQAIGEALRFYKLDLKNFIVIYDELDLPPGRVRVKIGGGNNGHNGIKSIDAHC 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
                + R+ +GIG P     +   +L  F++++++ +   L+  A+ +  L++
Sbjct: 122 G--TDYCRIRLGIGRPNSKELVYQHVLGNFTKSDQEWLPSLLEAIAKNIALLIK 173



>gb:CR543861_104724 Acinetobacter sp. ADP1 complete genome.
          Length = 193

 Score =  115 bits (287), Expect = 2e-24
 Identities = 65/185 (35%), Positives = 98/185 (52%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG +Y  TRHN GF  ++Q++    I L          G G I    V L  P
Sbjct: 6   LIVGLGNPGAEYAQTRHNAGFWFVEQLADRYNITLKKDPKFHGFSGRGQIEGHDVRLLIP 65

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG+SV   + +YQ+    IL+ HDE+ +  GV+RLK   GHG HNG++ ++ H+
Sbjct: 66  TTFMNRSGQSVVPFSKFYQISPEAILIAHDELDMDPGVIRLKTGGGHGGHNGLRDIVPHI 125

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
                F RL IGIG+P     +   +L K  + E+  +++A+       R LV   +   
Sbjct: 126 GA--NFHRLRIGIGHPGSKDRVSGHVLGKAPQNEQTLMEDAIHHALSNTRLLVDGQIAQA 183

Query: 133 LSRFN 119
           +++ N
Sbjct: 184 MNQIN 188



>sp|Q8NRV3|PTH1_CORGL Peptidyl-tRNA hydrolase 1 (EC 3.1.1.29) (PTH
           1).>gb:BA000036_718665 Corynebacterium glutamicum ATCC
           13032 DNA, complete genome.>gb:BX927150_832524
           Corynebacterium glutamicum ATCC 13032, IS fingerprint
           type 4-5, complete genome; segment 3/10.
          Length = 177

 Score =  115 bits (287), Expect = 2e-24
 Identities = 63/180 (35%), Positives = 107/180 (59%), Gaps = 2/180 (1%)
 Frame = -1

Query: 679 TPWLVAGLGNPGNKYHGTRHNVGFEMIDQ-ISQEEGILLNTIQSKALIGIGSIGEVP-VV 506
           +P LV GLGNPG KY GTRHN+GFE+ ++ +S+  G      +S        I ++P ++
Sbjct: 4   SPLLVVGLGNPGPKYVGTRHNIGFEVAEELVSRSFGSFSVHKRSNT-----DIAQLPGLI 58

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           +AKP+++MN SG  +  L  ++++   ++++VHDE+ L  G ++L+   G   HNG+KS 
Sbjct: 59  VAKPRSFMNLSGTPIRALCDFFKISPANVIVVHDELELDFGSVKLRQGGGDHGHNGLKST 118

Query: 325 MEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
            + L G   + +L +GIG PPG MD  +F+L+ F + E   +     + A+ V   +++G
Sbjct: 119 SKSL-GTKDYWKLSMGIGRPPGRMDPASFVLKPFGKQELADIPIMAADAADLVEKHLQQG 177



>gb:BX897700_828569 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 193

 Score =  114 bits (286), Expect = 3e-24
 Identities = 59/174 (33%), Positives = 103/174 (59%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           WL+AGLGNPG +Y   RHN+GF +ID I Q       + + +A I  G I      L KP
Sbjct: 2   WLIAGLGNPGLQYQNNRHNIGFMVIDAIYQSFSFSPWSKKFQAEISNGLIDGEKTFLIKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QT+MN SG+++G++  +Y++ L++ +++ DE+ LP G +R+K   G+  HNG+KS+  H 
Sbjct: 62  QTFMNLSGQAIGEVLRFYKLDLKNFIVICDELDLPPGKVRVKTAGGNNGHNGIKSIDAHC 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
                + R+ +GIG+P     +   +L  F++++++ +   L   A+ +  L++
Sbjct: 122 G--TDYCRVRLGIGHPGSKELVHQHVLGNFTKSDQEWLSPLLDAIAKNIALLIK 173



>sp|Q8E7Y8|PTH_STRA3 Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>sp|Q8E2I1|PTH_STRA5 Peptidyl-tRNA hydrolase (EC
           3.1.1.29) (PTH).>gb:SAG766843_169535 Streptococcus
           agalactiae NEM316 complete genome, segment
           1.>gb:AE014191_305349 Streptococcus agalactiae 2603V/R
           section 1 of 100 of the complete
           genome.>gb:AE009948_935462 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 191

 Score =  114 bits (286), Expect = 3e-24
 Identities = 58/169 (34%), Positives = 99/169 (58%), Gaps = 1/169 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           ++ GLGNPG+KY+ T+HN+GF  +D+I ++  +     ++ KA IG   I    +   KP
Sbjct: 4   MIVGLGNPGSKYNDTKHNIGFMAVDRIVKDLDVNFTEDKNFKAEIGSDFINGEKIYFIKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V  L  YY + ++ +++++D++ +  G +R + K   G HNG+KS++ HL
Sbjct: 64  TTFMNNSGIAVKALLTYYNISIKDMIIIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIAHL 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
            G  +F R+ +GIG P G M +   +L KF + +   +   L +   AV
Sbjct: 124 -GTQEFDRIKVGIGRPNGRMTVINHVLGKFDKNDEIMILNTLDKVDNAV 171



>gb:BA000037_721751 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 211

 Score =  114 bits (284), Expect = 4e-24
 Identities = 60/185 (32%), Positives = 101/185 (54%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL-NTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GL NPG +Y  TRHN G  +++++++   I L N  +   L G   +    + L  P
Sbjct: 22  LLVGLANPGPEYAKTRHNAGAWVVEELARVHNITLKNEAKFYGLTGRIVMNGQELRLLIP 81

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG+++  LA +YQ+    I++ HDE+ LP G+ + K   GHG HNG++  +  L
Sbjct: 82  TTFMNLSGKAIAALAKFYQIQPEEIMVAHDELDLPPGIAKFKKGGGHGGHNGLRDTISKL 141

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               +F RL IGIG+P     +  F+L K   +E+  +D  + E    +  L+++G+   
Sbjct: 142 GNNKEFYRLRIGIGHPGHKDKVAGFVLGKAPASEQSLLDATVDESVRCLDILIKDGLSKA 201

Query: 133 LSRFN 119
            +R +
Sbjct: 202 QNRLH 206



>gb:AE016797_335047 Vibrio vulnificus CMCP6 chromosome I section 1
           of 11 of the complete sequence.>gb:AE016795_1044771
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 222

 Score =  114 bits (284), Expect = 4e-24
 Identities = 60/185 (32%), Positives = 101/185 (54%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL-NTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GL NPG +Y  TRHN G  +++++++   I L N  +   L G   +    + L  P
Sbjct: 33  LLVGLANPGPEYAKTRHNAGAWVVEELARVHNITLKNEAKFYGLTGRIVMNGQELRLLIP 92

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG+++  LA +YQ+    I++ HDE+ LP G+ + K   GHG HNG++  +  L
Sbjct: 93  TTFMNLSGKAIAALAKFYQIQPEEIMVAHDELDLPPGIAKFKKGGGHGGHNGLRDTISKL 152

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               +F RL IGIG+P     +  F+L K   +E+  +D  + E    +  L+++G+   
Sbjct: 153 GNNKEFYRLRIGIGHPGHKDKVAGFVLGKAPASEQSLLDATVDESVRCLDILIKDGLSKA 212

Query: 133 LSRFN 119
            +R +
Sbjct: 213 QNRLH 217



>sp|Q8DFF4|PTH_VIBVU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>sp|Q7MMZ2|PTH_VIBVY Peptidyl-tRNA hydrolase (EC
           3.1.1.29) (PTH).
          Length = 196

 Score =  114 bits (284), Expect = 4e-24
 Identities = 60/185 (32%), Positives = 101/185 (54%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL-NTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GL NPG +Y  TRHN G  +++++++   I L N  +   L G   +    + L  P
Sbjct: 7   LLVGLANPGPEYAKTRHNAGAWVVEELARVHNITLKNEAKFYGLTGRIVMNGQELRLLIP 66

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG+++  LA +YQ+    I++ HDE+ LP G+ + K   GHG HNG++  +  L
Sbjct: 67  TTFMNLSGKAIAALAKFYQIQPEEIMVAHDELDLPPGIAKFKKGGGHGGHNGLRDTISKL 126

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               +F RL IGIG+P     +  F+L K   +E+  +D  + E    +  L+++G+   
Sbjct: 127 GNNKEFYRLRIGIGHPGHKDKVAGFVLGKAPASEQSLLDATVDESVRCLDILIKDGLSKA 186

Query: 133 LSRFN 119
            +R +
Sbjct: 187 QNRLH 191



>sp|Q87RN9|PTH_VIBPA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000031_706198 Vibrio parahaemolyticus RIMD
           2210633 DNA, chromosome 1, complete sequence.
          Length = 196

 Score =  114 bits (284), Expect = 4e-24
 Identities = 61/185 (32%), Positives = 101/185 (54%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL-NTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GL NPG +Y  TRHN G  +++++++   + L N  +   L G   +    + L  P
Sbjct: 7   LLVGLANPGPEYAKTRHNAGAWVVEELARVHNVTLKNEPKFFGLTGRIMVNGQDLRLLIP 66

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG+++  LA +YQ+    I++ HDE+ LP GV + K   GHG HNG++  +  L
Sbjct: 67  TTFMNLSGKAIAALAKFYQIKPEEIMVAHDELDLPPGVAKFKKGGGHGGHNGLRDTISKL 126

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
                F RL IGIG+P     +  F+L K    E++ +D A  E   ++  L+++G+   
Sbjct: 127 GNNKDFYRLRIGIGHPGHKDKVAGFVLGKAPAKEQELLDAAADEAVRSLDILIKDGLSKA 186

Query: 133 LSRFN 119
            +R +
Sbjct: 187 QNRLH 191



>sp|Q8DRQ2|PTH_STRR6 Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|E97872|E97872 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) [imported] - Streptococcus pneumoniae (strain
           R6)>gb:AE008385_236326 Streptococcus pneumoniae R6
           section 1 of 184 of the complete
           genome.>gb:AE007317_942484 Streptococcus pneumoniae R6,
           complete genome.
          Length = 189

 Score =  114 bits (284), Expect = 4e-24
 Identities = 61/176 (34%), Positives = 105/176 (59%), Gaps = 2/176 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL--NTIQSKALIGIGSIGEVPVVLAK 497
           L+ GLGNPG+KY  T+HNVGF +IDQ+++++ +    + I    L      GE  + L K
Sbjct: 4   LLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQADLASFFLNGE-KIYLVK 62

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG++V  L  YY + +  +L+++D++ +  G +RL+ K   G HNG+KS+++H
Sbjct: 63  PTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRLRAKGSAGGHNGIKSIIQH 122

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
           + G   F R+ IGIG P   M +   +L KF   +   + +++ +  ++V   ++E
Sbjct: 123 I-GTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQSIDKVDDSVNYYLQE 177



>sp|Q83LE1|PTH_SHIFL Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE005674_70789 Shigella flexneri 2a str. 301,
           complete genome.>gb:AE016982_371153 Shigella flexneri 2a
           str. 2457T section 5 of 16 of the complete
           genome.>gb:AE014073_995903 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 194

 Score =  114 bits (284), Expect = 4e-24
 Identities = 65/187 (34%), Positives = 99/187 (52%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D +++     L   +     G  S   +G   V L 
Sbjct: 5   LIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLR--EEAKFFGYTSRVTLGSEDVRLL 62

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++V  +A+++++    IL+ HDE+ LP GV + K   GHG HNG+K ++ 
Sbjct: 63  VPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIIS 122

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL IGIG+P     +  F+L K   +E+K +DEA+ E A        +G+ 
Sbjct: 123 KLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLT 182

Query: 139 SRLSRFN 119
              +R +
Sbjct: 183 KATNRLH 189



>sp|Q7M7U8|PTH_WOLSU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX571662_779332 Wolinella succinogenes,
           complete genome; segment 6/7.
          Length = 192

 Score =  113 bits (283), Expect = 6e-24
 Identities = 65/161 (40%), Positives = 97/161 (60%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           LV GLGNPG  Y  TRHN+GF +ID + +     LN  +S     +   GE   +  KP 
Sbjct: 3   LVVGLGNPGKTYESTRHNIGFRVIDALLERRS-ALNATKSTFKGELHKEGE--NLFLKPT 59

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SGES   ++ +Y+     IL++HD++ LP G +RLK   G+G HNG+KS+ + L 
Sbjct: 60  TYMNLSGESALPVSTFYKP--EKILVIHDDLDLPFGAIRLKRGGGNGGHNGLKSLDKLLG 117

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
             + + RL IGIG PP   ++  ++L +FS+ E ++++E L
Sbjct: 118 --NDYYRLRIGIGKPPLGWEVADYVLARFSQEEEQELEERL 156



>sp|Q97TD1|PTH_STRPN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|E95000|E95000 peptidyl-tRNA hydrolase
           [imported] - Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007318_225259 Streptococcus pneumoniae TIGR4
           section 1 of 194 of the complete
           genome.>gb:AE005672_1103027 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 189

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/176 (34%), Positives = 105/176 (59%), Gaps = 2/176 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL--NTIQSKALIGIGSIGEVPVVLAK 497
           L+ GLGNPG+KY  T+HNVGF +IDQ+++++ +    + I    L      GE  + L K
Sbjct: 4   LLVGLGNPGDKYFETKHNVGFMLIDQLAKKQNVTFTHDKIFQADLASFFLNGE-KIYLVK 62

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG++V  L  YY + +  +L+++D++ +  G +RL+ K   G HNG+KS+++H
Sbjct: 63  PTTFMNESGKAVHALLTYYGLDIDDLLIIYDDLDMEVGKIRLRAKGSAGGHNGIKSIIQH 122

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
           + G   F R+ IGIG P   M +   +L KF   +   + +++ +  ++V   ++E
Sbjct: 123 I-GTQVFNRVKIGIGRPKNGMSVVHHVLSKFDRDDYIGILQSVDKVDDSVNYYLQE 177



>sp|Q98HV6|PTH_RHILO Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000012_668047 Mesorhizobium loti MAFF303099
           DNA, complete genome.
          Length = 240

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/171 (35%), Positives = 100/171 (58%)
 Frame = -1

Query: 664 AGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTY 485
           AGLGNPG KY   RHNVGF   D I++       + + + LI  G+I    ++L KPQT+
Sbjct: 5   AGLGNPGAKYADNRHNVGFMAADAIARRHSFSPWSKKFQGLIAEGTIAGEKIILIKPQTF 64

Query: 484 MNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDGC 305
           MN SG+SVG+   +Y++ L  + + +DE+ L  G LR+K   G G HNG++S+  H+   
Sbjct: 65  MNLSGQSVGEALRFYKLELSALTVFYDEIDLAEGKLRIKTGGGAGGHNGIRSIDGHIGNA 124

Query: 304 HQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
           ++  R+ IG+G+P     ++  +L  F++ +R+ +D  L   A+    +V+
Sbjct: 125 YR--RVRIGVGHPGIKEMVQHHVLGDFAKADREWLDPLLDAIADNAAMIVK 173



>sp|Q8RIJ5|PTH_FUSNN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE010467_263413 Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586, section 9 of 197 of the complete
           genome.>gb:AE009951_910581 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 191

 Score =  113 bits (283), Expect = 6e-24
 Identities = 61/164 (37%), Positives = 101/164 (61%), Gaps = 1/164 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           +V GLGNPG KY  TRHN+GF  +D + ++  I     + +AL+   +I    V+  KPQ
Sbjct: 3   VVIGLGNPGKKYEKTRHNIGFIAVDNLRKKFNISDEREKFQALVSEKNIDGEKVIFFKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQV-PLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           T+MN SG SV ++  +Y++ P + I++++D+M L  G +R++ K   G HNG+KS++ H+
Sbjct: 63  TFMNLSGNSVIEIINFYKLDPKKDIIVIYDDMDLSFGDIRIREKGSSGGHNGIKSIISHI 122

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKE 182
               +F R+  GIG      D    +L +F++TE+K +DE L++
Sbjct: 123 G--EEFIRIKCGIG--AKERDAVEHVLGEFNQTEQKDLDEILEK 162



>sp|Q8YIG4|PTH_BRUME Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|AB3312|AB3312 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) [imported] - Brucella melitensis (strain
           16M)>gb:AE009490_252398 Brucella melitensis 16M
           chromosome I, section 47 of 195 of the complete
           sequence.>gb:AE014291_308959 Brucella suis 1330
           chromosome I, complete sequence.>gb:AE008917_978310
           Brucella melitensis 16M chromosome I, complete sequence.
          Length = 250

 Score =  113 bits (283), Expect = 6e-24
 Identities = 63/185 (34%), Positives = 104/185 (56%), Gaps = 3/185 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+AGLGNPG +Y   RHN+GF   D+I +         + +A I  G I    V+L KPQ
Sbjct: 3   LIAGLGNPGPQYAHNRHNIGFMAADEIFRRHRFSNWQKKFQAEIADGVIDGEKVLLVKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG+S+G+   +Y++    +++++DE+ L  G LR+K   G G HNG+KS+  H+ 
Sbjct: 63  TFMNLSGQSIGEAMRFYKLTPADLVVIYDELDLVPGKLRIKTGGGSGGHNGIKSIDAHMQ 122

Query: 310 ---GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
              G   + R+ +GIG+P     +  ++L  F++ + + +D  +   A+ V  L R    
Sbjct: 123 SFPGGQNYRRMRLGIGHPGAKELVHNYVLGDFAKADNEWLDTLMGAVADNVAMLARREDN 182

Query: 139 SRLSR 125
           S ++R
Sbjct: 183 SFMNR 187



>sp|Q9AEQ5|PTH_BRUAB Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AY028973_585357 Brucella melitensis biovar
           Abortus peptidyl tRNA hydrolase (pth) and putative
           GTP-binding protein (buG) genes, complete cds.
          Length = 250

 Score =  113 bits (283), Expect = 6e-24
 Identities = 63/185 (34%), Positives = 104/185 (56%), Gaps = 3/185 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+AGLGNPG +Y   RHN+GF   D+I +         + +A I  G I    V+L KPQ
Sbjct: 3   LIAGLGNPGPQYAHNRHNIGFMAADEIFRRHRFSNWQKKFQAEIADGVIDGEKVLLVKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG+S+G+   +Y++    +++++DE+ L  G LR+K   G G HNG+KS+  H+ 
Sbjct: 63  TFMNLSGQSIGEAMRFYKMTPADLVVIYDELDLVPGKLRIKTGGGSGGHNGIKSIDAHMQ 122

Query: 310 ---GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
              G   + R+ +GIG+P     +  ++L  F++ + + +D  +   A+ V  L R    
Sbjct: 123 SFPGGQNYRRMRLGIGHPGAKELVHNYVLGDFAKADNEWLDTLMGAVADNVAMLARREDN 182

Query: 139 SRLSR 125
           S ++R
Sbjct: 183 SFMNR 187



>gb:AE004969_60152 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 192

 Score =  113 bits (282), Expect = 7e-24
 Identities = 66/186 (35%), Positives = 105/186 (56%), Gaps = 3/186 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP---VVLA 500
           +V GLGNPG +Y  TRHN GF  +D+++ +        + K   G  +   +P   V L 
Sbjct: 7   MVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFK--EEKKFFGEVARAALPDGDVWLL 64

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP T+MN SG++V  LA +Y++    IL+VHDE+ +P G ++ K   G+G HNG+K +  
Sbjct: 65  KPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGRIKFKLGGGNGGHNGLKDIQA 124

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L G   + RL +GIG+P     +  ++L K S   R+Q+D+A+ +  +AV  ++  G  
Sbjct: 125 KL-GTADYYRLRLGIGHPGDRNLVVGYVLNKPSAEHRRQIDDAVAKSLQAVPDII-SGKW 182

Query: 139 SRLSRF 122
              +RF
Sbjct: 183 EEATRF 188



>sp|P23932|PTH_ECOLI Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|S16753|S16753 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) - Escherichia coli  (strain
           K-12)>pir|B85700|B85700 peptidyl-tRNA hydrolase
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>pir|E90842|E90842 peptidyl-tRNA
           hydrolase [imported] - Escherichia coli  (strain
           O157:H7, substrain RIMD 0509952)>gb:AE005174_65995
           Escherichia coli O157:H7 EDL933, complete
           genome.>gb:D90756_122137 Escherichia coli K12 genomic
           DNA. (27.1 - 27.5 min).>gb:ECPTHG_132343 E.coli pth gene
           for peptidyl-tRNA hydrolase.>gb:U00096_200273
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE016759_325679 Escherichia coli CFT073
           section 5 of 18 of the complete
           genome.>gb:BA000007_659721 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_956263 Escherichia coli
           CFT073 complete genome.
          Length = 194

 Score =  113 bits (282), Expect = 7e-24
 Identities = 65/187 (34%), Positives = 99/187 (52%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D +++     L   +     G  S   +G   V L 
Sbjct: 5   LIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLR--EEAKFFGYTSRVTLGGEDVRLL 62

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++V  +A+++++    IL+ HDE+ LP GV + K   GHG HNG+K ++ 
Sbjct: 63  VPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIIS 122

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL IGIG+P     +  F+L K   +E+K +DEA+ E A        +G+ 
Sbjct: 123 KLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLT 182

Query: 139 SRLSRFN 119
              +R +
Sbjct: 183 KATNRLH 189



>gb:CR378672_96194 Photobacterium profundum SS9; segment 10/12.
          Length = 196

 Score =  112 bits (279), Expect = 2e-23
 Identities = 63/186 (33%), Positives = 101/186 (54%), Gaps = 2/186 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSI--GEVPVVLAK 497
           L+ GL NPG +Y  TRHN G  ++ ++++   + L   +SK     G I      + L  
Sbjct: 7   LLVGLANPGAEYAKTRHNAGAWVVQELARVHNVSLRE-ESKYFGVTGRITTNGQDLRLLI 65

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P TYMN SG+SV  LA ++Q+    IL+ HDE+ LP GV + K   GHG HNG++  +  
Sbjct: 66  PTTYMNLSGKSVAALANFFQIKPEEILIAHDELDLPPGVAKFKKGGGHGGHNGLRDTISK 125

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           +    +F RL +GIG+P     +  F+L K    E++ +D A+ E    +  L+++G+  
Sbjct: 126 MGNNKEFYRLRVGIGHPGDKNKVANFVLGKAPVKEQECIDAAVDEAVRCMDILLKDGLNK 185

Query: 136 RLSRFN 119
             +R +
Sbjct: 186 AQNRLH 191



>sp|Q9KQ21|PTH_VIBCH Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|C82107|C82107 peptidyl-tRNA hydrolase VC2184
           [imported] - Vibrio cholerae  (strain N16961 serogroup
           O1)>gb:AE004290_52559 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 198 of 251 of the
           complete chromosome.>gb:AE003852_1053333 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 196

 Score =  112 bits (279), Expect = 2e-23
 Identities = 60/185 (32%), Positives = 102/185 (55%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL-NTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GL NPG +Y  TRHN G  +++++++   + L N  +   L G   I    + +  P
Sbjct: 7   LLVGLANPGPEYAKTRHNAGAWVVEELARIHNVTLKNEPKFFGLTGRLLINSQELRVLIP 66

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG+++  LA +YQ+    I++ HDE+ LP GV + K   GHG HNG+K  +  L
Sbjct: 67  TTFMNLSGKAIAALANFYQIKPEEIMVAHDELDLPPGVAKFKQGGGHGGHNGLKDTISKL 126

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               +F RL +GIG+P     +  ++L K    E++ +D A+ E    +  L+++G+   
Sbjct: 127 GNNKEFYRLRLGIGHPGHKDKVAGYVLGKAPAKEQECLDAAVDESVRCLEILMKDGLTKA 186

Query: 133 LSRFN 119
            +R +
Sbjct: 187 QNRLH 191



>sp|Q83AP0|PTH_COXBU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016965_369024 Coxiella burnetii strain RSA
           493, section 6 of 7 of the complete
           genome.>gb:AE016828_1009760 Coxiella burnetii strain RSA
           493, complete genome.
          Length = 187

 Score =  112 bits (279), Expect = 2e-23
 Identities = 65/174 (37%), Positives = 102/174 (58%), Gaps = 1/174 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEV-PVVLAKP 494
           L+AGLGNPG++Y  TRHNVG   ++ ++Q+     N   +K     G + +     L KP
Sbjct: 7   LIAGLGNPGDQYARTRHNVGAWFLETLAQQR----NQSLAKENKFHGFVAKCNDYWLLKP 62

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG++V  LA +Y++    IL+ HDE+  P G +RLK   GHG HNG++++++HL
Sbjct: 63  TTFMNESGQAVAALAHFYKIKPSEILIAHDELDFPAGDIRLKEGGGHGGHNGLRNIIQHL 122

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
            G   F RL IGI +P     +  ++L   SE +R  +  A+++G   +  LV+
Sbjct: 123 -GSSDFYRLRIGINHPGHKDRVTPYVLSPPSENDRIAILAAIEKGLRLIPELVQ 175



>sp|Q9X1W1|PTH_THEMA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|B72229|B72229 peptidyl-tRNA hydrolase -
           Thermotoga maritima (strain MSB8)>gb:AE001806_39521
           Thermotoga maritima MSB8 section 118 of 136 of the
           complete genome.>gb:AE000512_1113994 Thermotoga maritima
           MSB8, complete genome.
          Length = 186

 Score =  111 bits (278), Expect = 2e-23
 Identities = 65/184 (35%), Positives = 107/184 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           +V GLGNPG +Y  TRHNVGF  +D +  ++     T +  A   I   G   V L KP 
Sbjct: 2   VVVGLGNPGPRYAFTRHNVGFLFLDFLKNKDW---KTEKYFAWNKINLAGN-EVALVKPL 57

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG ++  +  ++   L  I++V+D++SL  G +R++ K   G HNG+KS+++ L 
Sbjct: 58  TYMNLSGLAMPHVLKFFSASLDDIIVVYDDVSLKLGKIRIRKKGSDGGHNGMKSIIQAL- 116

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  +  R+ +GIG+ P  MD+  F+L +FS+ E   +++  +   EA+  ++ EG+   +
Sbjct: 117 GTQEIKRIRVGIGDKPEGMDLVNFVLGEFSDEEWIILNKVFEVMKEALEVILVEGIEKAM 176

Query: 130 SRFN 119
           S +N
Sbjct: 177 SIYN 180



>sp|Q9K029|PTH_NEIMB Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|B81157|B81157 peptidyl-tRNA hydrolase NMB0795
           [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002433_46247 Neisseria meningitidis
           serogroup B strain MC58 section 75 of 206 of the
           complete genome.>gb:AE002098_896360 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 192

 Score =  111 bits (278), Expect = 2e-23
 Identities = 62/171 (36%), Positives = 99/171 (57%), Gaps = 3/171 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP---VVLA 500
           +V GLGNPG +Y  TRHN GF  +D+++ +        + K   G  +   +P   V L 
Sbjct: 7   MVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFK--EEKKFFGEVARAALPDGDVWLL 64

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP T+MN SG++V  LA +Y++    IL+VHDE+ +P G ++ K   G+G HNG+K +  
Sbjct: 65  KPATFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGRIKFKLGGGNGGHNGLKDIQA 124

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
            L G   + RL +GIG+P     +  ++L K S   R+Q+D+A+ +  +A+
Sbjct: 125 KL-GTADYYRLRLGIGHPGDRNLVVGYVLNKPSTEHRRQIDDAVAKSLQAI 174



>sp|Q9JV42|PTH_NEIMA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|B81948|B81948 probable aminoacyl-tRNA
           hydrolase (EC 3.1.1.29) NMA1004 [imported] - Neisseria
           meningitidis (strain Z2491 serogroup
           A)>gb:NMA3Z2491_153929 Neisseria meningitidis serogroup
           A strain Z2491 complete genome; segment 3/7.
          Length = 192

 Score =  111 bits (278), Expect = 2e-23
 Identities = 62/171 (36%), Positives = 99/171 (57%), Gaps = 3/171 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP---VVLA 500
           +V GLGNPG +Y  TRHN GF  +D+++ +        + K   G  +   +P   V L 
Sbjct: 7   MVVGLGNPGKEYEQTRHNAGFWFLDELAWKWKASFK--EEKKFFGEVARATLPDGDVWLL 64

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP T+MN SG++V  LA +Y++    IL+VHDE+ +P G ++ K   G+G HNG+K +  
Sbjct: 65  KPTTFMNRSGQAVAALAQFYKIKPEEILVVHDELDIPCGRIKFKLGGGNGGHNGLKDIQA 124

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
            L G   + RL +GIG+P     +  ++L K S   R+Q+D+A+ +  +A+
Sbjct: 125 KL-GTADYYRLRLGIGHPGDRNLVVGYVLNKPSTEHRRQIDDAVAKSLQAI 174



>gb:CP000010_867220 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 201

 Score =  111 bits (277), Expect = 3e-23
 Identities = 69/189 (36%), Positives = 104/189 (55%), Gaps = 16/189 (8%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNT------IQSKALIGIGSIGEVPV 509
           L+ GLGNPG +Y  TRHN GF ++DQ+++E G  L          +KA +     GE  V
Sbjct: 4   LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFHGFYAKARL----FGE-EV 58

Query: 508 VLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKS 329
            L +PQTYMN SG++V  LA ++++    IL+ HDE+ LP G  +LK   G G HNG+K 
Sbjct: 59  HLLEPQTYMNRSGQAVVALAHFFKILPTEILVAHDELDLPPGAAKLKLGSGSGGHNGLKD 118

Query: 328 VMEHLDGCHQFPRLCIGIGNPPGAM----------DMKAFLLQKFSETERKQVDEALKEG 179
           +  HL    Q+ RL IGIG+P   +          D+  F+L+   + E+  +D A++  
Sbjct: 119 ISAHLSS-QQYWRLRIGIGHPRDLIPESARAGAKPDVANFVLKPPRKDEQDLIDAAIERA 177

Query: 178 AEAVRTLVR 152
              + T ++
Sbjct: 178 LAVMPTAIK 186



>gb:BX950851_840923 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 195

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/187 (33%), Positives = 99/187 (52%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D++++     L   +     G  S   +    V L 
Sbjct: 6   LIVGLANPGAEYAATRHNAGAWFVDRLAESYRQSLK--EESKFFGYTSRLNLAGQDVRLL 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++V  +A +Y++    IL+ HDE+ L  G+ +LK   GHG HNG+K ++ 
Sbjct: 64  VPTTFMNLSGKAVAAMATFYRIQPDEILVAHDELDLLPGIAKLKLGGGHGGHNGLKDIIS 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL IGIG+P     +  F+L K   +E+  +DEA+ E       L++E + 
Sbjct: 124 KLGNNPNFHRLRIGIGHPGDKSKVTGFVLGKPPMSEQTLIDEAIDEAVRCTEILMKEDMI 183

Query: 139 SRLSRFN 119
             ++R +
Sbjct: 184 KAMNRLH 190



>gb:BX248356_762184 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 3/8.
          Length = 184

 Score =  111 bits (277), Expect = 3e-23
 Identities = 59/178 (33%), Positives = 104/178 (58%), Gaps = 4/178 (2%)
 Frame = -1

Query: 679 TPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTI----QSKALIGIGSIGEVP 512
           +P+L+ GLGN G +Y  TRHN+G+  ID++      +  T+    ++  L+    +G   
Sbjct: 3   SPYLIVGLGNLGPEYTKTRHNIGYMAIDELLTRTSPMPATLTVHKKTNTLVAETRLGTQK 62

Query: 511 VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVK 332
           V++AKP+ +MN +G SV +LA ++ V    I++++D++ L  G ++ +   G   HNG+K
Sbjct: 63  VIVAKPRAFMNVTGPSVRKLADFFTVDRNRIVVLYDDLDLEFGAIKFRHGGGDHGHNGLK 122

Query: 331 SVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTL 158
           S+ + L G   + R  IGIG PPG M  K+F+L+ FS+ E+ ++     + A+ V  +
Sbjct: 123 SITQAL-GTKDYIRGGIGIGRPPGRMAPKSFVLKPFSKIEQSELPIVCADAADEVEKI 179



>gb:AJ749949_531137 Francisella tularensis subsp. tularensis
           complete genome.>gb:AY774127_2148840 Synthetic construct
           Francisella tularensis clone FLH156577.01X NT02FT1020
           gene, complete cds.
          Length = 191

 Score =  111 bits (277), Expect = 3e-23
 Identities = 63/165 (38%), Positives = 97/165 (58%), Gaps = 1/165 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           ++ GLGN G +Y  TRHNVG   I +I+Q+     ++       +   SI    VVL  P
Sbjct: 6   MIIGLGNIGKEYQDTRHNVGEWFIAKIAQDNNQSFSSNPKLNCNLAKVSIDYNNVVLVFP 65

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG +V ++A +Y++    IL+VHDE+ + +G +RLK   GHG HNG++S+ +HL
Sbjct: 66  TTYMNNSGLAVSKVANFYKIAPAEILVVHDELDIDSGEIRLKKGGGHGGHNGLRSINQHL 125

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEG 179
            G + + RL IGIG+P     +  ++L   S  ++K +D A+  G
Sbjct: 126 -GTNDYLRLRIGIGHPGHKSKVANYVLSNPSIAQKKDIDSAIDNG 169



>sp|P47329|PTH_MYCGE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|B64209|B64209 peptidyl-tRNA hydrolase homolog
           - Mycoplasma genitalium>gb:U39689_205493 Mycoplasma
           genitalium G-37 section 11 of 51 of the complete
           genome.>gb:L43967_1100645 Mycoplasma genitalium G-37,
           complete genome.
          Length = 189

 Score =  111 bits (277), Expect = 3e-23
 Identities = 68/192 (35%), Positives = 108/192 (56%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGN G KY  TRHN GF ++D+++      LN  ++  L     I E   +LAKP 
Sbjct: 6   LIVGLGNLGKKYEKTRHNAGFMVLDRLASL--FHLNFDKTNKLGDYLFIKEKAAILAKPA 63

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG  V  L  ++Q+PL +I++VHDE++   GV+RLK +    +HNG+KSV+ HLD
Sbjct: 64  TFMNNSGLFVKWLQDHFQIPLANIMIVHDEIAFDLGVIRLKMQGSANNHNGIKSVIRHLD 123

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
              QF RL  GI +   +  +   ++ +F  +E  +++ A+ +  E ++  +    G  L
Sbjct: 124 -TEQFNRLRFGIKSQNTSNILHEQVMSEFQNSELTKLEVAITKSVELLKRYIE---GEEL 179

Query: 130 SRFNIGQKYKYH 95
            R     +Y +H
Sbjct: 180 QRL---MEYYHH 188



>gb:CP000003_859930 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 204

 Score =  110 bits (276), Expect = 4e-23
 Identities = 58/175 (33%), Positives = 98/175 (56%), Gaps = 1/175 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           ++ GLGNPG+KY  T+HN+GF  ID I +   +     ++ KA IG   I    V   KP
Sbjct: 19  MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKP 78

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V  L  YY + +  +++++D++ +    LRL+ K   G HNG+KS++ H+
Sbjct: 79  TTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHI 138

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
            G  +F R+ +GIG P   M + + ++ +F+  +   +   L     AV+  ++E
Sbjct: 139 -GTQEFNRIKVGIGRPLKGMTVISHVMGQFNTEDNIAISLTLDRVVNAVKFYLQE 192



>sp|Q8P327|PTH_STRP8 Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE009953_257726 Streptococcus pyogenes strain
           MGAS8232, section 1 of 173 of the complete
           genome.>gb:AE009949_904108 Streptococcus pyogenes strain
           MGAS8232, complete genome.
          Length = 189

 Score =  110 bits (276), Expect = 4e-23
 Identities = 58/175 (33%), Positives = 98/175 (56%), Gaps = 1/175 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           ++ GLGNPG+KY  T+HN+GF  ID I +   +     ++ KA IG   I    V   KP
Sbjct: 4   MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V  L  YY + +  +++++D++ +    LRL+ K   G HNG+KS++ H+
Sbjct: 64  TTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHI 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
            G  +F R+ +GIG P   M + + ++ +F+  +   +   L     AV+  ++E
Sbjct: 124 -GTQEFNRIKVGIGRPLKGMTVISHVMGQFNTEDNIAISLTLDRVVNAVKFYLQE 177



>sp|Q9HVC3|PTH_PSEAE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|H83060|H83060 peptidyl-tRNA hydrolase PA4672
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004881_58906 Pseudomonas aeruginosa PAO1,
           section 442 of 529 of the complete
           genome.>gb:AE004091_973006 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 194

 Score =  110 bits (275), Expect = 5e-23
 Identities = 58/162 (35%), Positives = 96/162 (59%), Gaps = 1/162 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK-ALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG +Y  TRHN G   +++++  +G+ L   +    L+G  S     V L  P
Sbjct: 6   LIVGLGNPGPEYDQTRHNAGALFVERLAHAQGVSLVADRKYFGLVGKFSHQGKDVRLLIP 65

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG+SV  LA ++++    IL+ HDE+ +P GV +LK   GHG HNG++ ++  L
Sbjct: 66  TTYMNRSGQSVAALAGFFRIAPDAILVAHDELDMPPGVAKLKTGGGHGGHNGLRDIIAQL 125

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
              + F RL +GIG+P  +  +  ++L +   +E++ +D ++
Sbjct: 126 GNQNSFHRLRLGIGHPGHSSLVSGYVLGRAPRSEQELLDTSI 167



>sp|Q7V4V4|PTH_PROMM Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX572100_799177 Prochlorococcus marinus
           MIT9313 complete genome; segment 6/7.
          Length = 206

 Score =  110 bits (275), Expect = 5e-23
 Identities = 70/193 (36%), Positives = 110/193 (56%), Gaps = 10/193 (5%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK--ALIGIGSIGEVPVVLAK 497
           L+ GLGNPG+KY GTRHN+GF  +D+++ ++ +     Q+K   L+   ++G   V L  
Sbjct: 8   LLVGLGNPGSKYVGTRHNIGFMALDKLAAQKSVSFRP-QTKFHGLMAEVAVGSERVRLLM 66

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQTYMN SG ++     ++ + +  +L++ D+M L  G LRL+ +   G HNG++S ++H
Sbjct: 67  PQTYMNESGRAIRAAIDWFGLEVDQLLVLVDDMDLSLGRLRLRAQGSAGGHNGLRSAIQH 126

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMK-----AFLLQKFSETERKQVDEALKE---GAEAVRT 161
           L G   F RL IGIG P    + +     + +L  FS  E   VD+ L E   G + ++ 
Sbjct: 127 L-GTQDFCRLRIGIGAPGCTSEERRARTVSHVLGVFSRQESLLVDQVLDEVLMGLDLIQC 185

Query: 160 LVREGVGSRLSRF 122
           L  E  G+RL+ F
Sbjct: 186 LGLERAGNRLNAF 198



>sp|Q8EHN5|PTH_SHEON Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE015562_315593 Shewanella oneidensis MR-1
           section 111 of 457 of the complete
           genome.>gb:AE014299_951190 Shewanella oneidensis MR-1
           complete genome.
          Length = 195

 Score =  110 bits (274), Expect = 6e-23
 Identities = 63/186 (33%), Positives = 101/186 (54%), Gaps = 2/186 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK--ALIGIGSIGEVPVVLAK 497
           L+ GL NPG +Y  TRHN G   ++++++  G+ L    SK   L     +    V L  
Sbjct: 6   LIVGLANPGAEYVQTRHNAGAWYVEELARICGVSL-VADSKYFGLTARAVLHGKDVRLLI 64

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P TYMN SG++VG LA ++++    IL+ HDE+ +P GV + K   GHG HNG+K ++  
Sbjct: 65  PTTYMNLSGKAVGALANFFRITPEEILVAHDELDMPPGVAKFKLGGGHGGHNGLKDIIAK 124

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           L     F RL IGIG+P     +  ++L K    E++ ++ A+ E   +   L +E +  
Sbjct: 125 LANDKNFYRLRIGIGHPGDKNKVSGYVLGKAPAKEQELINAAVDEAVRSTEILFKEDMVK 184

Query: 136 RLSRFN 119
            ++R +
Sbjct: 185 AMTRLH 190



>sp|Q7NQT1|PTH_CHRVO Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016924_359017 Chromobacterium violaceum ATCC
           12472 section 15 of 16 of the complete
           genome.>gb:AE016825_1044171 Chromobacterium violaceum
           ATCC 12472 complete genome.
          Length = 193

 Score =  110 bits (274), Expect = 6e-23
 Identities = 65/162 (40%), Positives = 94/162 (58%), Gaps = 1/162 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQIS-QEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG +Y  TRHN GF ++D++  Q +G   +  +    +    I    V L KP
Sbjct: 6   LIVGLGNPGPEYEKTRHNAGFWLVDELCWQFKGNWRSEGKFHGDVARIQIEGQDVWLLKP 65

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG++V  LA +Y++    IL+VHDE+ L  GV R K   GHG HNG+K +   L
Sbjct: 66  MTYMNLSGQAVLALAHFYKILPDEILVVHDELDLAPGVARFKQGGGHGGHNGLKDIAARL 125

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
                F RL +GIG+P    ++  F+L+K    E++ +DEA+
Sbjct: 126 SS-PAFWRLRLGIGHPGDKKEVANFVLKKPRAEEQQALDEAV 166



>sp|Q9A206|PTH_STRPY Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE006472_219275 Streptococcus pyogenes M1 GAS,
           section 1 of 167 of the complete
           genome.>gb:AE004092_1105121 Streptococcus pyogenes M1
           GAS, complete genome.
          Length = 189

 Score =  109 bits (273), Expect = 8e-23
 Identities = 58/175 (33%), Positives = 97/175 (55%), Gaps = 1/175 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           ++ GLGNPG+KY  T+HN+GF  ID I +   +     ++ KA IG   I    V   KP
Sbjct: 4   MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVYFVKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V  L  YY + +  +++++D++ +    LRL+ K   G HNG+KS++ H+
Sbjct: 64  TTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHI 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
            G  +F R+ +GIG P   M +   ++ +F+  +   +   L     AV+  ++E
Sbjct: 124 -GTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYLQE 177



>sp|Q8K8Z7|PTH_STRP3 Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE014136_303482 Streptococcus pyogenes
           MGAS315, section 1 of 37 of the complete
           genome.>gb:BA000034_712929 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:AE014074_926661 Streptococcus
           pyogenes MGAS315, complete genome.
          Length = 189

 Score =  109 bits (273), Expect = 8e-23
 Identities = 58/175 (33%), Positives = 97/175 (55%), Gaps = 1/175 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           ++ GLGNPG+KY  T+HN+GF  ID I +   +     ++ KA IG   I    V   KP
Sbjct: 4   MIVGLGNPGSKYEKTKHNIGFMAIDNIVKNLDVTFTDDKNFKAQIGSTFINHEKVCFVKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V  L  YY + +  +++++D++ +    LRL+ K   G HNG+KS++ H+
Sbjct: 64  TTFMNNSGIAVKALLTYYNIDITDLIVIYDDLDMEVSKLRLRSKGSAGGHNGIKSIIAHI 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
            G  +F R+ +GIG P   M +   ++ +F+  +   +   L     AV+  ++E
Sbjct: 124 -GTQEFNRIKVGIGRPLKGMTVINHVMGQFNTEDNIAISLTLDRVVNAVKFYLQE 177



>sp|Q8F3Q2|PTH_LEPIN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE011404_272586 Leptospira interrogans serovar
           lai str. 56601 chromosome I, section 213 of 397 of the
           complete sequence.>gb:AE017293_433802 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, section 7 of 14 of the complete
           sequence.>gb:AE010300_1005985 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1066813 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 190

 Score =  109 bits (272), Expect = 1e-22
 Identities = 57/174 (32%), Positives = 95/174 (54%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ G+GNPG KY   RHN+GF ++D +     +   T    +L      G V +   KP 
Sbjct: 7   LLVGIGNPGQKYVHNRHNIGFVILDSLLDSSSVSYQTNSKYSLARTDEDG-VTIFYLKPL 65

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
            +MN SG+SV ++A    +   +IL++HDE+    G L+LK   GH  HNG+++++E L 
Sbjct: 66  EFMNLSGKSVAEIAKKNGISPENILIIHDEIDFEFGKLKLKGGGGHAGHNGLRNIVEKL- 124

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
           G + F RL  G+G P    ++  ++L  F   E++++ E +K   + +   +RE
Sbjct: 125 GTNTFFRLRFGVGKPSITSEVPDYVLSNFLPNEKEKIPELVKVSLQKISDWIRE 178



>gb:BX571965_790297 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 201

 Score =  108 bits (271), Expect = 1e-22
 Identities = 68/189 (35%), Positives = 104/189 (55%), Gaps = 16/189 (8%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNT------IQSKALIGIGSIGEVPV 509
           L+ GLGNPG +Y  TRHN GF ++DQ+++E G  L          +KA +     GE  V
Sbjct: 4   LIVGLGNPGAEYTATRHNAGFWLVDQLAREAGATLRDERRFHGFYAKARL----FGE-EV 58

Query: 508 VLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKS 329
            L +PQTYMN SG++V  LA ++++    IL+ HDE+ LP G  +LK   G G HNG+K 
Sbjct: 59  HLLEPQTYMNRSGQAVVALAHFFKILPTEILVAHDELDLPPGAAKLKLGGGSGGHNGLKD 118

Query: 328 VMEHLDGCHQFPRLCIGIGNPPGAM----------DMKAFLLQKFSETERKQVDEALKEG 179
           +  HL    Q+ RL IGIG+P   +          D+  F+L+   + E+  ++ A++  
Sbjct: 119 ISAHLSS-QQYWRLRIGIGHPRDLIPESARAGAKPDVANFVLKPPRKDEQDLINAAIERA 177

Query: 178 AEAVRTLVR 152
              + T ++
Sbjct: 178 LAVMPTAIK 186



>sp|Q8KD05|PTH_CHLTE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE012885_286724 Chlorobium tepidum TLS section
           106 of 194 of the complete genome.>gb:AE006470_933892
           Chlorobium tepidum TLS complete genome.
          Length = 187

 Score =  108 bits (271), Expect = 1e-22
 Identities = 57/184 (30%), Positives = 103/184 (55%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNP  ++  TRHN+GF++ID ++            +        G  P++L KP 
Sbjct: 3   LIVGLGNPELRHAATRHNIGFDVIDHLAGSSTFSSGKGNYRFTKITAPGG--PLILVKPM 60

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG +V     ++++   ++L++ D++++P G +R++ K   G  NG+K +++ L 
Sbjct: 61  TYMNLSGHAVVAAMNFWKIERENLLVICDDVNIPLGTIRIRAKGSAGGQNGLKHIIQSL- 119

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
           G  +F RL +G+G       + +F+L KF+  ERK +D+ +   A+AV      GV   +
Sbjct: 120 GSEEFARLRVGVGGENMPASLSSFVLSKFTAEERKCIDKVIPVCADAVLDFASLGVEHAM 179

Query: 130 SRFN 119
           +++N
Sbjct: 180 TKYN 183



>gb:AP006841_571723 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 187

 Score =  108 bits (269), Expect = 2e-22
 Identities = 60/185 (32%), Positives = 99/185 (53%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +L+ GLGN G +YH TRHN+GF ++D +++   +     +      +   G   ++L KP
Sbjct: 3   YLIVGLGNIGPEYHETRHNIGFMVLDALARANNLSFTDGRYGFTTTLSVKGR-QMILLKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V        +PL ++L++ D+++LP G LRLK K     HNG+K +   L
Sbjct: 62  STFMNLSGNAVRYWMQKENIPLENVLIIVDDLALPFGTLRLKSKGSDAGHNGLKHIATIL 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G   + RL  GIGN         F+L  F++ + K +DE L+   E  ++    G+   
Sbjct: 122 -GTQNYARLRFGIGNDFPRGGQIDFVLGHFTDEDWKTMDERLETAGEIAKSFCLAGIDIT 180

Query: 133 LSRFN 119
           +++FN
Sbjct: 181 MNQFN 185



>gb:AL646059_545321 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 3/19.
          Length = 217

 Score =  108 bits (269), Expect = 2e-22
 Identities = 66/183 (36%), Positives = 100/183 (54%), Gaps = 11/183 (6%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL-NTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG +Y  TRHN GF ++DQ+++   + L N  +        ++    V L +P
Sbjct: 21  LIVGLGNPGAEYAATRHNAGFWLVDQLARMGHVTLRNETRFHGYAARATLWSHEVWLLQP 80

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QT+MN SG +   LA +Y++    IL+VHDE+ L  G ++LK   G G HNG+K +  HL
Sbjct: 81  QTFMNRSGLATVALARFYKILPDEILVVHDELDLLPGAVKLKLGGGSGGHNGLKDIAAHL 140

Query: 313 DGCHQFPRLCIGIGN----------PPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVR 164
               QF RL +GIG+          P G  D+  F+L+     E++ +D A+    +A+ 
Sbjct: 141 T-TQQFWRLRVGIGHPRNLLPPGTAPSGQHDVANFVLKAPRREEQELIDRAIDRSLDALP 199

Query: 163 TLV 155
            LV
Sbjct: 200 DLV 202



>sp|Q8Y2E3|PTH_RALSO Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).
          Length = 200

 Score =  108 bits (269), Expect = 2e-22
 Identities = 66/183 (36%), Positives = 100/183 (54%), Gaps = 11/183 (6%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL-NTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG +Y  TRHN GF ++DQ+++   + L N  +        ++    V L +P
Sbjct: 4   LIVGLGNPGAEYAATRHNAGFWLVDQLARMGHVTLRNETRFHGYAARATLWSHEVWLLQP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QT+MN SG +   LA +Y++    IL+VHDE+ L  G ++LK   G G HNG+K +  HL
Sbjct: 64  QTFMNRSGLATVALARFYKILPDEILVVHDELDLLPGAVKLKLGGGSGGHNGLKDIAAHL 123

Query: 313 DGCHQFPRLCIGIGN----------PPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVR 164
               QF RL +GIG+          P G  D+  F+L+     E++ +D A+    +A+ 
Sbjct: 124 T-TQQFWRLRVGIGHPRNLLPPGTAPSGQHDVANFVLKAPRREEQELIDRAIDRSLDALP 182

Query: 163 TLV 155
            LV
Sbjct: 183 DLV 185



>sp|Q88PX8|PTH_PSEPK Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016776_330159 Pseudomonas putida KT2440
           section 3 of 21 of the complete
           genome.>gb:AE015451_945236 Pseudomonas putida KT2440
           complete genome.
          Length = 194

 Score =  108 bits (269), Expect = 2e-22
 Identities = 60/164 (36%), Positives = 94/164 (57%), Gaps = 3/164 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIG---SIGEVPVVLA 500
           L+ GLGNPG +Y  TRHN G   +++++  + + L     K   G+    S     V L 
Sbjct: 6   LIVGLGNPGPEYEQTRHNAGALFVERLASAQRVSLTA--DKKYFGLTAKFSHQGNDVRLL 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P TYMN SG+SV  LA ++++    IL+ HDE+ LP GV +LK   GHG HNG++ ++ 
Sbjct: 64  IPTTYMNRSGQSVAALANFFRIKPEAILVAHDELDLPPGVAKLKRGGGHGGHNGLRDIIA 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
            L   + F RL +GIG+P  A  +  F+L +    E++++D ++
Sbjct: 124 QLGNQNDFHRLRLGIGHPGDAKLVSNFVLGRAPRAEQEKLDASI 167



>gb:BX927150_832520 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment 3/10.
          Length = 201

 Score =  107 bits (267), Expect = 4e-22
 Identities = 70/196 (35%), Positives = 102/196 (52%), Gaps = 2/196 (1%)
 Frame = -1

Query: 718 ASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQI--SQEEGILLNTIQSKA 545
           A  PE   AK     WLV GLGNPG KY  TRHNVG+   D +  + ++  L      KA
Sbjct: 12  APKPELPAAK-----WLVVGLGNPGAKYESTRHNVGYMCQDMLIDAHQQQPLTPATGYKA 66

Query: 544 LIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKP 365
           L    + G   V+  +  T+MN SG+ V  +AA   +P   I+++HDE+ LP G +RLK 
Sbjct: 67  LTTQLAPG---VLAVRSTTFMNHSGQGVAPIAAALGIPAERIIVIHDELDLPAGKVRLKK 123

Query: 364 KRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALK 185
                 HNG+KS+ E L G   + R+ IGI  PP  M +  ++L+     +       ++
Sbjct: 124 GGNENGHNGLKSLTEEL-GTRDYLRVRIGISRPPAGMAVPDYVLEPVDHDQ-----PGIE 177

Query: 184 EGAEAVRTLVREGVGS 137
             AEAV  L+ +G+ +
Sbjct: 178 LAAEAVDLLLAQGLSA 193



>gb:AE017263_420629 Mesoplasma florum L1 complete genome.
          Length = 186

 Score =  107 bits (267), Expect = 4e-22
 Identities = 55/162 (33%), Positives = 90/162 (55%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGN G++Y  TRHN G+  +DQ+ ++ G      +  ++I   ++    V+  KPQ
Sbjct: 3   LIVGLGNYGSQYEATRHNAGWIALDQLIEKYGFTQQKNEHNSIIFFSTVNNEKVLFVKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG ++  +  YY++ ++ ++++HDE   P G  + K       HNG+KSV+++L 
Sbjct: 63  TYMNNSGIAIQAIMHYYKIEIKDLVILHDEKDFPVGKNQFKMNGSAAGHNGIKSVIQYL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALK 185
           G   F R  IGIG P     +  ++L KF   E + +  A K
Sbjct: 122 GTQNFNRYRIGIGQPEQGWKIIDWVLSKFKPEELENIILASK 163



>sp|Q8DWN5|PTH_STRMU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE014853_312471 Streptococcus mutans UA159
           section 1 of 185 of the complete
           genome.>gb:AE014133_939472 Streptococcus mutans UA159
           complete genome.
          Length = 189

 Score =  107 bits (267), Expect = 4e-22
 Identities = 57/169 (33%), Positives = 96/169 (56%), Gaps = 1/169 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG+KYH T+HNVGF  +D+I +   +     ++ KA      I    +   KP
Sbjct: 4   LIVGLGNPGSKYHETKHNVGFMALDRIVKPLNVQFTENKTFKAETVATFINGEKIYFIKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V    AYY + +  +++++D++ +  G +R + K   G HNG+KS+++ +
Sbjct: 64  TTFMNASGLAVRAFLAYYNLTVEDLIVIYDDLDMEVGKIRFRQKGSAGGHNGIKSIIKEI 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
            G  +F R+ IGIG P   M +  ++L KF + +   +   L +  +AV
Sbjct: 124 -GTQEFDRIKIGIGRPKDKMTVVNYVLGKFDKKDEITIFNTLDKVDKAV 171



>sp|Q8NRV6|PTH2_CORGL Peptidyl-tRNA hydrolase 2 (EC 3.1.1.29) (PTH
           2).>gb:BA000036_718662 Corynebacterium glutamicum ATCC
           13032 DNA, complete genome.
          Length = 204

 Score =  107 bits (267), Expect = 4e-22
 Identities = 70/196 (35%), Positives = 102/196 (52%), Gaps = 2/196 (1%)
 Frame = -1

Query: 718 ASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQI--SQEEGILLNTIQSKA 545
           A  PE   AK     WLV GLGNPG KY  TRHNVG+   D +  + ++  L      KA
Sbjct: 15  APKPELPAAK-----WLVVGLGNPGAKYESTRHNVGYMCQDMLIDAHQQQPLTPATGYKA 69

Query: 544 LIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKP 365
           L    + G   V+  +  T+MN SG+ V  +AA   +P   I+++HDE+ LP G +RLK 
Sbjct: 70  LTTQLAPG---VLAVRSTTFMNHSGQGVAPIAAALGIPAERIIVIHDELDLPAGKVRLKK 126

Query: 364 KRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALK 185
                 HNG+KS+ E L G   + R+ IGI  PP  M +  ++L+     +       ++
Sbjct: 127 GGNENGHNGLKSLTEEL-GTRDYLRVRIGISRPPAGMAVPDYVLEPVDHDQ-----PGIE 180

Query: 184 EGAEAVRTLVREGVGS 137
             AEAV  L+ +G+ +
Sbjct: 181 LAAEAVDLLLAQGLSA 196



>gb:BX248356_762181 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 3/8.
          Length = 180

 Score =  107 bits (266), Expect = 5e-22
 Identities = 64/179 (35%), Positives = 99/179 (55%), Gaps = 6/179 (3%)
 Frame = -1

Query: 661 GLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEV------PVVLA 500
           GLGNPG +Y  TRHNVG+ ++D+       LL   + + L G  + G V       V++ 
Sbjct: 2   GLGNPGVRYASTRHNVGYMVVDE-------LLGPAELRPLRGFKASGAVIEVGGCRVLVV 54

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           +  T+MN SGE+VG +   Y V   H+++VHDE+ LP   +R+K       HNG+KSV +
Sbjct: 55  RSSTFMNTSGEAVGPIVQEYGVSPDHVVVVHDELDLPAHKVRVKVGGNENGHNGLKSVSQ 114

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGV 143
            L G   + R+ +GIG PP    +  ++L      E   +D A++ GA+A+R ++  GV
Sbjct: 115 WL-GTRDYVRIRVGIGRPPRGGTVPDYVLGALDSGE--VLDAAVRCGADAIRLVIERGV 170



>sp|Q7VDT7|PTH_PROMA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE017161_394739 Prochlorococcus marinus subsp.
           marinus str. CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030408 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 204

 Score =  107 bits (266), Expect = 5e-22
 Identities = 68/192 (35%), Positives = 103/192 (53%), Gaps = 8/192 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+AGLGNPG+KY  TRHNVGF  +++++++E +      +K + G  +   IG     L 
Sbjct: 8   LLAGLGNPGSKYTSTRHNVGFMALERLAKKESVQF--AMNKKIFGHIANIEIGANKRKLL 65

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P TYMN SG S+     ++ + +  IL+  D+M LP G LR +   G G HNG+K +++
Sbjct: 66  MPNTYMNESGRSISAAIKWFDLEINQILIFVDDMDLPLGKLRFREGGGSGGHNGLKDIIK 125

Query: 319 HLDGCHQFPRLCIGIGNP---PGAMDMKAF--LLQKFSETERKQVDEALKEGAEAVRTLV 155
           HL G   F RL IGIG P    G    K    +L KF + E K + + L +  + +  + 
Sbjct: 126 HL-GSQDFCRLRIGIGPPSINQGDRKQKTIPHVLGKFDQAESKVITKVLDKVIKGLEVIE 184

Query: 154 REGVGSRLSRFN 119
           + G+    S  N
Sbjct: 185 QYGLVKGTSFLN 196



>gb:AE017197_402563 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 185

 Score =  106 bits (265), Expect = 7e-22
 Identities = 60/162 (37%), Positives = 92/162 (56%), Gaps = 1/162 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           LV GLGNPG  Y  TRHN+GF  I++I+ +  +  +T Q     I    I    +   KP
Sbjct: 3   LVIGLGNPGIVYQYTRHNIGFIAIERIANKYHLSFSTKQKFNCKIAEAIIDRQKICFIKP 62

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG+SV  +  YY +    + ++HD++ L  G ++ K    +G HNG+KS+ + +
Sbjct: 63  TTYMNLSGKSVILVKTYYNINYEKVFVIHDDIDLEIGRIKFKTGGSNGGHNGLKSI-DSI 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
            G H + R+ IGIG P    D+  ++L  FSE+E K V +++
Sbjct: 122 IGSH-YNRIRIGIGRPQNNHDVADYVLSNFSESEYKTVMQSI 162



>sp|Q9CJI1|PTH_LACLA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|D86626|D86626 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) [imported] - Lactococcus lactis subsp. lactis
           (strain IL1403)>gb:AE006240_216914 Lactococcus lactis
           subsp. lactis IL1403 section 2 of 218 of the complete
           genome.>gb:AE005176_1093987 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 188

 Score =  106 bits (265), Expect = 7e-22
 Identities = 58/186 (31%), Positives = 101/186 (54%), Gaps = 2/186 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           ++ GLGNPG+KY  T+HN+GF  +D +++E  +     +   +L+    +    + L KP
Sbjct: 4   MIVGLGNPGDKYEKTKHNMGFMALDLLAKELNVDFKEEKPFMSLVASTFVNGEKLFLVKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG SV  L  YY +    + ++HD++  P G +RL+ K   G  NG+KSV+ H+
Sbjct: 64  LTFMNESGRSVAPLLKYYNIDEADLTVMHDDLDSPVGRVRLRQKGSSGGQNGIKSVITHV 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG-VGS 137
            G   F R+ IGIG P   M +   +L  F   +++   + + +  +A++  +  G    
Sbjct: 124 -GSQTFNRVKIGIGRPKHGMTVGNHVLSGFDNEDKEIAQDGIFKAVDAMKFYLENGDFQK 182

Query: 136 RLSRFN 119
            +++FN
Sbjct: 183 TMNKFN 188



>gb:AE013832_300598 Yersinia pestis KIM section 232 of 415 of the
           complete genome.>gb:AE017134_387656 Yersinia pestis
           biovar Medievalis str. 91001 section 8 of 16 of the
           complete genome.>gb:AE009952_930781 Yersinia pestis KIM
           complete genome.>gb:AE017042_1144222 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 206

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/187 (31%), Positives = 98/187 (52%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D +++     L   +     G  +   +    + L 
Sbjct: 16  LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLK--EESKFFGYTARLNLAGQDIRLL 73

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++V  +A++Y++    IL+ HDE+ +  G+ +LK   G+G HNG+K +  
Sbjct: 74  VPATFMNLSGKAVAAMASFYRILPEEILVAHDELDILPGMAKLKLGGGNGGHNGLKDIQN 133

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL IGIG+P     +  F+L K   +E+  +D+A+ E       L+ EG+ 
Sbjct: 134 KLGNNPNFYRLRIGIGHPGDKSKVTGFVLGKPPASEQTLIDDAIDESIRCTEVLLNEGMT 193

Query: 139 SRLSRFN 119
             ++R +
Sbjct: 194 KAMNRLH 200



>sp|Q8ZEY4|PTH_YERPE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|AE0245|AE0245 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) [imported] - Yersinia pestis (strain
           CO92)>gb:AJ414151_523818 Yersinia pestis strain CO92
           complete genome; segment 11/20.>gb:BX936398_836642
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.
          Length = 196

 Score =  106 bits (264), Expect = 9e-22
 Identities = 59/187 (31%), Positives = 98/187 (52%), Gaps = 3/187 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NPG +Y  TRHN G   +D +++     L   +     G  +   +    + L 
Sbjct: 6   LIVGLANPGAEYAQTRHNAGAWYVDLLAERHNQSLK--EESKFFGYTARLNLAGQDIRLL 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG++V  +A++Y++    IL+ HDE+ +  G+ +LK   G+G HNG+K +  
Sbjct: 64  VPATFMNLSGKAVAAMASFYRILPEEILVAHDELDILPGMAKLKLGGGNGGHNGLKDIQN 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L     F RL IGIG+P     +  F+L K   +E+  +D+A+ E       L+ EG+ 
Sbjct: 124 KLGNNPNFYRLRIGIGHPGDKSKVTGFVLGKPPASEQTLIDDAIDESIRCTEVLLNEGMT 183

Query: 139 SRLSRFN 119
             ++R +
Sbjct: 184 KAMNRLH 190



>sp|Q7N5A1|PTH_PHOLL Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX571865_786912 Photorhabdus luminescens
           subsp. laumondii TTO1 complete genome; segment 7/17.
          Length = 196

 Score =  106 bits (264), Expect = 9e-22
 Identities = 63/186 (33%), Positives = 98/186 (52%), Gaps = 2/186 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEV--PVVLAK 497
           L+ GL NPG +Y  TRHN G   +D +++     L   +SK       I      V L  
Sbjct: 6   LIVGLANPGAEYAQTRHNAGAWYVDLLARSHNQSLKE-ESKFFGYTARINICGHDVRLLV 64

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG+SV  LA++Y++    IL+ HDE+ LP GV ++K    HG HNG+K +   
Sbjct: 65  PTTFMNLSGKSVVALASFYRIQPDEILVAHDELDLPPGVAKMKLGGSHGGHNGLKDIQNK 124

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
                 F RL IGIG+P     +  F+L K   +E++ +D+A+ E       L+++ +  
Sbjct: 125 FGNNPNFYRLRIGIGHPGDKNKVVGFVLGKPPASEQQLIDDAIDEARRCTDILMKQDMDK 184

Query: 136 RLSRFN 119
            ++R +
Sbjct: 185 AINRLH 190



>sp|Q8EWQ8|PTH_MYCPE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000026_693496 Mycoplasma penetrans HF-2 DNA,
           complete genome.
          Length = 187

 Score =  106 bits (264), Expect = 9e-22
 Identities = 60/187 (32%), Positives = 105/187 (56%), Gaps = 1/187 (0%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +LV GLGNPG +Y  T+HNVGF  ID++ +E  + LN  +           E  + +AKP
Sbjct: 4   YLVVGLGNPGLEYEKTKHNVGFMCIDELLKEHTLFLNNSKFNGQFVKVDQPEDQIFIAKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SGE V ++  +Y++  ++IL+++D++    G +R+K K   G  NG+KS++  +
Sbjct: 64  MTYMNNSGEFVYEICKFYKIHEQNILVIYDDIDTDVGKIRVKAKGSSGGQNGIKSIISKM 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE-GVGS 137
           +   +  R+ IGIG P    ++   +L KFS  +  +V +A+ +  +A    +       
Sbjct: 124 N-TEKIKRIRIGIGKP--VHNLTHHVLTKFSAEDSIKVQQAIIKAKDACNEFLNHVDFDK 180

Query: 136 RLSRFNI 116
            +++FN+
Sbjct: 181 IMNKFNV 187



>sp|Q89YZ2|PTH_BACTN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016945_363954 Bacteroides thetaiotaomicron
           VPI-5482, section 20 of 21 of the complete
           genome.>gb:AE015928_990442 Bacteroides thetaiotaomicron
           VPI-5482, complete genome.
          Length = 189

 Score =  106 bits (264), Expect = 9e-22
 Identities = 61/185 (32%), Positives = 98/185 (52%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +L+ GLGN G +YH TRHN+GF  ++ +++                  SI    ++L KP
Sbjct: 4   YLIVGLGNIGPEYHETRHNIGFMTVEALARINNAPPFIDGRYGFTTSFSIKGRQLILLKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG +V        +PL ++L+V D+++LP G LRLK K     HNG+K +   L
Sbjct: 64  STFMNLSGLAVRYWMQKENIPLENVLIVVDDLALPFGTLRLKGKGSDAGHNGLKHIAAIL 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G   + RL  GIGN         ++L  F++ +RK +DE L+   E +++    G+   
Sbjct: 124 -GTQNYARLRFGIGNDFPKGGQIDYVLGHFTDEDRKTMDERLETAGEIIKSFCLAGIDIT 182

Query: 133 LSRFN 119
           +++FN
Sbjct: 183 MNQFN 187



>gb:AP006628_566587 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 188

 Score =  105 bits (262), Expect = 2e-21
 Identities = 59/158 (37%), Positives = 97/158 (61%), Gaps = 1/158 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQ-ISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNPG K+  TRHNVGF ++D  +SQ +  +L   ++  +  I +      +L KP
Sbjct: 3   LIVGLGNPGTKFVNTRHNVGFAVVDSFLSQNKYQILKEDKTDHIYQI-NFNHHQSLLIKP 61

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QTYMN SGE V ++   Y++ + +IL++ D++ L  G L+LK + GHG HNG++++++ L
Sbjct: 62  QTYMNLSGEVVKKIINKYRIKIENILVIVDDIYLDEGKLKLKMQGGHGGHNGLRNIIDRL 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQV 200
            G  QF RL IG+ +    M +  +LL   + + +K +
Sbjct: 122 -GTKQFKRLKIGV-SLDSCMPLDQYLLTPVNASSQKNI 157



>gb:CR925677_117344 Ehrlichia ruminantium str. Gardel, complete
           genome.
          Length = 215

 Score =  105 bits (262), Expect = 2e-21
 Identities = 60/152 (39%), Positives = 86/152 (56%), Gaps = 2/152 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK--ALIGIGSIGEVPVVLAK 497
           L+ GLGNPG +Y  TRHNVGF +ID I      L    + K  ALI  GSI    V+LAK
Sbjct: 26  LLVGLGNPGKEYELTRHNVGFMIIDAIMHH--FLFPDFKKKHNALISSGSIQSYKVILAK 83

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG  +  +   Y++PL +I++ HDE  +    +R+K   G+  HNG+KS+   
Sbjct: 84  PYTFMNNSGAPISSIVKLYKIPLDNIIVFHDETDIDFCTIRIKKGGGNAGHNGLKSIDTL 143

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFS 221
           L     + R+  GIG+P    D+   +L +F+
Sbjct: 144 LG--RDYWRIRFGIGHPSNGYDLSYHVLSQFN 173



>sp|Q9ZCV4|PTH_RICPR Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|G71665|G71665 peptidyl-tRNA hydrolase (pth)
           RP605 - Rickettsia prowazekii>gb:RPXX03_167383
           Rickettsia prowazekii strain Madrid E, complete genome;
           segment 3/4.
          Length = 185

 Score =  105 bits (261), Expect = 2e-21
 Identities = 58/156 (37%), Positives = 90/156 (57%), Gaps = 1/156 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           LV GLGNPG +Y  TRHN+GF  I++I+ +  +  +  +     I    I    ++  KP
Sbjct: 3   LVIGLGNPGTEYQYTRHNIGFIAIERIASKYHLSFSIKKKFNCEIAEAVIDRQKIIFIKP 62

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG+SV  +  YY +    + ++HD++ L  G ++ K   G+G HNG+KS+ + +
Sbjct: 63  TTYMNLSGKSVILVKTYYNIKYEKVFVIHDDIDLEIGRIKFKTGGGNGGHNGLKSI-DVV 121

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERK 206
            G H + R+ IGIG P    D+  ++L  FSE+E K
Sbjct: 122 IGNH-YNRIRIGIGRPKNNHDVADYVLNNFSESEYK 156



>gb:BX572607_803968 Rhodopseudomonas palustris CGA009 complete
           genome; segment 15/16.
          Length = 206

 Score =  104 bits (260), Expect = 3e-21
 Identities = 62/175 (35%), Positives = 97/175 (55%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L  GLGNPG KY G RHN+GF +ID+I++  G      + +     G +    + L KP 
Sbjct: 3   LFVGLGNPGAKYQGNRHNIGFMVIDEIARRHGFSPWRRRFQGETADGVLDGERITLLKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG +V   A++Y++    I + HDE+ LP   +R+K   G   HNG++S+  H+ 
Sbjct: 63  TYMNESGRAVQDAASFYKIGQNEIAVFHDEIELPPAKVRVKVGGGIAGHNGLRSISAHIG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
             + + R+ +G+G+P     +   +L  F+++ER  V EAL E A     L+ +G
Sbjct: 123 --NDYLRVRLGVGHPGAKELVHNHVLGDFAKSERPWV-EALCEIAADNAGLIAKG 174



>gb:CR925678_118298 Ehrlichia ruminantium str. Welgevonden, complete
           genome.
          Length = 215

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/152 (39%), Positives = 86/152 (56%), Gaps = 2/152 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK--ALIGIGSIGEVPVVLAK 497
           L+ GLGNPG +Y  TRHNVGF +ID I      L    + K  ALI  GSI    V+LAK
Sbjct: 26  LLVGLGNPGKEYELTRHNVGFMIIDAIMHH--FLFPDFKKKHNALISSGSIRSHKVILAK 83

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG  +  +   Y++PL +I++ HDE  +    +R+K   G+  HNG+KS+   
Sbjct: 84  PYTFMNNSGTPISSIVKLYKIPLDNIIVFHDETDIDFCTIRIKKGGGNAGHNGLKSIDTL 143

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFS 221
           L     + R+  GIG+P    D+   +L +F+
Sbjct: 144 LG--RDYWRIRFGIGHPSNGYDLSYHVLSQFN 173



>gb:CR767821_116438 Ehrlichia ruminantium strain Welgevonden,
           complete genome.
          Length = 193

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/152 (39%), Positives = 86/152 (56%), Gaps = 2/152 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK--ALIGIGSIGEVPVVLAK 497
           L+ GLGNPG +Y  TRHNVGF +ID I      L    + K  ALI  GSI    V+LAK
Sbjct: 4   LLVGLGNPGKEYELTRHNVGFMIIDAIMHH--FLFPDFKKKHNALISSGSIRSHKVILAK 61

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG  +  +   Y++PL +I++ HDE  +    +R+K   G+  HNG+KS+   
Sbjct: 62  PYTFMNNSGTPISSIVKLYKIPLDNIIVFHDETDIDFCTIRIKKGGGNAGHNGLKSIDTL 121

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFS 221
           L     + R+  GIG+P    D+   +L +F+
Sbjct: 122 LG--RDYWRIRFGIGHPSNGYDLSYHVLSQFN 151



>gb:BA000035_715789 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 231

 Score =  103 bits (256), Expect = 8e-21
 Identities = 65/198 (32%), Positives = 106/198 (53%), Gaps = 3/198 (1%)
 Frame = -1

Query: 721 SASLPE-PNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQI-SQEEGILLNTIQSK 548
           S+  PE P+ A++    WLV GLGNPG KY  TRHNVG+  +D +    +   L  ++  
Sbjct: 32  SSRTPEVPDLAELPEARWLVVGLGNPGVKYEATRHNVGYMCVDTLLGTHDAPPLTPVRGL 91

Query: 547 ALIGIGSIGEVPVVLA-KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRL 371
            ++           LA +  T+MN SG+ V  LA    +P   I+++HDE+ LP G +R+
Sbjct: 92  KVLTTPLPDAADSALAVRSTTFMNHSGQGVAPLAQTLGIPPERIIVIHDELDLPAGKVRV 151

Query: 370 KPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEA 191
           K       HNG+KS+ + L G   + R+ IGI  PP  M +  ++L+  ++ ++  +D A
Sbjct: 152 KKGGNENGHNGLKSLTQEL-GTRDYLRVRIGISRPPQGMSVPDYVLEPVAD-QQPGIDVA 209

Query: 190 LKEGAEAVRTLVREGVGS 137
               A+AV  ++  G+ +
Sbjct: 210 ----ADAVDLIIARGLAA 223



>gb:AE016969_369935 Mycoplasma gallisepticum strain R section 3 of 4
           of the complete genome.>gb:AE015450_1034584 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 188

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/161 (36%), Positives = 91/161 (56%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y  TRHN+GF++ID++     + LN  Q   L     +     ++AKP 
Sbjct: 8   LIVGLGNPGFEYEHTRHNIGFKIIDKLLDVLNLELNKSQFNGLY----VKHDDFIIAKPL 63

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG  + QL  +Y++ +  IL++HDE++   GV+RLK         GV +++  L 
Sbjct: 64  TYMNLSGNFIRQLVNFYKIQIDDILVIHDELAFNLGVVRLKQNGSANGQKGVANIISQL- 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
           G   F RL +GI N     ++ +F+L KF+  E   ++ A+
Sbjct: 123 GTQNFKRLRVGIKN-EDLKNIASFVLSKFAPNELILLESAI 162



>sp|Q8RLD7|PTH_MYCGA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AY081866_588132 Mycoplasma gallisepticum
           DNA-directed RNA polymerase subunit delta (rpoE),
           fructose-bisphosphate aldolase (fba), GTP-binding
           protein, thymidine kinase (tdk), 50S ribosomal protein
           L11 (rpl11), 50S ribosomal protein L1 (rpl1), and
           peptidyl-tRNA hydrolase (pth) genes, complete cds;
           MG083-like protein gene, partial cds; and unknown gene.
          Length = 183

 Score =  103 bits (256), Expect = 8e-21
 Identities = 58/161 (36%), Positives = 91/161 (56%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y  TRHN+GF++ID++     + LN  Q   L     +     ++AKP 
Sbjct: 3   LIVGLGNPGFEYEHTRHNIGFKIIDKLLDVLNLELNKSQFNGLY----VKHDDFIIAKPL 58

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG  + QL  +Y++ +  IL++HDE++   GV+RLK         GV +++  L 
Sbjct: 59  TYMNLSGNFIRQLVNFYKIQIDDILVIHDELAFNLGVVRLKQNGSANGQKGVANIISQL- 117

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
           G   F RL +GI N     ++ +F+L KF+  E   ++ A+
Sbjct: 118 GTQNFKRLRVGIKN-EDLKNIASFVLSKFAPNELILLESAI 157



>gb:BX640420_807518 Bordetella pertussis strain Tohama I, complete
           genome; segment 10/12.
          Length = 198

 Score =  102 bits (255), Expect = 1e-20
 Identities = 63/169 (37%), Positives = 92/169 (54%), Gaps = 8/169 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP-----VV 506
           L+ GLGNPG  Y  TRHN GF + D ++ +    L T  +      G + +       VV
Sbjct: 7   LIVGLGNPGPDYETTRHNAGFWLADHLADD----LRTAFALEKGFFGMLAKARHAGENVV 62

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           L KP TYMN SG+SVG +A +Y++    +L++HDE+ L  G +++K   GH  HNG+K +
Sbjct: 63  LLKPITYMNRSGQSVGAVACFYKLAPEQVLVLHDELDLLPGQVKIKQGGGHAGHNGLKDI 122

Query: 325 MEHLDGCHQFPRLCIGIGNPPG---AMDMKAFLLQKFSETERKQVDEAL 188
              L G   F RL IGIG+P     A  +  F+L      E++Q+D  +
Sbjct: 123 QAAL-GSPNFWRLRIGIGHPRSLGLAQQVADFVLHPPCREEQQQIDTVI 170



>sp|Q7VUH3|PTH_BORPE Peptidyl-tRNA hydrolase (EC 3.1.1.29) (PTH).
          Length = 215

 Score =  102 bits (255), Expect = 1e-20
 Identities = 63/169 (37%), Positives = 92/169 (54%), Gaps = 8/169 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP-----VV 506
           L+ GLGNPG  Y  TRHN GF + D ++ +    L T  +      G + +       VV
Sbjct: 24  LIVGLGNPGPDYETTRHNAGFWLADHLADD----LRTAFALEKGFFGMLAKARHAGENVV 79

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           L KP TYMN SG+SVG +A +Y++    +L++HDE+ L  G +++K   GH  HNG+K +
Sbjct: 80  LLKPITYMNRSGQSVGAVACFYKLAPEQVLVLHDELDLLPGQVKIKQGGGHAGHNGLKDI 139

Query: 325 MEHLDGCHQFPRLCIGIGNPPG---AMDMKAFLLQKFSETERKQVDEAL 188
              L G   F RL IGIG+P     A  +  F+L      E++Q+D  +
Sbjct: 140 QAAL-GSPNFWRLRIGIGHPRSLGLAQQVADFVLHPPCREEQQQIDTVI 187



>gb:CR628336_112823 Legionella pneumophila str. Paris complete
           genome.
          Length = 189

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/185 (31%), Positives = 101/185 (54%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           L+ GL NPG+ Y  TRHN G  ++  ++Q         +  +A +    I   P  LA P
Sbjct: 5   LIVGLRNPGSAYEQTRHNAGAWLVTALAQRHNSHFKIDKKMQAELTEIDINNHPCRLALP 64

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG++   ++ +Y++    IL+VHDE+ LP G ++LK   GHG HNG++ +   L
Sbjct: 65  LTFMNHSGQTTRIISQFYKIEPGEILIVHDELDLPVGRIKLKTGGGHGGHNGLRDITAQL 124

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G  +F RL IGIG+P     +  ++L + S  +R+Q+ +A+  G   +  ++   +   
Sbjct: 125 -GTGEFHRLRIGIGHPGHKDLVHQYVLSRPSMHDRQQIYDAIDRGIAIIPIVLSGDMARA 183

Query: 133 LSRFN 119
           +++ N
Sbjct: 184 MNQVN 188



>sp|O84806|PTH_CHLTR Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|F71469|F71469 probable peptidyl tRNA
           hydrolase - Chlamydia trachomatis  (serotype D, strain
           UW3/Cx)>gb:AE001352_34742 Chlamydia trachomatis
           D/UW-3/CX section 79 of 87 of the complete
           genome.>gb:AE001273_1098768 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 179

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/171 (33%), Positives = 98/171 (57%), Gaps = 3/171 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQI-SQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           LV G+GNPG +Y  TRHN+GF ++D + S+  G      +  A      I    VVL KP
Sbjct: 4   LVVGIGNPGRQYVWTRHNIGFLLLDSLASRFLGAFREAPRLYASFAKVEISSEAVVLMKP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TY+N +G++V     ++ V +  IL+V D+++   G +R +   G G HNG+K+  + L
Sbjct: 64  TTYVNLTGKAVLAAKKFFDVSMEDILVVADDINREFGFVRFRQDCGSGGHNGIKNTTQIL 123

Query: 313 DGCHQFPRLCIGIGNP--PGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
              H + +L +G+G P  PGA  +  ++L  FS  E++++++ L++G E +
Sbjct: 124 QSNHYW-QLRLGVGRPSYPGAEGVADYVLSSFSLNEKEKLNDFLEKGIEEI 173



>sp|Q89DJ9|PTH_BRAJA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000040_735700 Bradyrhizobium japonicum USDA
           110 DNA, complete genome.
          Length = 201

 Score =  102 bits (254), Expect = 1e-20
 Identities = 58/190 (30%), Positives = 99/190 (52%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L  GLGNPG KY   RHN+GF  +D+I++  G      + +     G++G   V+L KP 
Sbjct: 3   LFVGLGNPGAKYARNRHNIGFMAVDEIARRHGFSPWRRRFQGETSEGALGTERVILLKPT 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG SV + A ++++    + + HDE+ LP G +R+K   G   HNG++S+  H+ 
Sbjct: 63  TYMNDSGRSVQEAAGFFKIAPGDVTVFHDELELPPGKVRVKVGGGIAGHNGLRSISAHIG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
             + + R+ +GIG+P     +   +L  F++ +   V       AE    + +    +  
Sbjct: 123 --NDYRRVRLGIGHPGVKELVHGHVLSDFAKADNDWVATLCDAVAEHAALIAKGTDATFA 180

Query: 130 SRFNIGQKYK 101
           +R ++  + K
Sbjct: 181 NRVHLAMQAK 190



>sp|Q7WNY2|PTH_BORBR Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>sp|Q7W179|PTH_BORPA Peptidyl-tRNA hydrolase (EC
           3.1.1.29) (PTH).>gb:BX640425_809073 Bordetella
           parapertussis strain 12822, complete genome; segment
           3/14.>gb:BX640439_813556 Bordetella bronchiseptica
           strain RB50, complete genome; segment 3/16.
          Length = 215

 Score =  102 bits (254), Expect = 1e-20
 Identities = 63/169 (37%), Positives = 92/169 (54%), Gaps = 8/169 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP-----VV 506
           L+ GLGNPG  Y  TRHN GF + D ++ +    L T  +      G + +       VV
Sbjct: 24  LIVGLGNPGPDYETTRHNAGFWLADHLADD----LRTAFALEKGFFGMLAKARHAGENVV 79

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSV 326
           L KP TYMN SG+SVG +A +Y++    +L++HDE+ L  G +++K   GH  HNG+K +
Sbjct: 80  LLKPITYMNRSGQSVGAVARFYKLAPEQVLVLHDELDLLPGQVKIKQGGGHAGHNGLKDI 139

Query: 325 MEHLDGCHQFPRLCIGIGNPPG---AMDMKAFLLQKFSETERKQVDEAL 188
              L G   F RL IGIG+P     A  +  F+L      E++Q+D  +
Sbjct: 140 QAAL-GSPNFWRLRIGIGHPRSLGLAQQVADFVLHPPRREEQQQIDTVI 187



>gb:AE011537_274055 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 346 of 397 of the complete
           sequence.>gb:AE017288_432662 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 2 of 14 of the complete
           sequence.>gb:AE010300_1007454 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1065673 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 187

 Score =  102 bits (253), Expect = 2e-20
 Identities = 56/186 (30%), Positives = 105/186 (56%), Gaps = 1/186 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG++Y+  R N+GF+++D I+    + + T + K+LIG G      VVL KPQ
Sbjct: 3   LIVGLGNPGDRYNNNRSNIGFKILDVIANNINVEIKTKKKKSLIGRGDFEGEEVVLLKPQ 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+ + SGESV  +A++ ++ +  IL++ ++ +LP G + +        H GVKS+++ L 
Sbjct: 63  TFSDLSGESVLYIASFLKIQVGEILVIQEDWTLPLGRIVVDKGTQETDHPGVKSIVQSLR 122

Query: 310 GCHQFPRLCIGIGNPP-GAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               F R+ IGI N      + ++FL + F   E   + + + +   A+R++    +   
Sbjct: 123 S-PNFIRIRIGIQNDGFNLKNRESFLKEDFEPMENLSLIQIINDAEAAIRSISLGDIDDV 181

Query: 133 LSRFNI 116
           + ++++
Sbjct: 182 IEKYHL 187



>gb:AE017308_438165 Mycoplasma mobile 163K complete genome.
          Length = 190

 Score =  101 bits (251), Expect = 3e-20
 Identities = 57/184 (30%), Positives = 99/184 (53%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNP  KY   RHNVG+ ++D+I +   + +N  +   +     +     ++AKP 
Sbjct: 14  LIIGLGNPDPKYQKNRHNVGYMVVDKILENLRLKINKEKFSGIF----VKTEEFIIAKPT 69

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG+ V  ++ Y++V   +IL+++D+MS   G   +KPK G    NG+K ++  ++
Sbjct: 70  TYMNLSGDFVKNISTYFKVSPNNILIIYDDMSYEVGQAAIKPKGGSNGQNGIKDILLKMN 129

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
              + PRL IGIG      +    +L  F+  E K +D  + + AEA  + +   +   +
Sbjct: 130 -TEEIPRLKIGIGK---NQEAAKHVLSDFTLEEFKIIDLVINQAAEAAISFLFNDIRIVM 185

Query: 130 SRFN 119
           + +N
Sbjct: 186 NSYN 189



>gb:CR628337_115783 Legionella pneumophila str. Lens complete
           genome.
          Length = 189

 Score =  101 bits (251), Expect = 3e-20
 Identities = 58/185 (31%), Positives = 100/185 (54%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           L+ GL NPG+ Y  TRHN G  ++  ++Q         +  +A +    I   P  L  P
Sbjct: 5   LIVGLRNPGSAYEQTRHNAGAWLVTALAQRHNSHFKIDKKMQAELTEIDINNHPCRLLLP 64

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG++   ++ +Y++    IL+VHDE+ LP G ++LK   GHG HNG++ +   L
Sbjct: 65  LTFMNHSGQTTRIISQFYKIEPGEILIVHDELDLPVGRIKLKTGGGHGGHNGLRDITAQL 124

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G  +F RL IGIG+P     +  ++L + S  +R+Q+ +A+  G   +  ++   +   
Sbjct: 125 -GTGEFHRLRIGIGHPGHKDLVHQYVLSRPSMHDRQQIYDAIDRGIAIIPIVLSGDIARA 183

Query: 133 LSRFN 119
           +++ N
Sbjct: 184 MNQVN 188



>sp|P78034|PTH_MYCPN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|S73936|S73936 peptidyl-tRNA hydrolase pth -
           Mycoplasma pneumoniae (strain ATCC
           29342)>gb:AE000058_19495 Mycoplasma pneumoniae M129
           section 22 of 63 of the complete
           genome.>gb:U00089_1101261 Mycoplasma pneumoniae M129,
           complete genome.
          Length = 188

 Score =  101 bits (251), Expect = 3e-20
 Identities = 61/172 (35%), Positives = 99/172 (57%), Gaps = 3/172 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           LV GLGN G +Y  TRHN GF++ID++     + L  +Q +    +G    + +  VVLA
Sbjct: 6   LVVGLGNLGKQYAETRHNAGFKVIDRL-----LSLYHVQLEERNNLGEFILLRKHKVVLA 60

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP TYMN SG+ V      + +    +++V+DE++ P G +RLK +    +HNG+KSV+ 
Sbjct: 61  KPNTYMNHSGKFVKWACQNWNIKPDKVMVVYDELAFPLGTVRLKMQGSANNHNGIKSVIA 120

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVR 164
           HL+  H F RL  GI +   +  +   ++ +F+  ER  ++ AL +  EA++
Sbjct: 121 HLNTEH-FNRLRFGIKSDNTSNILHEVVMSEFTPAERNLLETALTKAIEALK 171



>gb:AF533231_519878 Western X phytoplasma tRNA-Ser gene, complete
           sequence; immunodominant protein (idpA), putative DNA
           polymerase III (dnaX), conserved hypothetical protein,
           putative DNA-directed RNA polymerase delta subunit
           (rpoE), putative phosphatidylserine synthase (pssA),
           putative phosphatidylserine decarboxylase (psd),
           putative CTP synthase (ctrA), hypothetical protein,
           putative chromosome replication initiation protein
           (dnaD), putative ribonuclease III (rnc), putative fatty
           acid/phospholipid biosynthesis (plsX), putative
           ATP-dependent DNA helicase (recG), conserved
           hypothetical GTP-binding protein, putative valyl-tRNA
           synthetase (valS), putative lysophospholipase (pldB),
           putative cation-transporting ATPase (pacL), and putative
           peptidyl-tRNA hydrolase (pth) genes, complete cds; 16S
           ribosomal RNA gene, complete sequence; tRNA-Ile gene,
           complete sequence; and 23S ribosomal RNA gene, partial
           sequence.
          Length = 205

 Score =  100 bits (250), Expect = 4e-20
 Identities = 51/159 (32%), Positives = 96/159 (60%), Gaps = 2/159 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQE--EGILLNTIQSKALIGIGSIGEVPVVLAK 497
           L+ GLGNPG  +  T HN+GF +I+ + +E  + IL    +  +++    + +  ++L +
Sbjct: 21  LIVGLGNPGKMFELTPHNIGFMLINYLEKEWKKNILTTKKELSSIVSHLQLEQETILLVQ 80

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           PQTYMN SG+++ QL   Y +P   +L++ D+++L  G  +LK K GHG HNG++++++ 
Sbjct: 81  PQTYMNISGKAIKQLMLKYNIPKDDVLVLVDDINLEPGAFKLKYKGGHGGHNGLRNIIDM 140

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQV 200
           L     F RL IG+G     + ++ ++L + +   ++Q+
Sbjct: 141 LHS-KDFKRLRIGVG-LDSRIPLEQYVLNRLNTQTQQQI 177



>gb:AE017354_460997 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 189

 Score =  100 bits (250), Expect = 4e-20
 Identities = 58/185 (31%), Positives = 100/185 (54%), Gaps = 1/185 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           L+ GL NPG+ Y  TRHN G  ++  ++Q         +  +A +    I   P  L  P
Sbjct: 5   LIVGLRNPGSAYEQTRHNAGAWLVTALAQRHNSHFKIDKKMQAELTEIDINNHPCRLVLP 64

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            T+MN SG++   ++ +Y++    IL+VHDE+ LP G ++LK   GHG HNG++ +   L
Sbjct: 65  LTFMNHSGQTTRIISQFYKIEPGEILIVHDELDLPVGRIKLKTGGGHGGHNGLRDITAQL 124

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
            G  +F RL IGIG+P     +  ++L + S  +R+Q+ +A+  G   +  ++   +   
Sbjct: 125 -GTGEFHRLRIGIGHPGHKDLVHQYVLSRPSMHDRQQIYDAIDRGIAIIPIVLSGDMARA 183

Query: 133 LSRFN 119
           +++ N
Sbjct: 184 MNQVN 188



>sp|Q9PR67|PTH_UREPA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|B82937|B82937 peptidyl-tRNA hydrolase UU078
           [imported] - Ureaplasma urealyticum>gb:AE002107_42946
           Ureaplasma parvum serovar 3 str. ATCC 700970 section 8
           of 59 of the complete genome.>gb:AF222894_1114317
           Ureaplasma parvum serovar 3 str. ATCC 700970, complete
           genome.
          Length = 186

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/185 (29%), Positives = 101/185 (54%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +L+ GLGNPG+ Y  TRHNVGF +I++I  +  + L++ +   +          V   +P
Sbjct: 4   YLIVGLGNPGSNYAKTRHNVGFMVINEICNKLNLSLDSSKFNGIFTKTIYNNSIVFFCQP 63

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SGE V ++  +Y +P++++++++D++    G ++L+ K   G  NG+K+++  L
Sbjct: 64  TTYMNLSGEFVIKMLNFYNIPIKNLIVIYDDVDTKLGTIKLRKKGSSGGQNGIKNIINIL 123

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSR 134
               +  R+ IGI   P  + +  ++L  F   E   +  A+ +GA A    + E     
Sbjct: 124 K-TDEIKRIRIGIDKDP-HIKLDQYVLSNFKIDELVIIKPAIIKGALATLAAIGEDFDKV 181

Query: 133 LSRFN 119
           +++FN
Sbjct: 182 MNKFN 186



>sp|Q92H41|PTH_RICCN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|C97816|C97816 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) - Rickettsia conorii  (strain Malish
           7)>gb:AE008646_239295 Rickettsia conorii str. Malish 7,
           section 78 of 114 of the complete
           genome.>gb:AE006914_1121413 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 185

 Score =  100 bits (248), Expect = 6e-20
 Identities = 58/164 (35%), Positives = 91/164 (55%), Gaps = 3/164 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGE-VPVVLAKP 494
           LV GLGNPG +Y  TRHNVGF  I++I  +     +T +        +I +   ++  KP
Sbjct: 3   LVIGLGNPGKEYQYTRHNVGFIAIEKIVNQYNSSFSTKKKFNCEIAETISDGQKIIFIKP 62

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG+SV  +  YY +    I ++HD++ L  G ++ K   G+G HNG+KS+    
Sbjct: 63  TTYMNLSGKSVISVKTYYNIYPAKIFVIHDDIDLETGRIKFKTGGGNGGHNGLKSI---- 118

Query: 313 DGC--HQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
           DG   + + R+ IG+G P     +  ++L  FS+ E + V +A+
Sbjct: 119 DGVIGNNYNRIRIGVGRPQNNQGVADYVLNHFSKPEYETVMQAI 162



>gb:CP000030_84057 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 186

 Score = 99.8 bits (247), Expect = 8e-20
 Identities = 49/135 (36%), Positives = 86/135 (63%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG +Y  TRHNVGF + D ++++      + +  AL+ +G++G    ++ KP 
Sbjct: 3   LLVGLGNPGKQYEFTRHNVGFVVADTVARDFNFPEFSSKYDALVSVGNVGLHRAMIVKPA 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG +V + A+ +++P   I + HD+  L +GV+++K   G+  HNG++S+ +   
Sbjct: 63  TFMNRSGAAVLKAASMHKIPAEQITVFHDDADLQHGVVKVKQGGGNAGHNGLRSI-DAAI 121

Query: 310 GCHQFPRLCIGIGNP 266
           GC Q+ R+ +G+G P
Sbjct: 122 GC-QYWRVRLGVGRP 135



>gb:BC047012_1983769 Homo sapiens chromosome 9 open reading frame
           115, mRNA (cDNA clone MGC:51999 IMAGE:5001221), complete
           cds.
          Length = 214

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 62/190 (32%), Positives = 101/190 (53%), Gaps = 3/190 (1%)
 Frame = -1

Query: 709 PEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK---ALI 539
           P P G +     W+VAGLGNPG    GTRH+VG  ++ Q+++  G+  +  + +   A +
Sbjct: 24  PRPPGKR-----WMVAGLGNPG--LPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADL 76

Query: 538 GIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKR 359
            +  +G+  +VL +P+  MN +G SV + A  + +    + LVHDE+  P G L LK   
Sbjct: 77  ALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGG 136

Query: 358 GHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEG 179
               HNGV+S +  L+  +  PRL +GIG P     ++A +L  FS  E++ +   L   
Sbjct: 137 SARGHNGVRSCISCLNS-NAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRA 195

Query: 178 AEAVRTLVRE 149
            + +   +RE
Sbjct: 196 TDLILDHIRE 205



>gb:AX418200_1468152 Sequence 1 from Patent WO0200859.
          Length = 227

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 62/190 (32%), Positives = 101/190 (53%), Gaps = 3/190 (1%)
 Frame = -1

Query: 709 PEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK---ALI 539
           P P G +     W+VAGLGNPG    GTRH+VG  ++ Q+++  G+  +  + +   A +
Sbjct: 37  PRPPGKR-----WMVAGLGNPG--LPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADL 89

Query: 538 GIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKR 359
            +  +G+  +VL +P+  MN +G SV + A  + +    + LVHDE+  P G L LK   
Sbjct: 90  ALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGG 149

Query: 358 GHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEG 179
               HNGV+S +  L+  +  PRL +GIG P     ++A +L  FS  E++ +   L   
Sbjct: 150 SARGHNGVRSCISCLNS-NAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRA 208

Query: 178 AEAVRTLVRE 149
            + +   +RE
Sbjct: 209 TDLILDHIRE 218



>sp|Q7VG29|PTH_HELHP Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE017148_391248 Helicobacter hepaticus ATCC
           51449 section 5 of 6 of the complete
           genome.>gb:AE017125_1025510 Helicobacter hepaticus ATCC
           51449 complete genome.
          Length = 223

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 58/169 (34%), Positives = 92/169 (54%), Gaps = 1/169 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQS-KALIGIGSIGEVPVVLAKP 494
           LVAGLGNP  KY  TRHN+GF ++D +S+E     +  +   A +G  +IG   V   KP
Sbjct: 5   LVAGLGNPSAKYQNTRHNIGFMVLDFLSKELDFDFSFDKKFNAEVGAINIGPHKVFFLKP 64

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QT+MN SGE++     Y+ +   H  ++HD++ +  G +R K     G HNG+KS+   +
Sbjct: 65  QTFMNLSGEAINPFVRYFDI--THTFVIHDDIDIGFGDMRFKYGGSSGGHNGLKSIDSFM 122

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
                + RL  G+G      ++  ++L  F+  ER+Q++  +    EAV
Sbjct: 123 G--DTYFRLRFGVGRSAN-KNVVEYVLSDFNAQEREQLEGLIAHAKEAV 168



>sp|Q8K9V3|PTH_BUCAP Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE014094_303109 Buchnera aphidicola str. Sg
           (Schizaphis graminum) section 19 of 57 of the complete
           genome.>gb:AE013218_935087 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 177

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 57/168 (33%), Positives = 92/168 (54%), Gaps = 5/168 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEE-GILLNTIQSKALIGIGSIGEVPVVLAKP 494
           ++ GL NP  KYH TRHNVG   I  +++    IL    +     G  +I    + L  P
Sbjct: 1   MIVGLSNPKKKYHKTRHNVGSWYIYSLAKNYLSILKEEKKFFGFTGCLNIKSNFIRLLIP 60

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
             +MN +G SV ++A++Y + L  IL+VHD++ L  G+++ K   GH  HNG++ +++  
Sbjct: 61  DIFMNINGFSVHRMASFYNISLNQILIVHDDLDLAPGIIKYKYSYGHSGHNGLRHIIKEF 120

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQ--KFSETE--RKQVDEALKE 182
           +    F RL IGIG P    ++ +F+L    F E +  +K +  A+KE
Sbjct: 121 NTKVNFYRLRIGIGRPKNKNEISSFVLSIPDFKEMKLIKKSISYAIKE 168



>gb:CP000013_870014 Borrelia garinii PBi, complete genome.
          Length = 185

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/159 (35%), Positives = 93/159 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++ GLGNPG ++  TRHNVGF ++D+I  + G+ L   +      +  I    V+L KP 
Sbjct: 1   MILGLGNPGLEFSLTRHNVGFSLLDRIISKNGLFLKRKKKYEYSEMRMISG-RVILVKPL 59

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG     + + + + ++++L+V D + LP G  RLK + G   HNG+KS+   L 
Sbjct: 60  TYMNLSGSLFPSIFSDFYMCIKNLLVVLDNVDLPLGKCRLKERGGASTHNGLKSISSIL- 118

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDE 194
           G   + RL IG+G+     D+K+F+L +F + E  ++++
Sbjct: 119 GSSNYSRLYIGVGSNV-MRDIKSFVLSRFCKDEIDRLEK 156



>gb:AE008692_241649 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 189

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 53/174 (30%), Positives = 96/174 (55%), Gaps = 2/174 (1%)
 Frame = -1

Query: 664 AGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTY 485
           AGLGNPG+ Y   RHNVGF  +D ++ E+         +  + +G I +  ++L KP T+
Sbjct: 5   AGLGNPGSSYALNRHNVGFMAVDMLASEKSFAPWKRAFQGQVSLGQIDQERILLLKPATF 64

Query: 484 MNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHG--HHNGVKSVMEHLD 311
           MN SG ++G+   +Y++    + + HDE+ +    +R+K K+G G   HNG++S + H+ 
Sbjct: 65  MNESGRAIGEAMRFYKLAPEDVTVFHDELDI--APMRVKVKKGGGAAGHNGLRSTIAHIG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
               F R+ +GIG+P     +  ++L  F+++E   + + L    +A+  L  +
Sbjct: 123 --QSFRRVRLGIGHPGEKSRVHDYVLGNFAKSETDSLADMLNAINQAIPWLAND 174



>sp|P47714|PTH_BORBU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|B70198|B70198 peptidyl-tRNA hydrolase (pth)
           homolog - Lyme disease spirochete>gb:AE001177_32767
           Borrelia burgdorferi B31 (section 63 of 70) of the
           complete genome.>gb:BORPTHH_749585 Borrelia burgdorferi
           peptidyl-tRNA hydrolase-like protein (pth) gene
           homologue, complete cds.>gb:AE000783_1120418 Borrelia
           burgdorferi B31 complete genome.
          Length = 188

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 56/159 (35%), Positives = 93/159 (58%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG ++  TRHNVGF ++D+I  + G+ L   +      +  I    V+L KP 
Sbjct: 4   LILGLGNPGLEFSLTRHNVGFSLLDKIVSKNGLFLKRKKKYEYSELKMISG-RVILVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG     + + + + ++++L+V D + LP G  RLK + G   HNG++S+   L 
Sbjct: 63  TYMNLSGSLFPSIFSDFYMCIKNLLVVLDNVDLPLGKCRLKERGGVSTHNGLRSISSVL- 121

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDE 194
           G   + RL IG+G+     D+K+F+L +F + E  ++++
Sbjct: 122 GSSNYSRLYIGVGSNL-MRDIKSFVLSRFCKDEMDRLEK 159



>sp|Q83FR1|PTH_TROWT Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016852_349175 Tropheryma whipplei str.
           Twist, section 3 of 3 of the complete
           genome.>gb:AE014184_1029371 Tropheryma whipplei str.
           Twist, complete genome.
          Length = 186

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 60/176 (34%), Positives = 92/176 (52%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           ++VAGLGNPG  Y  TRHNVG  ++D +S       +   +  L    S+G+  ++L KP
Sbjct: 4   YIVAGLGNPGPSYDKTRHNVGQMVLDILSGGARFRRHKTNNFYL----SLGD--ILLVKP 57

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
             YMN SG  +  L  ++ V    +L++HD++ LP G LR K   G   H G++S+ + L
Sbjct: 58  DAYMNLSGPVIASLMKFHSV--SDLLVLHDDIDLPLGTLRFKQGGGTAGHRGLRSISDCL 115

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
                + RL +GIG P     ++ F+L  FS  +   +   ++  AEAV  L   G
Sbjct: 116 GS--DYARLRVGIGRPENNQSIEDFVLSNFSPVQTDIISRTIQLAAEAVLHLRDNG 169



>sp|Q83HD8|PTH_TROW8 Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX251412_764859 Tropheryma whipplei TW08/27,
           complete genome; segment 3/3.
          Length = 186

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 60/176 (34%), Positives = 92/176 (52%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           ++VAGLGNPG  Y  TRHNVG  ++D +S       +   +  L    S+G+  ++L KP
Sbjct: 4   YIVAGLGNPGPSYDKTRHNVGQMVLDILSGGARFRRHKTNNFYL----SLGD--ILLVKP 57

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
             YMN SG  +  L  ++ V    +L++HD++ LP G LR K   G   H G++S+ + L
Sbjct: 58  DAYMNLSGPVIASLMKFHSV--SDLLVLHDDIDLPLGTLRFKQGGGTAGHRGLRSISDCL 115

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
                + RL +GIG P     ++ F+L  FS  +   +   ++  AEAV  L   G
Sbjct: 116 GS--DYARLRVGIGRPENNQSIEDFVLSNFSPVQTDIISRTIQLAAEAVLHLRDNG 169



>sp|Q9PA78|PTH_XYLFA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|C82532|C82532 peptidyl tRNA hydrolase XF2642
           [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE004071_50268 Xylella fastidiosa 9a5c, section
           217 of 229 of the complete genome.>gb:AE003849_1117478
           Xylella fastidiosa 9a5c, complete genome.
          Length = 192

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 64/177 (36%), Positives = 98/177 (55%), Gaps = 2/177 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS--IGEVPVVLAK 497
           L+ GLGNPG+++  TRHN GF  +D + Q EG     ++SK    +    I    V L +
Sbjct: 6   LIVGLGNPGSEHTKTRHNAGFRFVDGLVQREGQRW-MLESKLFAHVARVFIAGQWVWLLR 64

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG+S+    +++++    +L+ HDE+  P G +RLK   GHG  NG++ + + 
Sbjct: 65  PVTFMNLSGKSICAGLSFWKIKPEQMLVAHDELDFPPGAVRLKFDGGHGGQNGLRDITKL 124

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREG 146
           L G  +F RL +GIG+P     +  ++L   +  E   +D AL E A AV  LV  G
Sbjct: 125 L-GHGRFHRLRVGIGHPGHKDRVVNWVLGCPTCEENIAIDAAL-ERASAVLPLVVAG 179



>sp|Q8PNT8|PTH_XANAC Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE011726_275910 Xanthomonas axonopodis pv.
           citri str. 306, section 104 of 469 of the complete
           genome.>gb:AE008923_917685 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 193

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 56/138 (40%), Positives = 80/138 (57%), Gaps = 3/138 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEV---PVVLA 500
           L+ GLGNPG ++  TRHN GF  +D + +  G     + SK L G  +  EV   PV L 
Sbjct: 6   LIVGLGNPGPEHAQTRHNAGFRFVDALIERSGARW-ALDSK-LFGETAKVEVAGQPVWLL 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP T+MN SG+S+     ++++   H+L+ HDE+ L  G  RLK   GHG  NG++  + 
Sbjct: 64  KPATFMNLSGKSITAALRFWKIEPEHLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIR 123

Query: 319 HLDGCHQFPRLCIGIGNP 266
            L G  +F RL +GIG+P
Sbjct: 124 LL-GHGKFHRLRVGIGHP 140



>gb:CP000009_863153 Gluconobacter oxydans 621H, complete genome.
          Length = 189

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 58/174 (33%), Positives = 94/174 (54%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L  GLGNP       RHN+GF  +D+I++  G      + +     G IG   ++L KP 
Sbjct: 3   LWTGLGNPEPGMSRHRHNIGFMAVDEIARRHGFSPWRKRFRGETSEGVIGGQKILLLKPM 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG+SV Q A ++++    I + HDE+ L  G LR+K   G   HNG++S+ + L 
Sbjct: 63  TYMNRSGDSVQQAAQFFKIAQDDITVFHDELDLAFGKLRIKRGGGAAGHNGLRSMDKCLP 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
           G   + R+ +GIG+P     +   +L  F++ E  +++  L+  A+A   L ++
Sbjct: 123 G-PDYWRVRMGIGHPGHKDRVTGHVLGNFAKAEEPELERWLEAIADAAPLLAKK 175



>gb:AE013598_297302 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 204

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 55/138 (39%), Positives = 79/138 (57%), Gaps = 3/138 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GLGNPG ++  TRHN GF  +D + +  G     + SK L G  +   I   PV L 
Sbjct: 16  LIVGLGNPGQEHAQTRHNAGFRFVDSLIERSGARW-ALDSK-LFGETAKVDIAGQPVWLL 73

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP T+MN SG+S+     ++++   H+L+ HDE+ L  G  RLK   GHG  NG++  + 
Sbjct: 74  KPATFMNLSGKSITAALRFWKIEPEHLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIG 133

Query: 319 HLDGCHQFPRLCIGIGNP 266
            L G  +F RL +GIG+P
Sbjct: 134 LL-GHGKFHRLRVGIGHP 150



>sp|Q87A24|PTH_XYLFT Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE012560_285387 Xylella fastidiosa Temecula1,
           section 8 of 9 of the complete
           genome.>gb:AE009442_961963 Xylella fastidiosa Temecula1,
           complete genome.
          Length = 192

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 59/167 (35%), Positives = 94/167 (56%), Gaps = 2/167 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK--ALIGIGSIGEVPVVLAK 497
           L+ GLGNPG++Y  TRHN GF  +D + Q EG     ++SK  A +    I    V L +
Sbjct: 6   LIVGLGNPGSEYIKTRHNAGFRFVDGLVQREGQCW-ALESKLFAYVARVFIAGQWVWLLR 64

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG+S+     ++++    +L+ HDE+  P G +RLK   GHG  NG++ + + 
Sbjct: 65  PVTFMNLSGKSICAGLNFWKIKPEQMLVAHDELDFPPGAVRLKFDGGHGGQNGLRDITKL 124

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGA 176
           L G  +F RL +GIG+P     + +++L   +  E   +D AL+  +
Sbjct: 125 L-GHGRFHRLRVGIGHPGHKDRVVSWVLGCPTCDENIAIDAALERAS 170



>sp|Q9Z6V6|PTH_CHLPN Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|E72014|E72014 peptidyl-tRNA hydrolase CP0909
           [imported] - Chlamydophila pneumoniae (strains CWL029
           and AR39)>pir|D86609|D86609 peptidyl tRNA hydrolase
           [imported] - Chlamydophila pneumoniae (strain
           J138)>gb:AE001675_37800 Chlamydia pneumoniae section 91
           of 103 of the complete genome.>gb:AE002250_44381
           Chlamydophila pneumoniae AR39, section 77 of 94 of the
           complete genome.>gb:AE017160_394328 Chlamydophila
           pneumoniae TW-183, section 4 of 4 of the complete
           genome.>gb:BA000008_664321 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886506
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_942357 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028590 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 180

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 58/168 (34%), Positives = 93/168 (55%), Gaps = 3/168 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQE-EGILLNTIQS-KALIGIGSIGEVPVVLAK 497
           L+  +GNP + Y  TRHN GF + D++ +E +G     +    AL+ +      P+V  K
Sbjct: 4   LIVAIGNPRHGYANTRHNAGFLLADRLVEELQGPPFKPLSKCHALMTLVESSSGPLVFIK 63

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T++N SG++V     Y+ V L HIL++ D+++   G LRL    G G HNG+KS+   
Sbjct: 64  PTTFVNLSGKAVVLAKKYFNVALSHILVLADDVNRSFGKLRLCFNGGSGGHNGLKSITAS 123

Query: 316 LDGCHQFPRLCIGIGNP-PGAMDMKAFLLQKFSETERKQVDEALKEGA 176
           L G +++ +L  G+G P    +++  F+L KFSE E  Q+     E +
Sbjct: 124 L-GSNEYWQLRFGVGRPLEEGVELSNFVLGKFSEEENLQLGSIFVEAS 170



>gb:AK075833_1171043 Mus musculus adult male stomach cDNA, RIKEN
           full-length enriched library, clone:2210013M04
           product:hypothetical Peptidyl-tRNA hydrolase containing
           protein, full insert sequence.
          Length = 204

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 59/177 (33%), Positives = 94/177 (53%), Gaps = 3/177 (1%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK---ALIGIGSIGEVPVVL 503
           WLVAGLGN G    GTRH+VG  ++ QI++  G+  N  +     A + +  +G+  +VL
Sbjct: 21  WLVAGLGNHGMP--GTRHSVGMAVLGQIARRLGVAENWTRDSRCAADLALAPLGDAQLVL 78

Query: 502 AKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVM 323
            +P+  MN +G SV + A  + +    I LVHDE+  P G L LK       HNGV+S +
Sbjct: 79  LRPRRLMNVNGRSVARAAELFGLTAEEIYLVHDELDKPLGKLALKLGGSARGHNGVRSCI 138

Query: 322 EHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVR 152
             L+  +  PRL +GIG P     ++  +L  FS  E++ +   + +  + +   +R
Sbjct: 139 SCLNS-NAMPRLLVGIGRPTHPNMVENHVLGCFSPEEQELLSPLMDQATDLLLDHIR 194



>sp|P57287|PTH_BUCAI Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|C84952|C84952 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653561 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 177

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 52/169 (30%), Positives = 89/169 (52%), Gaps = 3/169 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP---VVLA 500
           ++ GL NP  +YH TRHNVG   +  ++  E  L N    K   G  +   +    + L 
Sbjct: 1   MIVGLSNPKKEYHSTRHNVGSWYLYSLA--ESYLRNFKNEKKFFGFTTSLNIESNYIRLL 58

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P  +MN +G+SV ++A++Y + L  IL+VHD++ L  G+ +LK   GH  HNG++ ++ 
Sbjct: 59  IPNIFMNINGQSVFKMASFYNINLSEILIVHDDLELQPGISKLKYSYGHNGHNGLRDIVN 118

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAE 173
             +    F R  IGIG P     + +F+L   ++ E+  + +++    E
Sbjct: 119 TFNKNINFYRFRIGIGRPINRDQIASFVLSNPTKKEKILIQKSILHAIE 167



>sp|Q821W6|PTH_CHLCV Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE016997_374875 Chlamydophila caviae GPIC
           section 4 of 4 of the complete
           genome.>gb:AE015925_994554 Chlamydophila caviae GPIC
           complete genome.
          Length = 183

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 55/158 (34%), Positives = 91/158 (57%), Gaps = 4/158 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP---VVLA 500
           L+  +GNPG +Y  TRHN+GF   D++ Q           K    I  + E P   +V  
Sbjct: 4   LIVAIGNPGRQYTWTRHNIGFLCADKLLQGFPEAQFKEARKLFSDIAKV-ESPQGSMVFI 62

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP+TY+N SG++V  +  YY +P+  IL++ D+++ P G +RL+   G G H G+KS+ +
Sbjct: 63  KPRTYVNLSGKAVSAVKEYYGIPIDRILVLADDVNHPFGNVRLRQNAGGGGHKGIKSITQ 122

Query: 319 HLDGCHQFPRLCIGIGNPPGA-MDMKAFLLQKFSETER 209
            L G + + +L +GIG P    +++  F+L +F+E E+
Sbjct: 123 SL-GSNDYWQLRLGIGRPQREDIELSDFVLGQFTEEEQ 159



>sp|Q8PC61|PTH_XANCP Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE012186_280145 Xanthomonas campestris pv.
           campestris str. ATCC 33913, section 94 of 460 of the
           complete genome.>gb:AE008922_913427 Xanthomonas
           campestris pv. campestris str. ATCC 33913, complete
           genome.
          Length = 193

 Score = 94.0 bits (232), Expect = 5e-18
 Identities = 59/191 (30%), Positives = 98/191 (51%), Gaps = 3/191 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVP---VVLA 500
           L+ GLGNPG ++  TRHN GF  +D +++  G     + SK L G  +  E+    V L 
Sbjct: 6   LIVGLGNPGPEHAQTRHNAGFRFVDALAERTGARWG-LDSK-LFGETAKAEIAGHTVWLL 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
           KP T+MN SG+S+     ++++    +L+ HDE+ L  G  RLK   GHG  NG++  + 
Sbjct: 64  KPATFMNLSGKSITAALRFWKIEPEQLLVAHDELDLAPGTARLKFDGGHGGQNGLRDTIR 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVG 140
            L G  +F RL +GIG+P     +  ++L +    +   + EA+    +A+   +     
Sbjct: 124 LL-GHGKFHRLRVGIGHPGHKDRVVPWVLGRAGRDDDMAIGEAVDAAIDALPLALDGNFN 182

Query: 139 SRLSRFNIGQK 107
             + R +  +K
Sbjct: 183 EAMKRLHTPKK 193



>gb:AE017256_417977 Wolbachia endosymbiont of Drosophila
           melanogaster, section 1 of 5 of the complete
           genome.>gb:AE017196_1058614 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 182

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 49/150 (32%), Positives = 86/150 (57%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG++Y  T HN+GF ++D I +       + ++  LI  G I +  ++L KP 
Sbjct: 3   LIVGLGNPGSQYELTHHNIGFIVVDTICKYWNFHSFSKKADYLITSGIINDNKIMLIKPY 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           ++MN SG  V ++  +Y++ L +I+++HD+  L  G +++K       HNG+KS+   + 
Sbjct: 63  SFMNNSGIPVAKIQNFYKLSLDNIVVIHDDADLELGRIKVKKGGSSAGHNGLKSIDSFIG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFS 221
             + + RL  G+G P     +  ++L KFS
Sbjct: 123 --NDYWRLRFGVGRPEDQRSLADYVLSKFS 150



>sp|O83975|PTH_TREPA Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|G71252|G71252 probable peptidyl-tRNA
           hydrolase (pth) - syphilis spirochete>gb:AE001269_33832
           Treponema pallidum subsp. pallidum str. Nichols section
           85 of 87 of the complete genome.>gb:AE000520_1050060
           Treponema pallidum subsp. pallidum str. Nichols complete
           genome.
          Length = 202

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 64/163 (39%), Positives = 87/163 (53%), Gaps = 10/163 (6%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGI-GSIGEVP------ 512
           L+  LGNPG +Y  TRHN  + ++         L  +I      G  GSI  +       
Sbjct: 5   LIVFLGNPGAEYEETRHNAAWLLLTY-------LFPSIVLPWRCGCRGSIARIEGFEGSS 57

Query: 511 --VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNG 338
             V L KP TYMN SG+SVG   A+ Q   + +L+VHDE+ LP GV+ LK   G G HNG
Sbjct: 58  EEVWLLKPLTYMNRSGKSVGAACAFLQTDAKQLLVVHDELELPFGVVSLKQGGGLGGHNG 117

Query: 337 VKSVMEHLDGCHQFPRLCIGIGNPPG-AMDMKAFLLQKFSETE 212
           ++S+ E L G   F RL IGIG PP  ++++  ++L  F   E
Sbjct: 118 LRSIKEVL-GTADFWRLRIGIGRPPSESVNIAQYVLSAFYPAE 159



>gb:AE017321_441729 Wolbachia endosymbiont strain TRS of Brugia
           malayi, complete genome.
          Length = 182

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 48/153 (31%), Positives = 85/153 (55%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG++Y  T HN+GF ++D I +       + ++  LI    I +  ++L KP 
Sbjct: 3   LIVGLGNPGSQYELTYHNIGFIIVDAICKHWNFQSFSKKADCLITSSVINDNKIMLMKPY 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           ++MN SG  V ++  +Y+  L +++++HD+  L  G +++K   G   HNG+KS+   + 
Sbjct: 63  SFMNNSGIPVARIRNFYKFSLDNVIVIHDDADLEPGRIKIKKGGGSAGHNGLKSIDSSIG 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETE 212
             + + RL  GIG       +  ++L KFS  +
Sbjct: 123 --NDYWRLRFGIGRSDSQRSLADYVLSKFSNLD 153



>gb:AE017248_415695 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069291 Treponema
           denticola ATCC 35405, complete genome.
          Length = 203

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 71/199 (35%), Positives = 103/199 (51%), Gaps = 25/199 (12%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTI-QSKALIGIGSIGEVP------ 512
           L+  LGN G KY  TRHN  + + D I     I  N + QSK     G   ++P      
Sbjct: 4   LIVFLGNYGKKYENTRHNAAWVLCDSIE----IGSNAVWQSKFK---GQYAKLPSSMTPG 56

Query: 511 --VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNG 338
             V L KP+TYMN SGESV   A+++++   +IL+VHDE+ L  G+L  K   G G HNG
Sbjct: 57  RAVHLLKPETYMNLSGESVIAAASFFRLKPENILIVHDELELKPGILSFKWSGGLGGHNG 116

Query: 337 VKSVMEHLDGCHQFPRLCIGIGNP-------PGAMDMKAFLLQKFSETER-------KQV 200
           ++S+   L+    F RL IGIG P         + D+  ++L +F+++E         Q 
Sbjct: 117 LRSIKSVLNTA-DFFRLRIGIGRPDFSSQGGDASPDISGYVLSRFAQSELDVLKSQVPQA 175

Query: 199 DEALKEGAEA--VRTLVRE 149
           D   KE  EA   +TL+++
Sbjct: 176 DSFFKELLEADEPQTLIKK 194



>gb:CP000020_870939 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 156

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 44/126 (34%), Positives = 72/126 (57%)
 Frame = -1

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG+++  +A +YQ+    IL+ HDE+ LP GV + K   GHG HNG++  +  
Sbjct: 26  PTTFMNLSGKAIAAMAKFYQIKPEEILVAHDELDLPPGVAKFKKGGGHGGHNGLRDTISK 85

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           L    +F RL IGIG+P     +  F+L K    E++ +D A+ E    +  L+++G+  
Sbjct: 86  LANTKEFYRLRIGIGHPGHKDKVAGFVLGKAPTKEQELIDAAVDESTRCLDILLKDGLSK 145

Query: 136 RLSRFN 119
             +R +
Sbjct: 146 AQNRLH 151



>sp|P56077|PTH_HELPY Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|A64707|A64707 peptidyl-tRNA hydrolase -
           Helicobacter pylori (strain 26695)>gb:AE000648_25657
           Helicobacter pylori 26695 section 126 of 134 of the
           complete genome.>gb:AE000511_881096 Helicobacter pylori
           26695 complete genome.
          Length = 186

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 58/173 (33%), Positives = 93/173 (53%), Gaps = 1/173 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLN-TIQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNP  +Y  TRHN GF+++D +  E  +    + +  A + +        +  KP
Sbjct: 3   LLVGLGNPTLRYAHTRHNAGFDILDSLVSELDLSFTFSPKHNAFLCVYK----DFIFLKP 58

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QTYMN SGESV     +Y+   + +L+VHD++ LP GV+R K   G+G HNG+KS+   L
Sbjct: 59  QTYMNLSGESVLSAKNFYKT--KELLIVHDDLDLPLGVVRFKNGGGNGGHNGLKSI--DL 114

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLV 155
              + + RL +GI    G ++    +L KF + E    + A +    A++  +
Sbjct: 115 LCSNSYYRLRVGISKGIGVIE---HVLSKFHKNEEPLKNAAFEHAKNALKFFI 164



>sp|Q98PE2|PTH_MYCPU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|E90609|E90609 peptidyl-trna hydrolase (pth)
           [imported] - Mycoplasma pulmonis (strain UAB
           CTIP)>gb:MPULM03_150294 Mycoplasma pulmonis (strain UAB
           CTIP) complete genome; segment 3/3.
          Length = 186

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 53/172 (30%), Positives = 99/172 (57%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG++Y  TRHN+GF +ID+I+++  + L+    +   GI   GE   +++KP 
Sbjct: 3   LIVGLGNPGDEYDKTRHNLGFMVIDKIAEKLNVKLD---KEKFNGIFYKGE-NYIISKPL 58

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           TYMN SG  V  +  ++ + + +I++++DE+ L  G   +K K       G++S++E L 
Sbjct: 59  TYMNNSGNFVYDIKNFFDIEIDNIIIIYDEIDLKVGQASIKIKGSANGQRGMQSIIEKLK 118

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLV 155
                 R+ IG+  P     + +++L+K  E E++  ++ + E A+ + T +
Sbjct: 119 -TENIKRIKIGVSRPL-YEPVSSYILKKIPENEKETFEKVIDELADKLLTYI 168



>gb:BX842645_822947 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 4/4.
          Length = 186

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 52/168 (30%), Positives = 88/168 (52%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++ GLGN G +Y  TRHN GF  ID + ++        +  +LI    I    V+L KP 
Sbjct: 3   VIIGLGNIGKEYEKTRHNAGFIAIDLLLEKYNYSSVKQEFNSLIYTTIINNQKVLLVKPL 62

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG +V Q+  +Y++ L  ++++HD+  L    ++ K       HNG+KS++ +L 
Sbjct: 63  TFMNNSGLAVRQIINFYKINLNDLIIIHDDKDLNISRIQFKKDGSSAGHNGIKSIINNLQ 122

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
               F RL IG+   P    +  ++L KFS+ E   + ++  +  E +
Sbjct: 123 -TQNFYRLRIGVNQVPKEWKIVDWVLSKFSDEELNLLKQSFIDKIEFI 169



>sp|Q9AAV9|PTH_CAUCR Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|C87309|C87309 peptidyl-tRNA hydrolase
           [imported] - Caulobacter crescentus>gb:AE005721_74501
           Caulobacter crescentus CB15 section 47 of 359 of the
           complete genome.>gb:AE005673_921533 Caulobacter
           crescentus CB15 complete genome.
          Length = 205

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 54/172 (31%), Positives = 93/172 (54%), Gaps = 4/172 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSI----GEVPVVL 503
           ++AGLGNP  KY   RHNVGF  +D ++++ G      + + L   G +    G V ++L
Sbjct: 3   ILAGLGNPEPKYEKNRHNVGFMAVDALARKWGTAPWRARFQGLACEGQVSTPDGPVKLLL 62

Query: 502 AKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVM 323
            KP+TY N SG +VG+   ++++    +++ HDE+ +  G  R+K   G   +NG++SV 
Sbjct: 63  LKPKTYYNESGRAVGEAMKFFKLQPTDVIVFHDEIDMAPGRFRMKSGGGAAGNNGIRSVT 122

Query: 322 EHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
             +     F R  IG+G+P     +  ++L  F + E + +D  L   A+A+
Sbjct: 123 SQVGDA--FRRGRIGVGHPGHKDAVMHYVLGDFHKVEHQWLDPILDAIADAL 172



>gb:BX248585_763956 Blochmannia floridanus complete genome; segment
           2/3.
          Length = 197

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 61/161 (37%), Positives = 91/161 (56%), Gaps = 3/161 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILL--NTIQSKALIGIGSIGEVPVVLAK 497
           L+AG+GN G KY  TRHN G + I  +SQ+  + L  N I     IG   I E  V L  
Sbjct: 5   LIAGIGNIGAKYINTRHNCGHKYIYLLSQKFKVHLKYNNILC-GYIGKFQILEHTVKLLI 63

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLK-PKRGHGHHNGVKSVME 320
           P +Y+N SG SV +   +Y + LR IL+ HDE+ L  G ++++  KR +  H+G++++++
Sbjct: 64  PNSYVNNSGISVSKCVNFYGLSLREILVAHDELDLYPGTIKIQLGKRRNESHHGIQNIID 123

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVD 197
            L   + F RL IGIG P    ++  F+L   S  E  Q+D
Sbjct: 124 KLGNRYDFYRLRIGIGRPCNKNEIINFVLNIPSVHEGIQID 164



>sp|Q9ZJC3|PTH_HELPJ Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|G71812|G71812 peptidyl-tRNA hydrolase -
           Helicobacter pylori (strain J99)>gb:AE001561_36381
           Helicobacter pylori, strain J99 section 122 of 132 of
           the complete genome.>gb:AE001439_885151 Helicobacter
           pylori, strain J99 complete genome.
          Length = 186

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 56/173 (32%), Positives = 93/173 (53%), Gaps = 1/173 (0%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGI-LLNTIQSKALIGIGSIGEVPVVLAKP 494
           L+ GLGNP  +Y  TRHN GF+++D +  E  +  + + +  A + +        +L KP
Sbjct: 3   LLVGLGNPTLRYDHTRHNAGFDILDSLVSELDLSFIFSPKHNAYLCVYK----DFILLKP 58

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
           QTYMN SGESV     +Y+   + +L+VHD++ LP GV++ K   G+G HNG+KS+    
Sbjct: 59  QTYMNLSGESVLSAKNFYKT--KELLIVHDDLDLPLGVVKFKKGGGNGGHNGLKSIDALC 116

Query: 313 DGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLV 155
              + + RL +GI      +++   +L KF   E    + A +    A++  +
Sbjct: 117 S--NSYYRLRVGISK---GINITEHVLSKFHNNEEPLKNAAFEHAKNALKFFI 164



>sp|P49607|PTH_CHLMU Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|C81732|C81732 peptidyl-tRNA hydrolase TC0183
           [imported] - Chlamydia muridarum (strain
           Nigg)>gb:AE002285_44774 Chlamydia muridarum Nigg section
           17 of 85 of the complete genome.>gb:AE002160_1148914
           Chlamydia muridarum Nigg, complete genome.
          Length = 179

 Score = 89.7 bits (221), Expect = 9e-17
 Identities = 57/176 (32%), Positives = 93/176 (52%), Gaps = 8/176 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQE------EGILLNTIQSKALIGIGSIGEVPV 509
           LV G+GNPG +Y  TRHN+GF  +D ++        E   L +   K     G I     
Sbjct: 4   LVVGIGNPGRQYVWTRHNIGFLFLDMLASRFSGAFREAPRLFSSFMKVETSCGVI----- 58

Query: 508 VLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKS 329
           VL KP TY+N +G++V     ++ V +  IL+V D+++   G +R +   G G HNG+K+
Sbjct: 59  VLIKPSTYVNLTGKAVLAAKRFFGVSVEGILIVADDINREFGSIRFRQDCGAGGHNGLKN 118

Query: 328 VMEHLDGCHQFPRLCIGIGNP--PGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
             + L   H + +L +G+G P  P +  +  ++L  FS  ERK ++   ++G E +
Sbjct: 119 TTQVLQSNHYW-QLRLGVGRPSNPESEGVADYVLSNFSFNERKSLNGFFEKGIEEI 173



>sp|Q9PII7|PTH_CAMJE Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|D81450|D81450 aminoacyl-tRNA hydrolase (EC
           3.1.1.29) Cj0312 [imported] - Campylobacter jejuni
           (strain NCTC 11168)>gb:CJ11168X1_846718 Campylobacter
           jejuni subsp. jejuni NCTC 11168 complete genome; segment
           1/6.
          Length = 181

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 63/183 (34%), Positives = 97/183 (53%), Gaps = 2/183 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGI--LLNTIQSKALIGIGSIGEVPVVLAK 497
           LV GLGN G +Y  TRHNVGF +ID + +E     L N+     L  IGS     ++L K
Sbjct: 3   LVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKGELFKIGS----SLLLLK 58

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P TYMN SG SV  +  +Y+     ++++HD++ +  G LR K     G HNG+KS+ + 
Sbjct: 59  PSTYMNNSGLSVKAVNDFYK--CERMIVIHDDIDINLGALRFKKGGSSGGHNGLKSI-DT 115

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           L G + + R+ IG+G     +   + +L KF   E   + + L+   +A+  L+     S
Sbjct: 116 LCG-NDYERVRIGVGKGENVI---SHVLGKFKSEEEITLSKVLEHAKKALLELIENDDLS 171

Query: 136 RLS 128
            +S
Sbjct: 172 AIS 174



>sp|P59490|PTH_BUCBP Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:AE014016_302595 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), section 1 of 2 of the complete
           genome.>gb:AE016826_981196 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 207

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 52/165 (31%), Positives = 91/165 (55%), Gaps = 4/165 (2%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGS---IGEVPVVLA 500
           L+ GL NP  KY+ TRHNVG  +++ +  ++   L   ++   +G  +   I    + + 
Sbjct: 6   LIVGLANPIKKYNDTRHNVGSWLVNSLVTQQNKKLK--KNNKFLGYSTEINILSKNIHVL 63

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVME 320
            P T+MN SG SV  ++ +Y + L  IL+VHDE+ L  G ++ + +  H  HNG+++V+ 
Sbjct: 64  VPDTFMNLSGISVLAISNFYNIKLHEILVVHDELDLKPGNVKFRLRSSHNGHNGIRNVLA 123

Query: 319 HLDGCHQFPRLCIGIGNP-PGAMDMKAFLLQKFSETERKQVDEAL 188
            L    +F R+ IGIG P      +  F+L K + +E+  ++ A+
Sbjct: 124 VLGTNIKFLRIQIGIGRPINSGYKISKFVLSKPNVSEKLLINRAI 168



>gb:CP000025_878129 Campylobacter jejuni RM1221, complete genome.
          Length = 181

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 63/183 (34%), Positives = 97/183 (53%), Gaps = 2/183 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGI--LLNTIQSKALIGIGSIGEVPVVLAK 497
           LV GLGN G +Y  TRHNVGF +ID + +E     L N+     L  IGS     ++L K
Sbjct: 3   LVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKGELFKIGS----SLLLLK 58

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P TYMN SG SV  +  +Y+     ++++HD++ +  G LR K     G HNG+KS+ + 
Sbjct: 59  PSTYMNNSGLSVKAVNDFYK--CERMIVIHDDIDINLGALRFKKGGSSGGHNGLKSI-DT 115

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGS 137
           L G + + R+ IG+G     +   + +L KF   E   + + L+   +A+  L+     S
Sbjct: 116 LCG-NDYERVRIGVGKGENVI---SHVLGKFKPEEEITLSKVLEHTKKALLELIENDDLS 171

Query: 136 RLS 128
            +S
Sbjct: 172 AIS 174



>gb:CTU31570_119670 Chlamydia muridarum peptidyl-tRNA hydrolase
           (pth) gene, complete cds.
          Length = 194

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 57/176 (32%), Positives = 92/176 (52%), Gaps = 8/176 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQE------EGILLNTIQSKALIGIGSIGEVPV 509
           LV G+GNPG +Y  TRHN+GF  +D ++        E   L +   K     G I     
Sbjct: 4   LVVGIGNPGRQYVWTRHNIGFLFLDMLASRFSGAFREAPRLFSSFMKVETSCGVI----- 58

Query: 508 VLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKS 329
           VL KP TY+N +G++V     ++ V +  IL+V D+++   G +R +   G G HNG+K+
Sbjct: 59  VLIKPSTYVNLTGKAVLAAKRFFGVSVEGILIVADDINREFGSIRFRQDCGAGGHNGLKN 118

Query: 328 VMEHLDGCHQFPRLCIGIGNP--PGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
             + L   H + +L +G+G P  P +     ++L  FS  ERK ++   ++G E +
Sbjct: 119 TTQVLQSNHYW-QLRLGVGRPSNPESEGGADYVLSNFSFNERKGLNGFFEKGIEEI 173



>sp|Q7V342|PTH_PROMP Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BX572090_795876 Prochlorococcus marinus MED4
           complete genome; segment 1/5.
          Length = 203

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 8/175 (4%)
 Frame = -1

Query: 667 VAGLGNPGNKYHGTRHNVGFEMIDQISQE---EGILLNTIQSKALIGIGSIGEVPVVLAK 497
           + GLGNPG +Y   RHN+GF +++  S++   +  L N +  K+      I      L  
Sbjct: 8   IIGLGNPGKEYIQNRHNIGFLLLENFSEKYDSKFTLKNKL--KSWYSEFKINNFTYRLFM 65

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P T+MN SG +V  +  +Y++ L  + ++ D++ LP G +R + K   G HNG+K ++  
Sbjct: 66  PNTFMNNSGNAVRAIVDWYKIDLDRLFIIVDDIDLPLGKIRFRKKGSSGGHNGIKDIINK 125

Query: 316 LDGCHQFPRLCIGIGNPP-----GAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
           L     F R+ IGIG+PP       ++  + +L   S  E   +D   K+  E++
Sbjct: 126 LQ-TENFNRIKIGIGSPPVNERKKTLNTISHVLGNISSKESLTLDRVYKKLIESL 179



>gb:CR522870_101577 Desulfotalea psychrophila LSv54 chromosome.
          Length = 215

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 44/136 (32%), Positives = 75/136 (55%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKP 494
           +L+ GLGNPG +Y  TRHN G  ++D +S       +  +  +      +    + L +P
Sbjct: 24  YLLVGLGNPGREYQDTRHNAGSLLLDDLSSRWSGSNSIEKYNSTFRKARVAGNSLALMQP 83

Query: 493 QTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHL 314
            TYMN SG +V +   ++++   +I+++HD++ +  G ++L    G G HNG+KS+   L
Sbjct: 84  LTYMNRSGLAVAEYVRFFKIVAENIIVIHDDIDMAPGRVKLVRGGGAGGHNGIKSINSSL 143

Query: 313 DGCHQFPRLCIGIGNP 266
            G   + RL IG+G P
Sbjct: 144 -GFVDYYRLKIGVGRP 158



>sp|Q8D2K4|PTH_WIGBR Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>gb:BA000021_687096 Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis DNA, complete
           genome.
          Length = 191

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 50/176 (28%), Positives = 89/176 (50%), Gaps = 2/176 (1%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQE--EGILLNTIQSKALIGIGSIGEVPVVLAK 497
           L+ GL NP N Y+ TRHN+G   I  ++++  + ++ N       I +  IG+    L  
Sbjct: 5   LIVGLSNPINLYYNTRHNIGSWYIKFLAKKYKKNLIKNKKYCFYYIDV-KIGDYYSKLVI 63

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEH 317
           P TYMN +G  +  +  +Y++    +L+VHD++ L  G+ R K    +  HNG+KS+ + 
Sbjct: 64  PDTYMNVNGTIIYNITNFYKIYSNEMLIVHDDLDLDTGIARFKFNHKNSTHNGIKSIYKS 123

Query: 316 LDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVRE 149
                 F  L IGIG P    ++ ++LL   S  E   + + + +  +    L+++
Sbjct: 124 FGAKCIFNTLRIGIGRPKLNKNINSYLLNNPSPKEEILIKKTITKCIKCTDVLIKK 179



>gb:BX908798_831149 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 198

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 49/143 (34%), Positives = 80/143 (55%)
 Frame = -1

Query: 547 ALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLK 368
           ALI  G +    V L  P TYMN SG +V +   +++ P+ ++ +V D++SL  G L+LK
Sbjct: 25  ALISKGMVENKSVHLILPLTYMNLSGTAVKRYLDFFKFPMTNLFVVTDDISLSFGKLKLK 84

Query: 367 PKRGHGHHNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEAL 188
                G HNG+KSV  HL G   + RL +GIG+ PG  +  +++L  F++ E + +   +
Sbjct: 85  TMGSAGGHNGLKSVETHL-GTSHYNRLKMGIGH-PGEKNFASYVLDVFTQEELQVLATFV 142

Query: 187 KEGAEAVRTLVREGVGSRLSRFN 119
             G E +  L++E V   ++  N
Sbjct: 143 DRGVEVLLRLIKESVSQVMNAVN 165



>gb:AE017332_445437 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 184

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 51/184 (27%), Positives = 95/184 (51%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           L+ GLGNPG KY  T+HNVG+ ++D ++++   L  +   K   GI  + +   +LAKP 
Sbjct: 3   LIVGLGNPGEKYAKTKHNVGYWVLDLLAEK---LALSFDQKTENGI-YVKQPDFILAKPT 58

Query: 490 TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLD 311
           T+MN SG+ V +L  +Y++  + +++++D+M+   G   +K     G   G+  ++E   
Sbjct: 59  TFMNKSGDFVEELIKFYKINTQDLMIIYDDMNFEVGQAAIKTTGSAGGQRGMAHIIEKCK 118

Query: 310 GCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRL 131
              +  RL IGI     A   K ++L  F   +  ++   ++E A  +   +     + +
Sbjct: 119 -TKEIKRLKIGISRGENA---KEYVLSPFLPKDNAKIKLVIEEAANILIFYLSNSFITTI 174

Query: 130 SRFN 119
            +FN
Sbjct: 175 EKFN 178



>gb:AC137000_1743330 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0035I01, complete sequence.
          Length = 154

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 49/130 (37%), Positives = 69/130 (53%), Gaps = 23/130 (17%)
 Frame = -1

Query: 463 VGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDG---CHQFP 293
           VG LAAYY++PL  +L+  D   LP G+LRL+PK G G HNG    +        CH   
Sbjct: 30  VGPLAAYYKLPLNRVLVAFDGTDLPCGILRLQPKGGFGRHNGSVDFVTMCFNEVICHS-- 87

Query: 292 RLCIGIGNPPGAMDMKAFLLQKFSETERK--------------------QVDEALKEGAE 173
               GIG PPG MD KAF+LQKF++T  +                    ++D A++EG E
Sbjct: 88  ---KGIGCPPGQMDPKAFVLQKFNKTSLERIHMTNSLKPWLYPAYVKTLKIDSAIEEGVE 144

Query: 172 AVRTLVREGV 143
            ++ +V +G+
Sbjct: 145 ILKLVVTKGL 154



>sp|P38876|PTH_YEAST Peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|S46683|S46683 hypothetical protein YHR189w -
           yeast (Saccharomyces cerevisiae)>gb:YSCH9998_1729274
           Saccharomyces cerevisiae chromosome VIII cosmid 9998.
          Length = 190

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 50/144 (34%), Positives = 79/144 (54%), Gaps = 6/144 (4%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSI----GEVPVVL 503
           ++ G+GNP  +Y GTRHNVG  M++ + +  G+   T       G G +     E   +L
Sbjct: 8   VLTGIGNPEPQYAGTRHNVGLYMLELLRKRLGLQGRTYSPVPNTG-GKVHYIEDEHCTIL 66

Query: 502 AKPQTYMNFSGESVGQL-AAYYQVPLRHILLVHDEMSLPNGVLRLK-PKRGHGHHNGVKS 329
                YMN SGE V ++ A Y +   RH+ ++HDE+S+  G ++L+ P      HNG++S
Sbjct: 67  RSDGQYMNLSGEQVCKVWARYAKYQARHV-VIHDELSVACGKVQLRAPSTSIRGHNGLRS 125

Query: 328 VMEHLDGCHQFPRLCIGIGNPPGA 257
           +++   G   F +L IGIG  PG+
Sbjct: 126 LLKCSGGRVPFAKLAIGIGREPGS 149



>gb:AF244656_492194 Carboxydothermus hydrogenoformans peptidyl-tRNA
           hydrolase gene, partial cds.
          Length = 90

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 32/80 (40%), Positives = 53/80 (66%)
 Frame = -1

Query: 628 TRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTYMNFSGESVGQLA 449
           TRHN G  + D++ ++ GIL+   + K+L+  G I  V V+L KPQTYMN SG +V +  
Sbjct: 2   TRHNAGLLVSDELGKKHGILITKRKFKSLVAAGEILGVXVLLLKPQTYMNLSGTAVQEAV 61

Query: 448 AYYQVPLRHILLVHDEMSLP 389
           ++ ++PL  +++V+D+  LP
Sbjct: 62  SFNKLPLSRLVVVYDDEDLP 81



>gb:MGU02185_143677 Mycoplasma genitalium random genomic clone sf1,
           partial cds.
          Length = 116

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 38/120 (31%), Positives = 68/120 (56%)
 Frame = -1

Query: 454 LAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVMEHLDGCHQFPRLCIGI 275
           L  ++Q+PL +I++VHDE++   GV+RLK +    +HNG+KSV+ HLD   QF RL  GI
Sbjct: 3   LQDHFQIPLANIMIVHDEIAFDLGVIRLKMQGSANNHNGIKSVIRHLD-TEQFNRLRFGI 61

Query: 274 GNPPGAMDMKAFLLQKFSETERKQVDEALKEGAEAVRTLVREGVGSRLSRFNIGQKYKYH 95
            +   +  +   ++ +F  +E  +++ A+ +  E ++  +    G  L R     +Y +H
Sbjct: 62  KSQNTSNILHEQVMSEFQNSELTKLEVAITKSVELLKRYIE---GEELQRL---MEYYHH 115



>gb:CR382134_1667324 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 215

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 49/168 (29%), Positives = 85/168 (50%), Gaps = 13/168 (7%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALI--GIGSIGEV----PV 509
           ++A +GNP  +Y GTRHNVG   +D++        N  Q+   I  G+ S   V     +
Sbjct: 11  MIASIGNPEPQYQGTRHNVGHWALDELITNHWTSFNQFQNHKNIPDGVYSTSRVEDLSDI 70

Query: 508 VLAKP-QTYMNFSGESVG---QLAAYYQVPLRH--ILLVHDEMSLPNGVLRLKPKRGHGH 347
            L K   ++MN  G  V    Q  + YQ   R   ++++HDE+ +P G  +++ +     
Sbjct: 71  FLFKSIYSFMNLQGAPVSKTWQKVSNYQKATRSPALVVLHDELQVPFGKFQIRKQLSSAR 130

Query: 346 -HNGVKSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERK 206
            HNG++S+   + G   + ++ IGIG P  A D+  ++L  F+  E++
Sbjct: 131 GHNGLRSIDSLMGG--GYTKISIGIGKPT-AKDLSNYVLSPFTPLEQE 175



>gb:CHTHSPORF_846282 Chlamydia muridarum putative heat shock protein
           gene, partial cds; ribosomal protein S18 homolog and
           putative heat shock protein genes, complete cds; and
           putative heat shock protein gene, partial cds.
          Length = 168

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 2/117 (1%)
 Frame = -1

Query: 511 VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVK 332
           +VL KP TY+N +G++V     ++ V +  IL+V D+++   G +R +   G G HNG+K
Sbjct: 32  IVLIKPSTYVNLTGKAVLAAKRFFGVSVEGILIVADDINREFGSIRFRQDCGAGGHNGLK 91

Query: 331 SVMEHLDGCHQFPRLCIGIGNP--PGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
           +  + L   H + +L +G+G P  P +     ++L  FS  ERK ++   ++G E +
Sbjct: 92  NTTQVLQSNHYW-QLRLGVGRPSNPESEGGADYVLSNFSFNERKGLNGFFEKGIEEI 147



>pir|C37840|C37840 hypothetical protein (S18 5' region) - Chlamydia
           trachomatis (fragment)
          Length = 168

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 37/117 (31%), Positives = 66/117 (56%), Gaps = 2/117 (1%)
 Frame = -1

Query: 511 VVLAKPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKRGHGHHNGVK 332
           +VL KP TY+N +G++V     ++ V +  IL+V D+++   G +R +   G G HNG+K
Sbjct: 32  IVLIKPSTYVNLTGKAVLAAKRFFGVSVEGILIVADDINREFGSIRFRQDCGAGGHNGLK 91

Query: 331 SVMEHLDGCHQFPRLCIGIGNP--PGAMDMKAFLLQKFSETERKQVDEALKEGAEAV 167
           +  + L   H + +L +G+G P  P +     ++L  FS  ERK ++   ++G E +
Sbjct: 92  NTTQVLQSNHYW-QLRLGVGRPSNPESEGGADYVLSNFSFNERKGLNGFFEKGIEEI 147



>gb:CR380959_1653957 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 196

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 44/142 (30%), Positives = 67/142 (47%), Gaps = 8/142 (5%)
 Frame = -1

Query: 667 VAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQT 488
           + G+GNP   Y GTRHNVG  ++D       +L+  +  +        G+V V+     T
Sbjct: 21  LTGIGNPEPSYKGTRHNVGLTVLD-------LLIKQLVPRDQHVFRREGKVHVLRTPTIT 73

Query: 487 -------YMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLK-PKRGHGHHNGVK 332
                  +MN SG SV  +            ++HDE+SL  G L+L+ P+     HNG++
Sbjct: 74  FIRSDIGFMNLSGRSVVPMWQKLYTDHTDYAVIHDELSLRTGALQLRQPQASLRGHNGLR 133

Query: 331 SVMEHLDGCHQFPRLCIGIGNP 266
            +  H    HQ+ +L IGI  P
Sbjct: 134 DISAHWR--HQYYKLAIGIDRP 153



>gb:AE016819_1749280 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 199

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 48/167 (28%), Positives = 83/167 (49%), Gaps = 9/167 (5%)
 Frame = -1

Query: 667 VAGLGNPGNKYHGTRHNVGFEMIDQISQE----EGILLNTIQSKALIGIGSIGEVPVVLA 500
           + GLGNP  +Y  TRHN G  ++D +       +  +  T+   A     +     ++L 
Sbjct: 19  LTGLGNPEPQYRNTRHNAGLILLDLLKAHYAPGKPWMPCTVPRVAASYCHASRHDLLLLR 78

Query: 499 KPQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLK-PKRGHGHHNGVKSVM 323
               +MN SG++V  L  + ++     ++VHDE+SLP G ++L+ P R    HNG+KS++
Sbjct: 79  SDGAFMNRSGQNVVPL--WQRIGGATRVVVHDELSLPLGKVQLRAPGRSPRGHNGLKSII 136

Query: 322 EHLDGCHQFPRLCIGIGNP----PGAMDMKAFLLQKFSETERKQVDE 194
                   +  L +GI  P    P A  +  ++L +FS  E  Q+++
Sbjct: 137 A-AGAQGTYYSLAVGIDRPETRKPAA--IADYVLSRFSRAELSQLEQ 180



>sp|O74806|PTH_SCHPO Putative peptidyl-tRNA hydrolase (EC 3.1.1.29)
           (PTH).>pir|T40118|T40118 peptidyl-trna hydrolase -
           fission yeast (Schizosaccharomyces
           pombe)>gb:SPBC2D10_1719785 S.pombe chromosome II cosmid
           c2D10.
          Length = 218

 Score = 56.6 bits (135), Expect = 8e-07
 Identities = 47/177 (26%), Positives = 81/177 (45%), Gaps = 19/177 (10%)
 Frame = -1

Query: 670 LVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ 491
           ++ GLGNPG+ +  +RH++G  M+   +       N   +K            + L    
Sbjct: 32  IIYGLGNPGSAFVKSRHSLGKLMVSMYADSMAFPKNWPSTKE----------NLTLVLST 81

Query: 490 TYMNFSGESVGQLAAYY---QVPLRHI--LLVHDEMSLPNGVLRLK-PKRGHGHHNGVKS 329
           +YMN SG+ + +++  +     PL  I  ++VHDE+ L  G ++L+ P   H  HNG++S
Sbjct: 82  SYMNDSGKQLKKISNDFVRKVSPLDKIVYVVVHDELELDLGKVKLRLPGGSHRGHNGIRS 141

Query: 328 VMEHL-----------DGCHQFPRLCIGIG--NPPGAMDMKAFLLQKFSETERKQVD 197
             E L                F R+ +GIG        D+  ++L KF+  E K ++
Sbjct: 142 CQEFLGKEVRYTFNFITNSKSFYRIGLGIGRCESRNREDVSDYVLSKFNSNEMKLIE 198



>gb:CR382134_1667124 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 210

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 43/168 (25%), Positives = 82/168 (48%), Gaps = 9/168 (5%)
 Frame = -1

Query: 673 WLVAGLGNPGN-KYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAK 497
           +++  +GNPG+   H T H V   +I+    ++   L    S ++  +  +  + +V  K
Sbjct: 9   FIIFSIGNPGSTNRHSTGHIVMKALIEYFGAKQ---LFKPLSNSMYSMTEVDNIALV--K 63

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRH--ILLVHDEMSLPNGVLRLKPKRGHGHHNGVKSVM 323
              YMN S + + Q     ++ LR   +++V+DE  L  G +++ P + +  HNG++S+ 
Sbjct: 64  SNNYMNDSNKLLKQYIEQEKIGLRQAVLIVVYDEFDLDLGKVKISPFKKNESHNGIRSIK 123

Query: 322 EHL---DGCHQFPRLCIGIGNPPG---AMDMKAFLLQKFSETERKQVD 197
           E++          +L IGIG  P       M +++L  F   ER+ +D
Sbjct: 124 EYISRQSADLTVYKLGIGIGPKPSNATTSTMSSWVLSNFKPDERQIID 171



>gb:CR382123_1655745 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 186

 Score = 53.1 bits (126), Expect = 9e-06
 Identities = 47/179 (26%), Positives = 90/179 (50%), Gaps = 8/179 (4%)
 Frame = -1

Query: 667 VAGLGNPGNKYHGTRHNVGFEMIDQISQE---EGILLNTIQSKALIGIGSIGEVPVVLAK 497
           ++ LGNP   Y  TRHN G  M+  +  E   + +L  +  S  +          ++L  
Sbjct: 9   LSALGNPEPLYRSTRHNAGVIMLRMLKNEFCPDAVLKTSNVSPHIQYCHEPRLNLLMLFN 68

Query: 496 PQTYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRL-KPKRGHGHHNGVKSVME 320
              +MN SG ++  +         H++L HDE+++P G ++L KP      HNG++ +++
Sbjct: 69  KSQFMNLSGHAMIPVWRKLPHDALHVVL-HDELNIPIGNVQLRKPGTSFRGHNGLRDMIK 127

Query: 319 HLDGCHQFPRLCIGIGNPPGAMDMKA---FLLQKFSETERKQVD-EALKEGAEAVRTLV 155
            + G  +F +L IGI + P + D +    ++L  F++ E + +  ++ ++  E VR L+
Sbjct: 128 -MKGDDKFHKLGIGI-DRPNSRDPRIVADYVLANFTKGEMETLQYDSFQKAVEHVRKLL 184



>gb:AX972822_1488131 Sequence 3625 from Patent EP1104808.
          Length = 119

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 28/83 (33%), Positives = 48/83 (57%), Gaps = 3/83 (3%)
 Frame = -1

Query: 709 PEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEEGILLNTIQSK---ALI 539
           P P G +     W+VAGLGNPG    GTRH+VG  ++ Q+++  G+  +  + +   A +
Sbjct: 24  PRPPGKR-----WMVAGLGNPG--LPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADL 76

Query: 538 GIGSIGEVPVVLAKPQTYMNFSG 470
            +  +G+  +VL +P+  MN +G
Sbjct: 77  ALAPLGDAQLVLLRPRLLMNANG 99



>gb:NCB14A6_1689294 Neurospora crassa DNA linkage group V BAC contig
           B14A6.
          Length = 228

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 42/151 (27%), Positives = 73/151 (48%), Gaps = 15/151 (9%)
 Frame = -1

Query: 673 WLVAGLGNPGNKYHGTRHNVGFEMID----QISQEEGILLNTIQSKALIGIGSIGEVPVV 506
           +LV  LGNPG +Y  T H+ G  +++    ++ ++ G    T +      + +       
Sbjct: 36  FLVVSLGNPG-EYRDTFHSAGHLVLESFQKKLPEDLGQPSFTSERYGKKAVRASAGSKYT 94

Query: 505 LAKPQTYMNFSGESVGQLAAYYQVPLRH--------ILLVHDEMSLPNGVLRLKP-KRGH 353
           L +  T MN +G  + +  AY    + H        ++LVHD++    GV++++  K  H
Sbjct: 95  LLQSPTLMNITGPWLAR--AYKDYLVDHGLSPEEVGLVLVHDDLEEELGVVKVRQWKASH 152

Query: 352 GHHNGVKSVMEHLDGC--HQFPRLCIGIGNP 266
             HNG+KSV+  L      ++ R+ IGIG P
Sbjct: 153 RGHNGIKSVLASLPPIPDAKWARVSIGIGRP 183



>gb:AP005869_1859336 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 210

 Score = 38.9 bits (89), Expect = 0.18
 Identities = 19/40 (47%), Positives = 24/40 (60%)
 Frame = -1

Query: 856 PCRPCSPSTFMSMLYSLSPAKSCMVPYPRCPCSHPRHLAP 737
           PCRPCS +T   +  S SP    ++P  RC C HP HL+P
Sbjct: 118 PCRPCS-ATHAGLPQSSSP----LMPASRCHCRHPLHLSP 152



>sp|P59573|SYGB_BUCBP Glycyl-tRNA synthetase beta chain (EC
           6.1.1.14) (Glycine--tRNA ligase beta chain)
           (GlyRS).>gb:AE014016_302544 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), section 1 of 2 of the complete
           genome.>gb:AE016826_981145 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 697

 Score = 35.8 bits (81), Expect = 1.5
 Identities = 36/170 (21%), Positives = 72/170 (42%), Gaps = 12/170 (7%)
 Frame = -1

Query: 658 LGNPGN--KYHGTRHNVGFEMIDQISQEEGILLNTIQSKALIGIGSIGEVPVVLAKPQ-- 491
           LGNP +  K+   + N+    I  ++  +G   + +    +    SI E+ + L +    
Sbjct: 83  LGNPTSIMKFWMQKMNIKIHEITYLNTNKG---SWVTCSKITNKKSIQEILIELCRLAIK 139

Query: 490 -----TYMNFSGESVGQLAAYYQVPLRHILLVHDEMSLPNGVLRLKPKR---GHGHHNGV 335
                T+M +S   +      +  P+R+++++ +   + N VL L+  R   GH      
Sbjct: 140 NISIPTFMKWSNNDI-----QFSRPVRNVIMLLNHEIIRNNVLGLETNRLLSGHKFMTNN 194

Query: 334 KSVMEHLDGCHQFPRLCIGIGNPPGAMDMKAFLLQKFSETERKQVDEALK 185
           K ++ H    +Q+P L +  G      D +   +QK +    + V+  LK
Sbjct: 195 KIILNH---AYQYPELLLNSGKVIADYDARKHKIQKHASIAAQSVNGILK 241



>gb:AP005290_1849959 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1282_E10.
          Length = 259

 Score = 35.4 bits (80), Expect = 2.0
 Identities = 26/86 (30%), Positives = 36/86 (41%), Gaps = 4/86 (4%)
 Frame = -1

Query: 856 PCRPCSPSTFMSMLYSLSPAKSCMVPYPRC-PCSHPRHLAPVRIRASASLPEPNGAKVEY 680
           P R C+ S        L+ A + + P     P SH  HL P R+R  AS+P      +  
Sbjct: 149 PSRRCATSALQPACLHLAAASNDIEPTSALMPPSHHLHLQPARLRLGASIPPAASVSI-- 206

Query: 679 TPWLV---AGLGNPGNKYHGTRHNVG 611
             W V   AG+G  G+    + H  G
Sbjct: 207 --WQVSVSAGIGTTGDGRIASVHMAG 230



>gb:AB125167_1873844 Macaca fascicularis FCMD mRNA for Fukuyama type
           congenital muscular dystrophy, fukutin, complete cds.
          Length = 461

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 5/41 (12%)
 Frame = +2

Query: 194 FIYLFP---LCFTEFLEKKSLHIHCS--RWVSYSYAKSWKL 301
           F YLFP   LC+TEF++ K +H+ C    ++  +Y K+WK+
Sbjct: 390 FKYLFPKFTLCWTEFVDMK-VHVPCETLEYIEANYGKTWKI 429



>gb:AB008226_1864081 Homo sapiens FCMD mRNA for fukutin, complete
           cds.
          Length = 461

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 5/41 (12%)
 Frame = +2

Query: 194 FIYLFP---LCFTEFLEKKSLHIHCS--RWVSYSYAKSWKL 301
           F YLFP   LC+TEF++ K +H+ C    ++  +Y K+WK+
Sbjct: 390 FKYLFPKFTLCWTEFVDMK-VHVPCETLEYIEANYGKTWKI 429



>gb:AP003488_1829888 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0436F11.
          Length = 396

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 36/130 (27%), Positives = 52/130 (40%), Gaps = 29/130 (22%)
 Frame = -1

Query: 910 YHSSVTGREIRGF------------RDDRLPCRPCSP--STFMSMLYSLSPAKSCMVPYP 773
           +H+SV GR   GF              D LP  P SP  S  + ++ +LS   +   P P
Sbjct: 110 FHASVHGRHFLGFVAALSASVHGRKLSDPLPSPP-SPVVSALLELISALSAFVASTPPLP 168

Query: 772 ---------------RCPCSHPRHLAPVRIRASASLPEPNGAKVEYTPWLVAGLGNPGNK 638
                          +   S  + +AP  I A+A  P+  GA+ E  P+L+   GN    
Sbjct: 169 HNSRYGNPAFRLWHEKLSDSANQLIAP--IMATAGSPDLAGAEAELAPYLLDSFGNATRI 226

Query: 637 YHGTRHNVGF 608
            +GT H   F
Sbjct: 227 DYGTGHETNF 236



>sp|O75072|FCMD_HUMAN Fukutin (EC 2.-.-.-) (Fukuyama-type congenital
           muscular dystrophy protein).>gb:AB038490_1866711 Homo
           sapiens gene for fukutin, complete
           cds.>gb:AL158070_1921284 Human DNA sequence from clone
           RP11-235C23 on chromosome 9q31.1-31.3 Contains part of a
           pseudogene similar to KIAA1272, KIAA0884, Drosophila
           CG5521 and rat Tulip 1 and 2 proteins, the 3' end of the
           CSDUFD1 gene for cystatin and DUF19 domain containing 1,
           a novel gene, the FCMD gene for Fukuyama type congenital
           muscular dystrophy protein, the TAL2 gene for T-cell
           acute lymphocytic leukemia 2 protein and two CpG
           islands, complete sequence.
          Length = 461

 Score = 35.0 bits (79), Expect = 2.6
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 5/41 (12%)
 Frame = +2

Query: 194 FIYLFP---LCFTEFLEKKSLHIHCS--RWVSYSYAKSWKL 301
           F YLFP   LC+TEF++ K +H+ C    ++  +Y K+WK+
Sbjct: 390 FKYLFPKFTLCWTEFVDMK-VHVPCETLEYIEANYGKTWKI 429



>gb:AP004267_1839446 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0039H02.>gb:AP004664_1842905 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0428D12.
          Length = 517

 Score = 34.7 bits (78), Expect = 3.3
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 1/89 (1%)
 Frame = +1

Query: 307 NHPDAPLHFSPRYDGHVLAWA*ASKHHLVNSSRHEPVGYVARVLDNMQQVVQPILH*NSY 486
           NH    L+F+P + GH+L      K+ +V   +    G+V  VL     V  P LH  SY
Sbjct: 230 NHKQMSLYFAPAFFGHLLGKCIKRKYPIVEVMK---FGFV--VLGTFAFVWWPFLH--SY 282

Query: 487 KSEALLIP-LAPLQ*NLFQSMLLTVLCST 570
           ++   +I  LAP +  +++  +    CST
Sbjct: 283 EAAMQVISRLAPFERGIYEDYVANFWCST 311



>gb:AY071243_1295327 Drosophila melanogaster RE28421 full length
           cDNA.
          Length = 443

 Score = 34.3 bits (77), Expect = 4.4
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +2

Query: 170 CLGPFFQCFIYLFPLCFTEFLEKKSLHIHCSRWVSYSYAKSWKLMA 307
           CLG F  C ++L+P  +++ L + +LH+ C + +    A S  ++A
Sbjct: 266 CLGAFSLCAVFLYPAKYSDTLHRATLHLGCWQRIDREPAPSQLIVA 311



>gb:AC125735_1208090 Leishmania major strain Friedlin chromosome 3,
           complete sequence.
          Length = 2087

 Score = 34.3 bits (77), Expect = 4.4
 Identities = 22/84 (26%), Positives = 34/84 (40%)
 Frame = -1

Query: 757 HPRHLAPVRIRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQISQEE 578
           H RH +P  + A+  +P P+ A +  T W  A  G       G  H V        +   
Sbjct: 295 HHRHQSPGAVAAAGVVPSPSPADLANTKWKEASSGAGAGVGGGCAHAV------PSATAA 348

Query: 577 GILLNTIQSKALIGIGSIGEVPVV 506
           G    T+ + A +  GS  E P++
Sbjct: 349 GNYRTTLTASAAVASGSTNEPPII 372



>gb:AE013599_1131787 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003815_1225857 Drosophila melanogaster
           chromosome 2R, section 35 of 74 of the complete
           sequence.
          Length = 443

 Score = 34.3 bits (77), Expect = 4.4
 Identities = 14/46 (30%), Positives = 27/46 (58%)
 Frame = +2

Query: 170 CLGPFFQCFIYLFPLCFTEFLEKKSLHIHCSRWVSYSYAKSWKLMA 307
           CLG F  C ++L+P  +++ L + +LH+ C + +    A S  ++A
Sbjct: 266 CLGAFSLCAVFLYPAKYSDTLHRATLHLGCWQRIDREPAPSQLIVA 311



>gb:BC017538_2092485 Mus musculus Fukuyama type congenital muscular
           dystrophy homolog (human), mRNA (cDNA clone MGC:28842
           IMAGE:4506804), complete cds.
          Length = 461

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 5/41 (12%)
 Frame = +2

Query: 194 FIYLFP---LCFTEFLEKKSLHIHCSR--WVSYSYAKSWKL 301
           F YLFP   LC+TEF++ K +H+ C    ++  +Y K+WK+
Sbjct: 390 FKYLFPKFTLCWTEFVDIK-VHVPCETVDYIEANYGKTWKI 429



>sp|Q8R507|FCMD_MOUSE Fukutin (EC 2.-.-.-).>gb:AK085931_1174623 Mus
           musculus 16 days neonate heart cDNA, RIKEN full-length
           enriched library, clone:D830030O17 product:BA235C23.2
           (FUKUYAMA TYPE CONGENITAL MUSCULAR DYSTROPHY PROTEIN)
           homolog [Homo sapiens], full insert
           sequence.>gb:AB077383_2047628 Mus musculus mRNA for
           Fukutin, complete cds,
           strain:C57BL/6.>gb:MMU511807_2121864 Mus musculus mRNA
           for fukutin (Fcmd gene), strain C57.
          Length = 461

 Score = 33.9 bits (76), Expect = 5.7
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 5/41 (12%)
 Frame = +2

Query: 194 FIYLFP---LCFTEFLEKKSLHIHCSR--WVSYSYAKSWKL 301
           F YLFP   LC+TEF++ K +H+ C    ++  +Y K+WK+
Sbjct: 390 FKYLFPKFTLCWTEFVDIK-VHVPCETVDYIEANYGKTWKI 429



>gb:AE016789_333502 Pseudomonas putida KT2440 section 16 of 21 of
           the complete genome.>gb:AE015451_948579 Pseudomonas
           putida KT2440 complete genome.
          Length = 231

 Score = 33.5 bits (75), Expect = 7.4
 Identities = 31/105 (29%), Positives = 40/105 (38%)
 Frame = -1

Query: 766 PCSHPRHLAPVRIRASASLPEPNGAKVEYTPWLVAGLGNPGNKYHGTRHNVGFEMIDQIS 587
           P  HP  L         SLP PNG KV         L   G  Y    H V F+  DQ+S
Sbjct: 14  PAKHPERLQLY------SLPTPNGVKVSIM------LEEIGLAYEA--HKVSFDNDDQLS 59

Query: 586 QEEGILLNTIQSKALIGIGSIGEVPVVLAKPQTYMNFSGESVGQL 452
            E   L    +  A++     G  P+ L +    + +  E  GQL
Sbjct: 60  PEFISLSANNKIPAILDPNGPGGQPLALFESGAILQYLAEKSGQL 104



>gb:BA000030_703421 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 215

 Score = 33.1 bits (74), Expect = 9.7
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +2

Query: 602 HFKTNIVPRSMVLVSRVPQSCDQPWSV 682
           H KTN+   + +L + +P  CDQPW V
Sbjct: 112 HVKTNVTAMTAMLTAHLPWICDQPWVV 138


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,169,655,326
Number of Sequences: 1806583
Number of extensions: 26585680
Number of successful extensions: 67369
Number of sequences better than 10.0: 233
Number of HSP's better than 10.0 without gapping: 64122
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67017
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 81189682800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)