BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13277
         (854 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003240_1826030 Oryza sativa (japonica cultivar-group) genom...   202   3e-52   
gb:AC097277_1736509 Oryza sativa chromosome 3 BAC OSJNBa0022C08 ...   202   9e-51   
gb:AB106274_1526672 Lilium longiflorum LlSCL mRNA for SCARECROW-...   201   1e-50   
pir|T02531|T02531 probable SCARECROW gene regulator At2g37650 [i...   188   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00182_1696318 Oryza sativa genomic DNA, chromosome 4, BAC...   187   2e-46   
gb:AC079356_1732523 Oryza sativa (japonica cultivar-group) chrom...   186   4e-46   
gb:AC079022_1541719 Oryza sativa chromosome 5 clone P0574H01, co...   186   4e-46   
gb:AC079022_1541720 Oryza sativa chromosome 5 clone P0574H01, co...   181   2e-44   
gb:AF036306_1762942 Arabidopsis thaliana scarecrow-like 9 (SCL9)...   178   1e-43   
pir|T51240|T51240 scarecrow-like protein 9 [imported] - Arabidop...   178   1e-43   Arabidopsis thaliana [mouse-ear cress]
pir|T02736|T02736 probable SCARECROW gene regulator [imported] -...   167   2e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AF036307_1762943 Arabidopsis thaliana scarecrow-like 11 (SCL1...   163   4e-39   
gb:AB025604_1516260 Arabidopsis thaliana genomic DNA, chromosome...   163   4e-39   
pir|T51233|T51233 scarecrow-like protein 11 [imported] - Arabido...   163   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AY087418_1572449 Arabidopsis thaliana clone 35201 mRNA, compl...   161   1e-38   
pir|T45597|T45597 scarecrow-like protein - Arabidopsis thaliana>...   161   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb:AE005172_889759 Arabidopsis thaliana chromosome 1, top arm co...   156   4e-38   
gb:AF036309_1762945 Arabidopsis thaliana scarecrow-like 14 (SCL1...   147   3e-34   
pir|T51232|T51232 scarecrow-like protein 14 [imported] - Arabido...   147   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AP003791_1833397 Oryza sativa (japonica cultivar-group) genom...    94   3e-18   
gb:AP003791_1833400 Oryza sativa (japonica cultivar-group) genom...    94   3e-18   
gb:AC109602_1738782 Oryza sativa chromosome 3 BAC OSJNBa0087M10 ...    93   6e-18   
gb:AP004235_1839095 Oryza sativa (japonica cultivar-group) genom...    91   2e-17   
gb:AK176099_1818087 Arabidopsis thaliana mRNA for putative SCARE...    90   6e-17   
pir|G84462|G84462 probable SCARECROW gene regulator [imported] -...    90   6e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AK175990_1817978 Arabidopsis thaliana mRNA for putative SCARE...    89   1e-16   
gb:AF036301_1762937 Arabidopsis thaliana scarecrow-like 3 (SCL3)...    86   7e-16   
pir|E96540|E96540 hypothetical protein F11F12.22 [imported] - Ar...    86   7e-16   Arabidopsis thaliana [mouse-ear cress]
pir|T51235|T51235 scarecrow-like protein 3 [imported] - Arabidop...    86   7e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003227_1825676 Oryza sativa (japonica cultivar-group) genom...    86   9e-16   
gb:AE016959_1022186 Oryza sativa (japonica cultivar-group) chrom...    84   3e-15   
gb:AY062210_1565005 Oryza sativa chitin-inducible gibberellin-re...    82   1e-14   
gb:AF378125_1793344 Vitis vinifera GAI-like protein 1 (GAI1) gen...    81   2e-14   
gb:AK117483_1815516 Arabidopsis thaliana At5g48150 mRNA for puta...    80   4e-14   
gb:AB023039_1515421 Arabidopsis thaliana genomic DNA, chromosome...    80   4e-14   
gb:AK118009_1816011 Arabidopsis thaliana At3g03450 mRNA for puta...    80   6e-14   
gb:AY326306_1599657 Cucurbita maxima gibberellic acid insensitiv...    80   6e-14   
gb:ATAC009895_1543077 Arabidopsis thaliana chromosome III BAC T2...    80   6e-14   
gb:AF036302_1762938 Arabidopsis thaliana scarecrow-like 5 (SCL5)...    79   8e-14   
gb:CRU303349_1673662 Capsella rubella ORF1, ORF2, ORF3, ORF4, OR...    79   8e-14   
gb:BT000883_1635138 Arabidopsis thaliana clone C105359 putative ...    79   8e-14   
gb:AY034929_1559714 Arabidopsis thaliana putative scarecrow prot...    79   8e-14   
pir|E96542|E96542 scarecrow-like protein [imported] - Arabidopsi...    79   8e-14   Arabidopsis thaliana [mouse-ear cress]
pir|T51236|T51236 scarecrow-like protein 5 [imported] - Arabidop...    79   8e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AY039611_1560324 Arabidopsis thaliana F17J6.12/F17J6.12 mRNA,...    79   1e-13   
gb:BT001076_1635331 Arabidopsis thaliana At4g17230/dl4650c mRNA,...    78   2e-13   
gb:AF036300_1762936 Arabidopsis thaliana scarecrow-like 1 (SCL1)...    77   3e-13   
pir|E86347|E86347 scarecrow-like 1 protein F24J8.8 - Arabidopsis...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
pir|T51234|T51234 scarecrow-like protein 1 [imported] - Arabidop...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AB189844_1529557 Daucus carota DcLSLP mRNA for lateral suppre...    77   5e-13   
gb:AP000378_1819856 Arabidopsis thaliana genomic DNA, chromosome...    76   7e-13   
gb:AF036305_1762941 Arabidopsis thaliana scarecrow-like 8 (SCL8)...    76   7e-13   
gb:AY099686_1576711 Arabidopsis thaliana SCARECROW transcription...    76   7e-13   
pir|T51239|T51239 scarecrow-like protein 8 [imported] - Arabidop...    76   7e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AF036308_1762944 Arabidopsis thaliana scarecrow-like 13 (SCL1...    76   9e-13   
pir|T51241|T51241 scarecrow-like protein 13 [imported] - Arabido...    76   9e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP003259_1826533 Oryza sativa (japonica cultivar-group) genom...    75   1e-12   
gb:AY052239_1562612 Arabidopsis thaliana At2g01570/F2I9.19 mRNA,...    75   2e-12   
gb:ATY15194_1557522 Arabidopsis thaliana mRNA for GRS protein.         75   2e-12   
gb:ATY15193_1557521 Arabidopsis thaliana GAI gene.                     75   2e-12   
gb:ATRGA2_1554046 A.thaliana mRNA for RGA2 gene.                       75   2e-12   
gb:ATRGA1_1554045 A.thaliana mRNA for RGA1 gene.                       75   2e-12   
gb:AE005173_893441 Arabidopsis thaliana chromosome 1, bottom arm...    75   2e-12   
pir|H86282|H86282 protein F10B6.34 [imported] - Arabidopsis thal...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
pir|D84426|D84426 hypothetical protein At2g01570 [imported] - Ar...    75   2e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AY269087_1594027 Lycopersicon esculentum GAI-like protein mRN...    75   2e-12   
gb:LES303345_1684555 Lycopersicon esculentum lateral suppressor ...    74   3e-12   
gb:AY326307_1599658 Cucurbita maxima gibberellic acid insensitiv...    73   6e-12   
gb:OSJN00086_1694639 Oryza sativa genomic DNA, chromosome 4, BAC...    73   8e-12   
gb:ATA224957_1542702 Arabidopsis thaliana RGAL gene.                   72   1e-11   
pir|G96688|G96688 hypothetical protein T27F4.10 [imported] - Ara...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AX081276_1460755 Sequence 1 from Patent WO0109356.                  72   1e-11   
gb:AY389546_1178192 Hyacinthus orientalis GAI-like protein mRNA,...    72   1e-11   
gb:AF492570_1804930 Argyroxiphium kauense clone AkBcopy1n GIA/RG...    72   2e-11   
pir|T51475|T51475 RGA-like protein - Arabidopsis thaliana>gb:ATK...    72   2e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AY184482_1587927 Brassica rapa subsp. pekinensis phytochrome ...    71   2e-11   
gb:AX081278_1460756 Sequence 3 from Patent WO0109356.                  70   4e-11   
gb:AF492575_1804934 Carlquistia muirii clone Cm1 GIA/RGA-like gi...    70   5e-11   
gb:AF492572_1804932 Argyroxiphium sandwicense subsp. macrocephal...    70   5e-11   
gb:AF492571_1804931 Argyroxiphium sandwicense subsp. macrocephal...    70   5e-11   
gb:AF492568_1804928 Wilkesia gymnoxiphium clone WgBcopy2 GIA/RGA...    70   5e-11   
gb:AF492567_1804927 Dubautia raillardioides clone DrBcopy GIA/RG...    70   5e-11   
gb:AF492566_1804926 Dubautia menziesii clone DmeBcopy GIA/RGA-li...    70   5e-11   
gb:AF492565_1804925 Dubautia ciliolata subsp. glutinosa clone Dc...    70   5e-11   
gb:AF492564_1804924 Dubautia ciliolata subsp. glutinosa clone Dc...    70   5e-11   
gb:AF492563_1804923 Dubautia arborea clone DaBcopy2 GIA/RGA-like...    70   5e-11   
gb:AF492562_1804922 Dubautia arborea clone DaBcopy1 GIA/RGA-like...    70   5e-11   
gb:AF492576_1804935 Carlquistia muirii clone Cm2 GIA/RGA-like gi...    70   7e-11   
gb:AY208992_1589641 Gossypium hirsutum GIA/RGA-like gibberellin ...    69   1e-10   
gb:AB030956_1518584 Oryza sativa (japonica cultivar-group) mRNA ...    69   1e-10   
gb:AF492573_1804933 Madia sativa clone MsCod1 GIA/RGA-like gibbe...    69   1e-10   
gb:AF492590_1804949 Dubautia microcephala clone DmiAcopy1 GIA/RG...    68   2e-10   
gb:AF492589_1804948 Dubautia raillardioides clone DrAcopy1 GIA/R...    68   2e-10   
gb:AF492587_1804946 Dubautia knudsenii clone DkAcopy1 GIA/RGA-li...    68   2e-10   
gb:AF492586_1804945 Dubautia arborea clone DaAcopy1 GIA/RGA-like...    68   2e-10   
gb:AF492582_1804941 Argyroxiphium sandwicense subsp. macrocephal...    68   2e-10   
gb:AF492581_1804940 Argyroxiphium sandwicense subsp. macrocephal...    68   2e-10   
gb:AF492580_1804939 Anisocarpus madioides clone ANm2b GIA/RGA-li...    68   2e-10   
gb:AF492578_1804937 Calycadenia multiglandulosa clone CLmCod7 GI...    68   3e-10   
gb:AF492584_1804943 Argyroxiphium kauense clone AkAcopy2 GIA/RGA...    67   4e-10   
gb:AF492583_1804942 Argyroxiphium kauense clone AkAcopy1 GIA/RGA...    67   4e-10   
gb:ZMA242530_1731466 Zea mays partial d8 gene for gibberellin re...    67   6e-10   
gb:AY117079_1579155 Gossypioides kirkii putative RGA1 protein ge...    66   7e-10   
gb:AY117075_1579151 Gossypium herbaceum putative RGA1 protein ge...    66   7e-10   
gb:AF492588_1804947 Dubautia menziesii clone DmeAcopy1 GIA/RGA-l...    65   1e-09   
gb:TAE242531_1724288 Triticum aestivum rht-D1a gene for gibberel...    65   2e-09   
gb:AY117078_1579154 Gossypium barbadense D-subgenome putative RG...    64   4e-09   
gb:AP002910_1823868 Oryza sativa (japonica cultivar-group) genom...    63   6e-09   
gb:AY464568_1607946 Oryza sativa GAI protein mRNA, complete cds.       63   6e-09   
pir|D96656|D96656 hypothetical protein F16M19.21 [imported] - Ar...    63   6e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AF460219_1801797 Hordeum vulgare subsp. vulgare nuclear trans...    63   8e-09   
gb:AY062209_1565004 Oryza sativa chitin-inducible gibberellin-re...    59   9e-08   
gb:AC146936_1744640 Oryza sativa chromosome 3 B1154F06 genomic s...    59   2e-07   
gb:AY224426_1590628 Oryza sativa (japonica cultivar-group) isola...    59   2e-07   
gb:AP003985_1835945 Oryza sativa (japonica cultivar-group) genom...    56   8e-07   
gb:AY062538_1565194 Arabidopsis thaliana SCARECROW gene regulato...    56   8e-07   
gb:AB010700_1511253 Arabidopsis thaliana genomic DNA, chromosome...    56   8e-07   
gb:AF413158_1797449 Zea mays cultivar NC320 DWARF8 gene, partial...    55   1e-06   
gb:AF413117_1797408 Zea mays cultivar CMV3 DWARF8 gene, partial ...    54   4e-06   
gb:AF413114_1797405 Zea mays cultivar CM7 DWARF8 gene, partial cds.    54   4e-06   
gb:AF413112_1797403 Zea mays cultivar A619 DWARF8 gene, partial ...    54   4e-06   
gb:AF413186_1797477 Zea mays cultivar M37W DWARF8 gene, partial ...    54   5e-06   
gb:AF413141_1797432 Zea mays cultivar NC260 DWARF8 gene, partial...    54   5e-06   
gb:AF413192_1797483 Zea mays cultivar EP1 DWARF8 gene, partial cds.    53   6e-06   
gb:AF413189_1797480 Zea mays cultivar B103 DWARF8 gene, partial ...    53   6e-06   
gb:AF413176_1797467 Zea mays cultivar MO24W DWARF8 gene, partial...    53   6e-06   
gb:AF413171_1797462 Zea mays cultivar GT112 DWARF8 gene, partial...    53   6e-06   
gb:AF413138_1797429 Zea mays cultivar Q6199 DWARF8 gene, partial...    53   6e-06   
gb:AF413135_1797426 Zea mays cultivar H99 DWARF8 gene, partial cds.    53   6e-06   
gb:AF413129_1797420 Zea mays cultivar WF9 DWARF8 gene, partial c...    53   6e-06   
gb:AF413113_1797404 Zea mays cultivar I29 DWARF8 gene, partial c...    53   6e-06   
gb:AJ870306_1815094 Cucumis sativus mRNA for SCARECROW (scr gene...    53   8e-06   
gb:AC133861_1741586 Oryza sativa chromosome 3 BAC OSJNBb0031F05 ...    53   8e-06   
gb:AC098832_1736897 Oryza sativa (japonica cultivar-group) chrom...    52   1e-05   
gb:AY074547_1567587 Arabidopsis thaliana putative SHORT-ROOT (SH...    52   1e-05   
pir|T04722|T04722 hypothetical protein F19F18.140 - Arabidopsis ...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AF413145_1797436 Zea mays cultivar F2 DWARF8 gene, partial cds.     52   1e-05   
gb:AP003866_1834548 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AF263457_1781688 Zea mays SCARECROW (SCR) gene, complete cds.       52   2e-05   
gb:AC105767_1738174 Oryza sativa (japonica cultivar-group) chrom...    52   2e-05   
gb:AF413128_1797419 Zea mays cultivar KUI43 DWARF8 gene, partial...    51   2e-05   
gb:AY367051_1602916 Zea mays scarecrow-like 23 (scl23) mRNA, par...    51   3e-05   
gb:AB048713_1520745 Pisum sativum PsSCR mRNA for SCARECROW, comp...    51   3e-05   
gb:AB017067_1513401 Arabidopsis thaliana genomic DNA, chromosome...    51   3e-05   
gb:ATCHRIV46_1545525 Arabidopsis thaliana DNA chromosome 4, cont...    50   4e-05   
gb:AB180961_1528999 Oryza sativa (japonica cultivar-group) OsSCR...    50   4e-05   
pir|C71441|C71441 probable SCARECROW - Arabidopsis thaliana>gb:A...    50   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AF413168_1797459 Zea mays cultivar NC250 DWARF8 gene, partial...    50   5e-05   
pir|T51244|T51244 SCARECROW protein [imported] - Arabidopsis tha...    50   7e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T47581|T47581 SCARECROW1 - Arabidopsis thaliana>gb:ATF24B22_...    50   7e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AJ832139_1814394 Pisum sativum sym7 gene for GRAS family prot...    49   1e-04   
pir|T46142|T46142 scarecrow-like 7 (SCL7) - Arabidopsis thaliana...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
pir|T10552|T10552 hypothetical protein T12G13.90 - Arabidopsis t...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AC120987_1740028 Oryza sativa (japonica cultivar-group) chrom...    48   2e-04   
gb:AP003750_1832856 Oryza sativa (japonica cultivar-group) genom...    48   3e-04   
gb:AJ832138_1814393 Medicago truncatula nsp2 gene for GRAS famil...    47   4e-04   
gb:AP003616_1831461 Oryza sativa (japonica cultivar-group) genom...    45   0.002   
sp|Q84MM9|MOC_ORYSA|MOC_ORYSA Protein MONOCULM 1.>gb:AY242058_1592361 Oryz...    45   0.002   Oryza sativa [red rice]
gb:AC093952_1736166 Oryza sativa (japonica cultivar-group) chrom...    42   0.019   
gb:AF067400_1765608 Zea mays Scl1 protein (Scl1) mRNA, partial cds.    41   0.033   
pir|T51242|T51242 Scl1 protein [imported] - maize (fragment)           41   0.033   Zea mays [maize]
pir|T45848|T45848 hypothetical protein F3A4.30 - Arabidopsis tha...    41   0.033   Arabidopsis thaliana [mouse-ear cress]
gb:AF036304_1762940 Arabidopsis thaliana scarecrow-like 7 (SCL7)...    38   0.22    
pir|T51238|T51238 scarecrow-like protein 7 [imported] - Arabidop...    38   0.22    Arabidopsis thaliana [mouse-ear cress]
gb:BC068322_2555010 Danio rerio frizzled homolog 7a, mRNA (cDNA ...    34   3.1     
gb:AF336123_2488138 Danio rerio frizzled 7b mRNA, complete cds.        34   4.1     
pir|T33997|T33997 hypothetical protein W03G1.5 - Caenorhabditis ...    22   4.1     Caenorhabditis elegans [roundworm]
gb:AY347800_1177961 Malus x domestica clone 19-4 unknown mRNA.         33   6.9     
pir|AD2556|AD2556 hypothetical protein all8043 [imported] - Nost...    33   6.9     Nostoc sp. PCC 7120
gb:BC049397_2550210 Danio rerio frizzled homolog 7b, mRNA (cDNA ...    33   9.0     
gb:AF336124_2488139 Danio rerio frizzled 7a mRNA, complete cds.>...    33   9.0     
gb:AC113332_1738914 Oryza sativa (japonica cultivar-group) chrom...    33   9.0     
gb:CR522870_101095 Desulfotalea psychrophila LSv54 chromosome.         33   9.0     


>gb:AP003240_1826030 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0406G08.
          Length = 820

 Score =  202 bits (513), Expect(2) = 3e-52
 Identities = 86/138 (62%), Positives = 118/138 (85%)
 Frame = -3

Query: 798  HTFLYRGIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAK 619
            H F++ G+VNG+YN+PFF+TRFREALFH+S++FDML+TN+P++  +R+LIE  +F +EA 
Sbjct: 677  HVFIH-GVVNGSYNAPFFVTRFREALFHYSAIFDMLETNIPKDNEQRLLIESALFSREAI 735

Query: 618  NVIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGE 439
            NVI+CE  ER+ERPETYKQW VRN R GF  LPLN+++MK +R++ + Y+KDF+IDED  
Sbjct: 736  NVISCEGLERMERPETYKQWQVRNQRVGFKQLPLNQDMMKRAREKVRCYHKDFIIDEDNR 795

Query: 438  WLLQGWKGRIVYALSSWR 385
            WLLQGWKGRI++ALS+W+
Sbjct: 796  WLLQGWKGRILFALSTWK 813



 Score = 26.6 bits (57), Expect(2) = 3e-52
 Identities = 10/14 (71%), Positives = 12/14 (85%)
 Frame = -2

Query: 820 KLIRELNPHVFIQG 779
           K IR++NPHVFI G
Sbjct: 669 KTIRKMNPHVFIHG 682



>gb:AC097277_1736509 Oryza sativa chromosome 3 BAC OSJNBa0022C08
           genomic sequence, complete sequence.
          Length = 731

 Score =  202 bits (513), Expect = 9e-51
 Identities = 92/133 (69%), Positives = 117/133 (87%), Gaps = 1/133 (0%)
 Frame = -3

Query: 780 GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
           GIVNG+Y+ PFFITRFREALFHFS+LFDML+T VPR+  +R LIE+ +FG+EA NVIACE
Sbjct: 595 GIVNGSYSVPFFITRFREALFHFSALFDMLETTVPRDDAQRALIERDLFGREALNVIACE 654

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQG 424
            ++RVERPETYKQW VRN+RAGF+  PLN++I+  ++D+ K +Y+KDFVIDED EWLLQG
Sbjct: 655 GSDRVERPETYKQWQVRNLRAGFVQSPLNQDIVLKAKDKVKDIYHKDFVIDEDSEWLLQG 714

Query: 423 WKGRIVYALSSWR 385
           WKGRI+YA+S+W+
Sbjct: 715 WKGRIIYAISTWK 727



>gb:AB106274_1526672 Lilium longiflorum LlSCL mRNA for SCARECROW-like
            protein, complete cds.
          Length = 748

 Score =  201 bits (511), Expect = 1e-50
 Identities = 91/132 (68%), Positives = 113/132 (85%), Gaps = 1/132 (0%)
 Frame = -3

Query: 780  GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
            G+VNG+YN+PFF+TRFREALFHFS+LFDML+ N PR   +R+LIE+ IFG++A NVIACE
Sbjct: 612  GVVNGSYNAPFFVTRFREALFHFSALFDMLEMNTPRKDEQRLLIEQNIFGRDAMNVIACE 671

Query: 600  TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQG 424
              ERVERPETYKQW VRN RAGF  LPL+++I+K S+ + K +Y+KDFV+DEDG WLL G
Sbjct: 672  GTERVERPETYKQWQVRNFRAGFTQLPLDRDIVKKSKCKVKELYHKDFVVDEDGRWLLLG 731

Query: 423  WKGRIVYALSSW 388
            WKGRI+YALS+W
Sbjct: 732  WKGRIIYALSAW 743



>pir|T02531|T02531 probable SCARECROW gene regulator At2g37650
           [imported] - Arabidopsis thaliana>gb:AC004684_1532076
           Arabidopsis thaliana chromosome 2 clone F13M22 map
           ve018, complete sequence.
          Length = 718

 Score =  188 bits (477), Expect = 1e-46
 Identities = 90/136 (66%), Positives = 106/136 (77%), Gaps = 1/136 (0%)
 Frame = -3

Query: 780 GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
           GIVNGAYN+PFF+TRFREALFHFSS+FDML+T VPR   ER+ +E  +FG+EA NVIACE
Sbjct: 581 GIVNGAYNAPFFVTRFREALFHFSSIFDMLETIVPREDEERMFLEMEVFGREALNVIACE 640

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV-YNKDFVIDEDGEWLLQG 424
             ERVERPETYKQWHVR MR+G + +P +  IMK S  +    Y+KDFVID+D  WLLQG
Sbjct: 641 GWERVERPETYKQWHVRAMRSGLVQVPFDPSIMKTSLHKVHTFYHKDFVIDQDNRWLLQG 700

Query: 423 WKGRIVYALSSWRSAS 376
           WKGR V ALS W+  S
Sbjct: 701 WKGRTVMALSVWKPES 716



>gb:OSJN00182_1696318 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0086O06, complete sequence.
          Length = 636

 Score =  187 bits (476), Expect = 2e-46
 Identities = 84/132 (63%), Positives = 110/132 (83%), Gaps = 1/132 (0%)
 Frame = -3

Query: 780 GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
           G+VNG YN+PFF+TRF+EALF++SSLFDML+T   R    R+LIE+ +FG+EA NV+ACE
Sbjct: 502 GVVNGTYNAPFFVTRFKEALFYYSSLFDMLETTASRVDENRLLIERDLFGREALNVVACE 561

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRA-KVYNKDFVIDEDGEWLLQG 424
             ERVERPETYKQW VRN+RAGF  LPLN+E +K +R +  K Y++DF++DED +W+LQG
Sbjct: 562 GTERVERPETYKQWQVRNIRAGFKQLPLNQETVKKARYKVKKSYHRDFLVDEDNKWMLQG 621

Query: 423 WKGRIVYALSSW 388
           WKGRI++ALS+W
Sbjct: 622 WKGRIIFALSAW 633



>gb:AC079356_1732523 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0016H04, complete sequence.
          Length = 1363

 Score =  186 bits (473), Expect = 4e-46
 Identities = 84/132 (63%), Positives = 105/132 (79%)
 Frame = -3

Query: 780  GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
            G+VNG Y+SPFF+TRFRE LFH+SSLFDMLD NVPRN   RIL+EK +FG +A N +ACE
Sbjct: 1229 GVVNGLYSSPFFLTRFREVLFHYSSLFDMLDNNVPRNHEARILVEKDLFGNDALNAVACE 1288

Query: 600  TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGW 421
             AER+ERPE+YKQW +R +RAGF   P+N+ I+  S    + Y++DFVIDED  WLLQGW
Sbjct: 1289 GAERIERPESYKQWQMRILRAGFKQRPVNQAILNRSVHYKEFYHEDFVIDEDSGWLLQGW 1348

Query: 420  KGRIVYALSSWR 385
            KGRI+ ALS+W+
Sbjct: 1349 KGRIIQALSTWK 1360



 Score =  181 bits (458), Expect(2) = 2e-44
 Identities = 84/136 (61%), Positives = 108/136 (79%), Gaps = 4/136 (2%)
 Frame = -3

Query: 780 GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
           GIVNG+Y+SPFFITRF+E LFH+SSLFDM+D NVPR+   R +IE  +FGQEA N+IACE
Sbjct: 596 GIVNGSYSSPFFITRFKEVLFHYSSLFDMIDANVPRDNEARKMIEGGLFGQEALNIIACE 655

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLN----KEIMKMSRDRAKVYNKDFVIDEDGEWL 433
            AER ERPE+YKQW  R ++AGF  LP++    KEI+ M +    +Y++DFV DEDG WL
Sbjct: 656 GAERTERPESYKQWQARCLKAGFKQLPVDPATLKEIINMKKG---IYHEDFVADEDGAWL 712

Query: 432 LQGWKGRIVYALSSWR 385
           LQGWKGR++YA+S+W+
Sbjct: 713 LQGWKGRVIYAISTWK 728



 Score = 21.6 bits (44), Expect(2) = 2e-44
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -2

Query: 820 KLIRELNPHVFIQG 779
           K++R +NP VFI G
Sbjct: 583 KIMRMMNPRVFILG 596



>gb:AC079022_1541719 Oryza sativa chromosome 5 clone P0574H01,
           complete sequence.
          Length = 629

 Score =  186 bits (473), Expect = 4e-46
 Identities = 84/132 (63%), Positives = 105/132 (79%)
 Frame = -3

Query: 780 GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
           G+VNG Y+SPFF+TRFRE LFH+SSLFDMLD NVPRN   RIL+EK +FG +A N +ACE
Sbjct: 495 GVVNGLYSSPFFLTRFREVLFHYSSLFDMLDNNVPRNHEARILVEKDLFGNDALNAVACE 554

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGW 421
            AER+ERPE+YKQW +R +RAGF   P+N+ I+  S    + Y++DFVIDED  WLLQGW
Sbjct: 555 GAERIERPESYKQWQMRILRAGFKQRPVNQAILNRSVHYKEFYHEDFVIDEDSGWLLQGW 614

Query: 420 KGRIVYALSSWR 385
           KGRI+ ALS+W+
Sbjct: 615 KGRIIQALSTWK 626



>gb:AC079022_1541720 Oryza sativa chromosome 5 clone P0574H01,
           complete sequence.
          Length = 736

 Score =  181 bits (458), Expect(2) = 2e-44
 Identities = 84/136 (61%), Positives = 108/136 (79%), Gaps = 4/136 (2%)
 Frame = -3

Query: 780 GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
           GIVNG+Y+SPFFITRF+E LFH+SSLFDM+D NVPR+   R +IE  +FGQEA N+IACE
Sbjct: 596 GIVNGSYSSPFFITRFKEVLFHYSSLFDMIDANVPRDNEARKMIEGGLFGQEALNIIACE 655

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLN----KEIMKMSRDRAKVYNKDFVIDEDGEWL 433
            AER ERPE+YKQW  R ++AGF  LP++    KEI+ M +    +Y++DFV DEDG WL
Sbjct: 656 GAERTERPESYKQWQARCLKAGFKQLPVDPATLKEIINMKKG---IYHEDFVADEDGAWL 712

Query: 432 LQGWKGRIVYALSSWR 385
           LQGWKGR++YA+S+W+
Sbjct: 713 LQGWKGRVIYAISTWK 728



 Score = 21.6 bits (44), Expect(2) = 2e-44
 Identities = 8/14 (57%), Positives = 11/14 (78%)
 Frame = -2

Query: 820 KLIRELNPHVFIQG 779
           K++R +NP VFI G
Sbjct: 583 KIMRMMNPRVFILG 596



>gb:AF036306_1762942 Arabidopsis thaliana scarecrow-like 9 (SCL9)
           mRNA, partial cds.
          Length = 133

 Score =  178 bits (451), Expect = 1e-43
 Identities = 85/131 (64%), Positives = 101/131 (77%), Gaps = 1/131 (0%)
 Frame = -3

Query: 765 AYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERV 586
           AYN+PFF+TRFREALFHFSS+FDML+T VPR   ER+ +E  +FG+EA NVIACE  ERV
Sbjct: 1   AYNAPFFVTRFREALFHFSSIFDMLETIVPREDEERMFLEMEVFGREALNVIACEGWERV 60

Query: 585 ERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV-YNKDFVIDEDGEWLLQGWKGRI 409
           ERPETYKQWHVR MR+G + +P +  IMK S  +    Y+KDFVID+D  WLLQGWKGR 
Sbjct: 61  ERPETYKQWHVRAMRSGLVQVPFDPSIMKTSLHKVHTFYHKDFVIDQDNRWLLQGWKGRT 120

Query: 408 VYALSSWRSAS 376
           V ALS W+  S
Sbjct: 121 VMALSVWKPES 131



>pir|T51240|T51240 scarecrow-like protein 9 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 133

 Score =  178 bits (451), Expect = 1e-43
 Identities = 85/131 (64%), Positives = 101/131 (77%), Gaps = 1/131 (0%)
 Frame = -3

Query: 765 AYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERV 586
           AYN+PFF+TRFREALFHFSS+FDML+T VPR   ER+ +E  +FG+EA NVIACE  ERV
Sbjct: 1   AYNAPFFVTRFREALFHFSSIFDMLETIVPREDEERMFLEMEVFGREALNVIACEGWERV 60

Query: 585 ERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV-YNKDFVIDEDGEWLLQGWKGRI 409
           ERPETYKQWHVR MR+G + +P +  IMK S  +    Y+KDFVID+D  WLLQGWKGR 
Sbjct: 61  ERPETYKQWHVRAMRSGLVQVPFDPSIMKTSLHKVHTFYHKDFVIDQDNRWLLQGWKGRT 120

Query: 408 VYALSSWRSAS 376
           V ALS W+  S
Sbjct: 121 VMALSVWKPES 131



>pir|T02736|T02736 probable SCARECROW gene regulator [imported] -
            Arabidopsis thaliana>gb:AC005315_1532598 Arabidopsis
            thaliana chromosome 2 clone T9I4 map mi54, complete
            sequence.
          Length = 1336

 Score =  167 bits (422), Expect(2) = 2e-40
 Identities = 75/132 (56%), Positives = 104/132 (78%), Gaps = 2/132 (1%)
 Frame = -3

Query: 777  IVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACET 598
            IVNG++N+PFFI+RF+EA++H+S+LFDM D+ +PR+  ERI  E+  +G+EA NVIACE 
Sbjct: 1202 IVNGSFNAPFFISRFKEAVYHYSALFDMFDSTLPRDNKERIRFEREFYGREAMNVIACEE 1261

Query: 597  AERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV--YNKDFVIDEDGEWLLQG 424
            A+RVERPETY+QW VR +RAGF    +  E++++ R + K   Y+KDFV+DE+ +WLLQG
Sbjct: 1262 ADRVERPETYRQWQVRMVRAGFKQKTIKPELVELFRGKLKKWRYHKDFVVDENSKWLLQG 1321

Query: 423  WKGRIVYALSSW 388
            WKGR +YA S W
Sbjct: 1322 WKGRTLYASSCW 1333



 Score =  161 bits (408), Expect(2) = 7e-39
 Identities = 75/133 (56%), Positives = 97/133 (72%), Gaps = 2/133 (1%)
 Frame = -3

Query: 780 GIVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE 601
           GI++G+YN+PFF+TRFRE LFH+SSLFDM DTN+ R    R++ EK  +G+E  NV+ACE
Sbjct: 559 GILSGSYNAPFFVTRFREVLFHYSSLFDMCDTNLTREDPMRVMFEKEFYGREIMNVVACE 618

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSR--DRAKVYNKDFVIDEDGEWLLQ 427
             ERVERPE+YKQW  R MRAGF  +PL KE+++  +    +    K+F +D+D  WLLQ
Sbjct: 619 GTERVERPESYKQWQARAMRAGFRQIPLEKELVQKLKLMVESGYKPKEFDVDQDCHWLLQ 678

Query: 426 GWKGRIVYALSSW 388
           GWKGRIVY  S W
Sbjct: 679 GWKGRIVYGSSIW 691



 Score = 22.3 bits (46), Expect(2) = 2e-40
 Identities = 9/12 (75%), Positives = 10/12 (83%)
 Frame = -2

Query: 820  KLIRELNPHVFI 785
            KLIR +NP VFI
Sbjct: 1188 KLIRNMNPDVFI 1199



 Score = 22.3 bits (46), Expect(2) = 7e-39
 Identities = 9/14 (64%), Positives = 11/14 (78%)
 Frame = -2

Query: 820 KLIRELNPHVFIQG 779
           KLIR++ P VFI G
Sbjct: 546 KLIRKIKPDVFIPG 559



>gb:AF036307_1762943 Arabidopsis thaliana scarecrow-like 11 (SCL11)
           mRNA, partial cds.
          Length = 205

 Score =  163 bits (412), Expect = 4e-39
 Identities = 77/138 (55%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = -3

Query: 774 VNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRN--IHERILIEKTIFGQEAKNVIACE 601
           +NG YNSPFF+TRFREALFH+SSLFDM DT +        R L+E+ +  ++A +VI+CE
Sbjct: 61  INGMYNSPFFMTRFREALFHYSSLFDMFDTTIHAEDEYKNRSLLERELLVRDAMSVISCE 120

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRA-KVYNKDFVIDEDGEWLLQG 424
            AER  RPETYKQW VR +RAGF P  ++K+IMK +++   K Y++DFVID D  W+LQG
Sbjct: 121 GAERFARPETYKQWRVRILRAGFKPATISKQIMKEAKEIVRKRYHRDFVIDSDNNWMLQG 180

Query: 423 WKGRIVYALSSWRSAS*F 370
           WKGR++YA S W+ A  F
Sbjct: 181 WKGRVIYAFSCWKPAEKF 198



>gb:AB025604_1516260 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F2O15.>gb:AY035001_1559780 Arabidopsis
           thaliana putative scarecrow 11 protein (At5g59450) mRNA,
           complete cds.>gb:AY062942_1565534 Arabidopsis thaliana
           putative scarecrow 11 protein (At5g59450) mRNA, complete
           cds.
          Length = 610

 Score =  163 bits (412), Expect = 4e-39
 Identities = 77/138 (55%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = -3

Query: 774 VNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRN--IHERILIEKTIFGQEAKNVIACE 601
           +NG YNSPFF+TRFREALFH+SSLFDM DT +        R L+E+ +  ++A +VI+CE
Sbjct: 466 INGMYNSPFFMTRFREALFHYSSLFDMFDTTIHAEDEYKNRSLLERELLVRDAMSVISCE 525

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRA-KVYNKDFVIDEDGEWLLQG 424
            AER  RPETYKQW VR +RAGF P  ++K+IMK +++   K Y++DFVID D  W+LQG
Sbjct: 526 GAERFARPETYKQWRVRILRAGFKPATISKQIMKEAKEIVRKRYHRDFVIDSDNNWMLQG 585

Query: 423 WKGRIVYALSSWRSAS*F 370
           WKGR++YA S W+ A  F
Sbjct: 586 WKGRVIYAFSCWKPAEKF 603



>pir|T51233|T51233 scarecrow-like protein 11 [imported] -
           Arabidopsis thaliana  (fragment)
          Length = 205

 Score =  163 bits (412), Expect = 4e-39
 Identities = 77/138 (55%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = -3

Query: 774 VNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRN--IHERILIEKTIFGQEAKNVIACE 601
           +NG YNSPFF+TRFREALFH+SSLFDM DT +        R L+E+ +  ++A +VI+CE
Sbjct: 61  INGMYNSPFFMTRFREALFHYSSLFDMFDTTIHAEDEYKNRSLLERELLVRDAMSVISCE 120

Query: 600 TAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRA-KVYNKDFVIDEDGEWLLQG 424
            AER  RPETYKQW VR +RAGF P  ++K+IMK +++   K Y++DFVID D  W+LQG
Sbjct: 121 GAERFARPETYKQWRVRILRAGFKPATISKQIMKEAKEIVRKRYHRDFVIDSDNNWMLQG 180

Query: 423 WKGRIVYALSSWRSAS*F 370
           WKGR++YA S W+ A  F
Sbjct: 181 WKGRVIYAFSCWKPAEKF 198



>gb:AY087418_1572449 Arabidopsis thaliana clone 35201 mRNA, complete
           sequence.
          Length = 583

 Score =  161 bits (408), Expect = 1e-38
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 1/133 (0%)
 Frame = -3

Query: 774 VNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETA 595
           +NG YNSPFF+TRFREALFH SSLFDM +T +  + + R L+E+ +  ++A +VIACE +
Sbjct: 449 INGTYNSPFFLTRFREALFHCSSLFDMYETTLSEDDNCRTLVERELIIRDAMSVIACEGS 508

Query: 594 ERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV-YNKDFVIDEDGEWLLQGWK 418
           ER  RPETYKQW VR +RAGF P  L+K+I+K  ++  K  Y+KDFVID D  W+ QGWK
Sbjct: 509 ERFARPETYKQWQVRILRAGFRPAKLSKQIVKDGKEIVKERYHKDFVIDNDNHWMFQGWK 568

Query: 417 GRIVYALSSWRSA 379
           GR++YA+S W+ A
Sbjct: 569 GRVLYAVSCWKPA 581



>pir|T45597|T45597 scarecrow-like protein - Arabidopsis
           thaliana>gb:ATF12A12_1548301 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F12A12.
          Length = 583

 Score =  161 bits (408), Expect = 1e-38
 Identities = 75/133 (56%), Positives = 100/133 (75%), Gaps = 1/133 (0%)
 Frame = -3

Query: 774 VNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETA 595
           +NG YNSPFF+TRFREALFH SSLFDM +T +  + + R L+E+ +  ++A +VIACE +
Sbjct: 449 INGTYNSPFFLTRFREALFHCSSLFDMYETTLSEDDNCRTLVERELIIRDAMSVIACEGS 508

Query: 594 ERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV-YNKDFVIDEDGEWLLQGWK 418
           ER  RPETYKQW VR +RAGF P  L+K+I+K  ++  K  Y+KDFVID D  W+ QGWK
Sbjct: 509 ERFARPETYKQWQVRILRAGFRPAKLSKQIVKDGKEIVKERYHKDFVIDNDNHWMFQGWK 568

Query: 417 GRIVYALSSWRSA 379
           GR++YA+S W+ A
Sbjct: 569 GRVLYAVSCWKPA 581



>gb:AE005172_889759 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC022464_1539000 Genomic sequence
            for Arabidopsis thaliana BAC F22G5 from chromosome I,
            complete sequence.
          Length = 1502

 Score =  156 bits (395), Expect(2) = 4e-38
 Identities = 71/131 (54%), Positives = 96/131 (73%), Gaps = 2/131 (1%)
 Frame = -3

Query: 774  VNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETA 595
            VNG++N+PFF TRF+EALFH+S+LFD+    + +   ERI  E   +G+E  NVIACE  
Sbjct: 1369 VNGSFNAPFFTTRFKEALFHYSALFDLFGATLSKENPERIHFEGEFYGREVMNVIACEGV 1428

Query: 594  ERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV--YNKDFVIDEDGEWLLQGW 421
            +RVERPETYKQW VR +RAGF   P+  E++++ R++ K   Y+KDFV+DED  W LQGW
Sbjct: 1429 DRVERPETYKQWQVRMIRAGFKQKPVEAELVQLFREKMKKWGYHKDFVLDEDSNWFLQGW 1488

Query: 420  KGRIVYALSSW 388
            KGRI+++ S W
Sbjct: 1489 KGRILFSSSCW 1499



 Score =  154 bits (388), Expect = 3e-36
 Identities = 71/125 (56%), Positives = 96/125 (76%), Gaps = 1/125 (0%)
 Frame = -3

Query: 777  IVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACET 598
            I++G YN+PFF+TRFREALFH+S++FDM D+ + R    R++ EK  +G+E  NV+ACE 
Sbjct: 634  ILSGNYNAPFFVTRFREALFHYSAVFDMCDSKLAREDEMRLMYEKEFYGREIVNVVACEG 693

Query: 597  AERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQGW 421
             ERVERPETYKQW  R +RAGF  LPL KE+M+  + + +  Y+K+F +D++G WLLQGW
Sbjct: 694  TERVERPETYKQWQARLIRAGFRQLPLEKELMQNLKLKIENGYDKNFDVDQNGNWLLQGW 753

Query: 420  KGRIV 406
            KGRIV
Sbjct: 754  KGRIV 758



 Score = 24.6 bits (52), Expect(2) = 4e-38
 Identities = 9/14 (64%), Positives = 13/14 (92%)
 Frame = -2

Query: 826  FWKLIRELNPHVFI 785
            F KLIR++NP+VF+
Sbjct: 1352 FLKLIRDMNPNVFL 1365



>gb:AF036309_1762945 Arabidopsis thaliana scarecrow-like 14 (SCL14)
            mRNA, partial cds.
          Length = 808

 Score =  147 bits (371), Expect = 3e-34
 Identities = 71/135 (52%), Positives = 97/135 (71%), Gaps = 1/135 (0%)
 Frame = -3

Query: 777  IVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACET 598
            I++G YN+PFF+TRFREALFH+S++FDM D+ + R    R++     +G+E  NV+A E 
Sbjct: 673  ILSGNYNAPFFVTRFREALFHYSAVFDMCDSKLAREDEMRLMYVFEFYGREIVNVVASEG 732

Query: 597  AERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQGW 421
             ERVE  ETYKQW  R +RAGF  LPL KE+M+  + + +  Y+K+F +D++G WLLQGW
Sbjct: 733  TERVESRETYKQWQARLIRAGFRQLPLEKELMQNLKLKIENGYDKNFDVDQNGNWLLQGW 792

Query: 420  KGRIVYALSSWRSAS 376
            KGRIVYA S W  +S
Sbjct: 793  KGRIVYASSLWVPSS 807



>pir|T51232|T51232 scarecrow-like protein 14 [imported] - Arabidopsis
            thaliana  (fragment)
          Length = 808

 Score =  147 bits (371), Expect = 3e-34
 Identities = 71/135 (52%), Positives = 97/135 (71%), Gaps = 1/135 (0%)
 Frame = -3

Query: 777  IVNGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACET 598
            I++G YN+PFF+TRFREALFH+S++FDM D+ + R    R++     +G+E  NV+A E 
Sbjct: 673  ILSGNYNAPFFVTRFREALFHYSAVFDMCDSKLAREDEMRLMYVFEFYGREIVNVVASEG 732

Query: 597  AERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQGW 421
             ERVE  ETYKQW  R +RAGF  LPL KE+M+  + + +  Y+K+F +D++G WLLQGW
Sbjct: 733  TERVESRETYKQWQARLIRAGFRQLPLEKELMQNLKLKIENGYDKNFDVDQNGNWLLQGW 792

Query: 420  KGRIVYALSSWRSAS 376
            KGRIVYA S W  +S
Sbjct: 793  KGRIVYASSLWVPSS 807



>gb:AP003791_1833397 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1065G12.>gb:AP006757_1862933 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0551C06.
          Length = 532

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 49/129 (37%), Positives = 69/129 (53%)
 Frame = -3

Query: 771 NGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAE 592
           +  +N PFF+ RF EAL ++++LFD LD  +PR    R  +E+  FG E +NV+ CE A 
Sbjct: 403 DAGHNGPFFLGRFMEALHYYAALFDALDAALPRYDARRARVEQFHFGAEIRNVVGCEGAA 462

Query: 591 RVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGR 412
           RVER E   QW  R  RAGF  +P+                  + + E+   L+ GWKG+
Sbjct: 463 RVERHERADQWRRRMSRAGFQSVPIKMAAKAREWLDENAGGGGYTVAEEKGCLVLGWKGK 522

Query: 411 IVYALSSWR 385
            V A S W+
Sbjct: 523 PVIAASCWK 531



>gb:AP003791_1833400 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1065G12.
          Length = 297

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 48/129 (37%), Positives = 70/129 (54%)
 Frame = -3

Query: 771 NGAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAE 592
           +  +N+PFF+ RF EAL ++++LFD LD  +PR    R  +E+  FG E +NV+ CE A 
Sbjct: 168 DAGHNAPFFLGRFMEALHYYAALFDALDAALPRYDARRARVEQFHFGAEIRNVVGCEGAA 227

Query: 591 RVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGR 412
           RVER E   QW  R  RAGF  +P+                  + + ++   L+ GWKG+
Sbjct: 228 RVERHERADQWRRRMSRAGFQSVPIKMAAKAREWLDENAGGDGYTVADEKVCLVLGWKGK 287

Query: 411 IVYALSSWR 385
            V A S W+
Sbjct: 288 PVIAASCWK 296



>gb:AC109602_1738782 Oryza sativa chromosome 3 BAC OSJNBa0087M10
           genomic sequence, complete sequence.
          Length = 663

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 39/71 (54%), Positives = 58/71 (81%), Gaps = 1/71 (1%)
 Frame = -3

Query: 594 ERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRA-KVYNKDFVIDEDGEWLLQGWK 418
           ER+ERPE+YK+W VRN++AG + LPLN  I++ ++D   K Y+KDF++DE+ +WL+ GWK
Sbjct: 366 ERIERPESYKKWKVRNLKAGLVQLPLNPAIVRETQDMVRKGYHKDFLVDEEDQWLVLGWK 425

Query: 417 GRIVYALSSWR 385
           GRI+YA S+W+
Sbjct: 426 GRILYASSTWQ 436



>gb:AP004235_1839095 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0006G05.
          Length = 571

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 43/124 (34%), Positives = 72/124 (58%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E + ++S++F+ +D N+PR+  ERI +E+    ++  N+IACE  +RVER
Sbjct: 447 NTTPFLMRFGETMEYYSAMFESIDANLPRDNKERISVEQHCLAKDIVNIIACEGKDRVER 506

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +  + R     Y+  + +DE    +L GW+ R + +
Sbjct: 507 HELLGKWKSRLTMAGFRPYPLSSYVNSVIRKLLACYSDKYTLDEKDGAMLLGWRSRKLIS 566

Query: 399 LSSW 388
            S+W
Sbjct: 567 ASAW 570



>gb:AK176099_1818087 Arabidopsis thaliana mRNA for putative
           SCARECROW gene regulator, partial cds, clone:
           RAFL22-88-J06.
          Length = 220

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 46/125 (36%), Positives = 71/125 (56%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E L +++++F+ +D  +PRN  ERI IE+    ++  N+IACE AER+ER
Sbjct: 96  NTSPFLPRFLETLSYYTAMFESIDVMLPRNHKERINIEQHCMARDVVNIIACEGAERIER 155

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  I    R   + Y+  + I+E    L  GW  RI+ +
Sbjct: 156 HELLGKWKSRFSMAGFEPYPLSSIISATIRALLRDYSNGYAIEERDGALYLGWMDRILVS 215

Query: 399 LSSWR 385
             +W+
Sbjct: 216 SCAWK 220



>pir|G84462|G84462 probable SCARECROW gene regulator [imported] -
           Arabidopsis thaliana>gb:AC006955_1534915 Arabidopsis
           thaliana chromosome 2 clone F28I8 map RNS1, complete
           sequence.>gb:AC007211_1535568 Arabidopsis thaliana
           chromosome 2 BAC F1O13 genomic sequence, complete
           sequence.>gb:AF210732_1777378 Arabidopsis thaliana
           scarecrow-like 21 (SCL21) mRNA, complete
           cds.>gb:AK175210_1817198 Arabidopsis thaliana mRNA for
           putative SCARECROW gene regulator, complete cds, clone:
           RAFL21-63-H23.
          Length = 413

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 46/125 (36%), Positives = 71/125 (56%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E L +++++F+ +D  +PRN  ERI IE+    ++  N+IACE AER+ER
Sbjct: 289 NTSPFLPRFLETLSYYTAMFESIDVMLPRNHKERINIEQHCMARDVVNIIACEGAERIER 348

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  I    R   + Y+  + I+E    L  GW  RI+ +
Sbjct: 349 HELLGKWKSRFSMAGFEPYPLSSIISATIRALLRDYSNGYAIEERDGALYLGWMDRILVS 408

Query: 399 LSSWR 385
             +W+
Sbjct: 409 SCAWK 413



>gb:AK175990_1817978 Arabidopsis thaliana mRNA for putative
           SCARECROW gene regulator, complete cds, clone:
           RAFL22-68-E12.
          Length = 413

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/125 (36%), Positives = 71/125 (56%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E L +++++F+ +D  +PRN  ERI IE+    ++  N++ACE AER+ER
Sbjct: 289 NTSPFLPRFLETLSYYTAMFESIDVMLPRNHKERINIEQHCMARDVVNIMACEGAERIER 348

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  I    R   + Y+  + I+E    L  GW  RI+ +
Sbjct: 349 HELLGKWKSRFSMAGFEPYPLSSIISATIRALLRDYSNGYAIEERDGALYLGWMDRILVS 408

Query: 399 LSSWR 385
             +W+
Sbjct: 409 SCAWK 413



>gb:AF036301_1762937 Arabidopsis thaliana scarecrow-like 3 (SCL3)
           mRNA, partial cds.
          Length = 325

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 1/127 (0%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N    + R  E+L+ +++LFD L+T VPR   +RI +EK +FG+E KN+I+CE  ER E
Sbjct: 196 HNGSTLMERLLESLYTYAALFDCLETKVPRTSQDRIKVEKMLFGEEIKNIISCEGFERRE 255

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIV 406
           R E  ++W  R   AGF  +PL+   M  +R   +    D + I E+    +  W+ R +
Sbjct: 256 RHEKLEKWSQRIDLAGFGNVPLSYYAMLQARRLLQGCGFDGYRIKEESGCAVICWQDRPL 315

Query: 405 YALSSWR 385
           Y++S+WR
Sbjct: 316 YSVSAWR 322



>pir|E96540|E96540 hypothetical protein F11F12.22 [imported] -
           Arabidopsis thaliana>gb:AE005173_892961 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012561_1537709 Arabidopsis thaliana
           chromosome I BAC F11F12 genomic sequence, complete
           sequence.>gb:AY056154_1563484 Arabidopsis thaliana
           putative scarecrow 3 protein (At1g50420) mRNA, complete
           cds.>gb:AY091260_1574468 Arabidopsis thaliana putative
           scarecrow 3 protein (At1g50420) mRNA, complete cds.
          Length = 482

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 1/127 (0%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N    + R  E+L+ +++LFD L+T VPR   +RI +EK +FG+E KN+I+CE  ER E
Sbjct: 353 HNGSTLMERLLESLYTYAALFDCLETKVPRTSQDRIKVEKMLFGEEIKNIISCEGFERRE 412

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIV 406
           R E  ++W  R   AGF  +PL+   M  +R   +    D + I E+    +  W+ R +
Sbjct: 413 RHEKLEKWSQRIDLAGFGNVPLSYYAMLQARRLLQGCGFDGYRIKEESGCAVICWQDRPL 472

Query: 405 YALSSWR 385
           Y++S+WR
Sbjct: 473 YSVSAWR 479



>pir|T51235|T51235 scarecrow-like protein 3 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 325

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 47/127 (37%), Positives = 75/127 (59%), Gaps = 1/127 (0%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N    + R  E+L+ +++LFD L+T VPR   +RI +EK +FG+E KN+I+CE  ER E
Sbjct: 196 HNGSTLMERLLESLYTYAALFDCLETKVPRTSQDRIKVEKMLFGEEIKNIISCEGFERRE 255

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIV 406
           R E  ++W  R   AGF  +PL+   M  +R   +    D + I E+    +  W+ R +
Sbjct: 256 RHEKLEKWSQRIDLAGFGNVPLSYYAMLQARRLLQGCGFDGYRIKEESGCAVICWQDRPL 315

Query: 405 YALSSWR 385
           Y++S+WR
Sbjct: 316 YSVSAWR 322



>gb:AP003227_1825676 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0018C10.>gb:AP003561_1830777 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1065E10.
          Length = 553

 Score = 85.9 bits (211), Expect = 9e-16
 Identities = 43/125 (34%), Positives = 67/125 (53%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F TRFRE   ++++LFD LD  +PR   +R+ +E+    +E  N++ACE  +RVER
Sbjct: 429 NTAPFQTRFREVYDYYAALFDSLDATLPRESPDRMNVERQCLAREIVNILACEGPDRVER 488

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P P +  ++   R   K Y   +  +ED   L  GW  + +  
Sbjct: 489 YEVAGKWRARMTMAGFTPCPFSSNVISGIRSLLKSYCDRYKFEEDHGGLHFGWGEKTLIV 548

Query: 399 LSSWR 385
            S+W+
Sbjct: 549 SSAWQ 553



>gb:AE016959_1022186 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC113335_1738958
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OJ1003C07,
           from chromosome 10, complete
           sequence.>gb:AE017084_1752005 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 38 of 77 of the
           complete sequence.
          Length = 524

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 42/122 (34%), Positives = 68/122 (55%)
 Frame = -3

Query: 753 PFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPE 574
           PFF  R+ E L +++++F+ +D  +PR+   R+  E+    ++  N+IACE AERVER E
Sbjct: 403 PFF-PRYLETLDYYTAMFESIDVALPRDDKRRMSAEQHCVARDIVNLIACEGAERVERHE 461

Query: 573 TYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYALS 394
            + +W  R   AGF P PL+  +    +     YN  + ++E    L  GWK R++   S
Sbjct: 462 VFGKWKARLTMAGFRPYPLSSVVNSTIKTLLHTYNSFYRLEERDGVLYLGWKNRVLVVSS 521

Query: 393 SW 388
           +W
Sbjct: 522 AW 523



>gb:AY062210_1565005 Oryza sativa chitin-inducible
           gibberellin-responsive protein (GIGR2) mRNA, complete
           cds.>gb:AP003747_1832797 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1127_E01.
          Length = 544

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 43/124 (34%), Positives = 68/124 (54%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F  RF E L +++++F+ +D  +PR+  ERI +E+    +E  N+IACE  ER ER
Sbjct: 420 NTAPFPQRFAETLDYYTAIFESIDLTLPRDDRERINMEQHCLAREIVNLIACEGEERAER 479

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E + +W  R   AGF P PL+  +    R   + Y+ ++ + E    L  GWK R +  
Sbjct: 480 YEPFGKWKARLTMAGFRPSPLSSLVNATIRTLLQSYSDNYKLAERDGALYLGWKSRPLVV 539

Query: 399 LSSW 388
            S+W
Sbjct: 540 SSAW 543



>gb:AF378125_1793344 Vitis vinifera GAI-like protein 1 (GAI1) gene,
           complete cds.
          Length = 590

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 50/140 (35%), Positives = 76/140 (54%), Gaps = 4/140 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTN--VPRNIHERILIEKTIFGQEAKNVIACETAER 589
           +N P F+ RF E+L ++S+LFD L+     P N  ++++ E    GQ+  NV+ACE  ER
Sbjct: 447 HNGPVFLDRFTESLHYYSTLFDSLEGCGVSPVNTQDKLMSE-VYLGQQICNVVACEGPER 505

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKG 415
           VER ET  QW  R   AGF P+ L     K +     ++     + ++E+   L+ GW  
Sbjct: 506 VERHETLAQWRARLGSAGFDPVNLGSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHT 565

Query: 414 RIVYALSSWRSAS*FCLRSS 355
           R + A S+W+ A+   L SS
Sbjct: 566 RPLIATSAWQLANKPALPSS 585



>gb:AK117483_1815516 Arabidopsis thaliana At5g48150 mRNA for
           putative SCARECROW gene regulator, complete cds, clone:
           RAFL17-10-L05.
          Length = 411

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 39/125 (31%), Positives = 69/125 (55%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F  RF E + +++++F+ +D  +PR+  +RI +E+    ++  N+IACE A+RVER
Sbjct: 287 NTAAFFPRFMETMNYYAAMFESIDVTLPRDHKQRINVEQHCLARDVVNIIACEGADRVER 346

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +    +   + Y+  + ++E    L  GW  R + A
Sbjct: 347 HELLGKWRSRFGMAGFTPYPLSPLVNSTIKSLLRNYSDKYRLEERDGALYLGWMHRDLVA 406

Query: 399 LSSWR 385
             +W+
Sbjct: 407 SCAWK 411



>gb:AB023039_1515421 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIF21.>gb:AF153443_1772841 Arabidopsis thaliana
           phytochrome A signal transduction 1 protein (PAT1) mRNA,
           complete cds.
          Length = 490

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 39/125 (31%), Positives = 69/125 (55%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F  RF E + +++++F+ +D  +PR+  +RI +E+    ++  N+IACE A+RVER
Sbjct: 366 NTAAFFPRFMETMNYYAAMFESIDVTLPRDHKQRINVEQHCLARDVVNIIACEGADRVER 425

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +    +   + Y+  + ++E    L  GW  R + A
Sbjct: 426 HELLGKWRSRFGMAGFTPYPLSPLVNSTIKSLLRNYSDKYRLEERDGALYLGWMHRDLVA 485

Query: 399 LSSWR 385
             +W+
Sbjct: 486 SCAWK 490



>gb:AK118009_1816011 Arabidopsis thaliana At3g03450 mRNA for
           putative RGA1, complete cds, clone: RAFL19-21-I19.
          Length = 547

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 44/130 (33%), Positives = 71/130 (54%), Gaps = 2/130 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N   F+ RF EAL ++SSLFD L+ +      +R++ E    G++  NV+A E ++RVE
Sbjct: 419 HNGIVFLDRFNEALHYYSSLFDSLEDSYSLPSQDRVMSE-VYLGRQILNVVAAEGSDRVE 477

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R ET  QW +R   AGF P+ L     K +     +Y     + ++E+   L+ GW+ R 
Sbjct: 478 RHETAAQWRIRMKSAGFDPIHLGSSAFKQASMLLSLYATGDGYRVEENDGCLMIGWQTRP 537

Query: 408 VYALSSWRSA 379
           +   S+W+ A
Sbjct: 538 LITTSAWKLA 547



>gb:AY326306_1599657 Cucurbita maxima gibberellic acid insensitive
           phloem (GAIP) mRNA, complete cds.
          Length = 579

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 44/128 (34%), Positives = 74/128 (57%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+ +   N  ++++ E  + G++  NV+ACE A+RVE
Sbjct: 446 HNGPVFVERFTESLHYYSTLFDSLECSP--NSQDKMMSEMYL-GKQICNVVACEGADRVE 502

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   AGF P+ L     K +     ++   + + ++E+   L+ GW  R 
Sbjct: 503 RHETLTQWRTRLSSAGFDPIHLGSNAFKQASILLALFGSGEGYRVEENEGSLMLGWHTRP 562

Query: 408 VYALSSWR 385
           + A S+W+
Sbjct: 563 LIATSAWK 570



>gb:ATAC009895_1543077 Arabidopsis thaliana chromosome III BAC T21P5
           genomic sequence, complete sequence.
          Length = 547

 Score = 79.7 bits (195), Expect = 6e-14
 Identities = 44/130 (33%), Positives = 71/130 (54%), Gaps = 2/130 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N   F+ RF EAL ++SSLFD L+ +      +R++ E    G++  NV+A E ++RVE
Sbjct: 419 HNGIVFLDRFNEALHYYSSLFDSLEDSYSLPSQDRVMSE-VYLGRQILNVVAAEGSDRVE 477

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R ET  QW +R   AGF P+ L     K +     +Y     + ++E+   L+ GW+ R 
Sbjct: 478 RHETAAQWRIRMKSAGFDPIHLGSSAFKQASMLLSLYATGDGYRVEENDGCLMIGWQTRP 537

Query: 408 VYALSSWRSA 379
           +   S+W+ A
Sbjct: 538 LITTSAWKLA 547



>gb:AF036302_1762938 Arabidopsis thaliana scarecrow-like 5 (SCL5)
           mRNA, partial cds.
          Length = 306

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E + H+ ++F+ +D  + R+  ERI +E+    +E  N+IACE  ER ER
Sbjct: 182 NTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREER 241

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +    +   + Y++ + ++E    L  GWK + +  
Sbjct: 242 HEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEKYTLEERDGALYLGWKNQPLIT 301

Query: 399 LSSWR 385
             +WR
Sbjct: 302 SCAWR 306



>gb:CRU303349_1673662 Capsella rubella ORF1, ORF2, ORF3, ORF4, ORF5
           and ORF6 (partial).
          Length = 447

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 40/127 (31%), Positives = 71/127 (55%), Gaps = 6/127 (4%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+ RF EAL H+ ++FD L+  +P N  ER+ +E+  FG+E  +V+A E  ER +R   +
Sbjct: 325 FLIRFSEALDHYVAIFDSLEATLPPNSRERLTLEQRWFGKEIMDVVAAEATERKQRHRRF 384

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV------YNKDFVIDEDGEWLLQGWKGRIV 406
           + W     R GF+ +P+    +  ++   ++      YN  F+ D     L  GW+ R++
Sbjct: 385 EIWGEMMKRFGFVNVPIGSFALSQAKLLLRLHYPSEGYNLQFLNDS----LFLGWQNRLL 440

Query: 405 YALSSWR 385
           +++SSW+
Sbjct: 441 FSVSSWK 447



>gb:BT000883_1635138 Arabidopsis thaliana clone C105359 putative
           scarecrow protein (At1g50600) mRNA, complete cds.
          Length = 597

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E + H+ ++F+ +D  + R+  ERI +E+    +E  N+IACE  ER ER
Sbjct: 473 NTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREER 532

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +    +   + Y++ + ++E    L  GWK + +  
Sbjct: 533 HEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEKYTLEERDGALYLGWKNQPLIT 592

Query: 399 LSSWR 385
             +WR
Sbjct: 593 SCAWR 597



>gb:AY034929_1559714 Arabidopsis thaliana putative scarecrow protein
           (At1g50600) mRNA, partial cds.
          Length = 587

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E + H+ ++F+ +D  + R+  ERI +E+    +E  N+IACE  ER ER
Sbjct: 463 NTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREER 522

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +    +   + Y++ + ++E    L  GWK + +  
Sbjct: 523 HEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEKYTLEERDGALYLGWKNQPLIT 582

Query: 399 LSSWR 385
             +WR
Sbjct: 583 SCAWR 587



>pir|E96542|E96542 scarecrow-like protein [imported] - Arabidopsis
           thaliana>gb:AE005173_892977 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC012561_1537695 Arabidopsis thaliana
           chromosome I BAC F11F12 genomic sequence, complete
           sequence.>gb:AC079279_1732404 Arabidopsis thaliana
           chromosome 1 BAC F17J6 genomic sequence, complete
           sequence.
          Length = 526

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E + H+ ++F+ +D  + R+  ERI +E+    +E  N+IACE  ER ER
Sbjct: 402 NTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREER 461

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +    +   + Y++ + ++E    L  GWK + +  
Sbjct: 462 HEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEKYTLEERDGALYLGWKNQPLIT 521

Query: 399 LSSWR 385
             +WR
Sbjct: 522 SCAWR 526



>pir|T51236|T51236 scarecrow-like protein 5 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 306

 Score = 79.3 bits (194), Expect = 8e-14
 Identities = 40/125 (32%), Positives = 67/125 (53%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E + H+ ++F+ +D  + R+  ERI +E+    +E  N+IACE  ER ER
Sbjct: 182 NTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREER 241

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +    +   + Y++ + ++E    L  GWK + +  
Sbjct: 242 HEPLGKWRSRFHMAGFKPYPLSSYVNATIKGLLESYSEKYTLEERDGALYLGWKNQPLIT 301

Query: 399 LSSWR 385
             +WR
Sbjct: 302 SCAWR 306



>gb:AY039611_1560324 Arabidopsis thaliana F17J6.12/F17J6.12 mRNA,
           complete cds.
          Length = 526

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 40/125 (32%), Positives = 66/125 (52%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ RF E + H+ ++F+ +D  + R+  ERI +E+    +E  N+IACE  ER ER
Sbjct: 402 NTAPFLPRFVETMNHYLAVFESIDVKLARDHKERINVEQHCLAREVVNLIACEGVEREER 461

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W  R   AGF P PL+  +        + Y++ + ++E    L  GWK + +  
Sbjct: 462 HEPLGKWRSRFHMAGFKPYPLSSYVNATIEGLLESYSEKYTLEERDGALYLGWKNQPLIT 521

Query: 399 LSSWR 385
             +WR
Sbjct: 522 SCAWR 526



>gb:BT001076_1635331 Arabidopsis thaliana At4g17230/dl4650c mRNA,
           complete cds.>gb:AF419570_1798432 Arabidopsis thaliana
           AT4g17230/dl4650c mRNA, complete cds.
          Length = 529

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 41/125 (32%), Positives = 69/125 (55%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F++RF E L +++++F+ +D   PR+  +RI  E+    ++  N+IACE +ERVER
Sbjct: 401 NTSPFLSRFVETLDYYTAMFESIDAARPRDDKQRISAEQHCVARDIVNMIACEESERVER 460

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W VR M AGF   P++      + +  K Y+K++ +      L   WK R +  
Sbjct: 461 HEVLGKWRVRMMMAGFTGWPVSTSAAFAASEMLKAYDKNYKLGGHEGALYLFWKRRPMAT 520

Query: 399 LSSWR 385
            S W+
Sbjct: 521 CSVWK 525



>gb:AF036300_1762936 Arabidopsis thaliana scarecrow-like 1 (SCL1)
           mRNA, partial cds.
          Length = 352

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 42/125 (33%), Positives = 70/125 (56%), Gaps = 1/125 (0%)
 Frame = -3

Query: 756 SPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERP 577
           SPFF  RF EA  ++S++F+ LD  +PR   ER+ +E+    ++  N++ACE  ER+ER 
Sbjct: 229 SPFF-PRFIEAYEYYSAVFESLDMTLPRESQERMNVERQCLARDIVNIVACEGEERIERY 287

Query: 576 ETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQGWKGRIVYA 400
           E   +W  R M AGF P P++ ++    ++  K  Y   + + E+   L   W+ + +  
Sbjct: 288 EAAGKWRARMMMAGFNPKPMSAKVTNNIQNLIKQQYCNKYKLKEEMGELHFCWEEKSLIV 347

Query: 399 LSSWR 385
            S+WR
Sbjct: 348 ASAWR 352



>pir|E86347|E86347 scarecrow-like 1 protein F24J8.8 - Arabidopsis
           thaliana>gb:AE005172_891096 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC015447_1537999 Arabidopsis thaliana
           chromosome I BAC F24J8 genomic sequence, complete
           sequence.>gb:AY045833_1561345 Arabidopsis thaliana
           putative scarecrow 1 protein (At1g21450) mRNA, complete
           cds.>gb:AY084492_1569581 Arabidopsis thaliana clone
           109490 mRNA, complete sequence.>gb:AY096626_1576166
           Arabidopsis thaliana unknown protein (At1g21450) mRNA,
           complete cds.>gb:AF210731_1777377 Arabidopsis thaliana
           scarecrow-like 1 (SCL1) mRNA, complete cds.
          Length = 593

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 42/125 (33%), Positives = 70/125 (56%), Gaps = 1/125 (0%)
 Frame = -3

Query: 756 SPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERP 577
           SPFF  RF EA  ++S++F+ LD  +PR   ER+ +E+    ++  N++ACE  ER+ER 
Sbjct: 470 SPFF-PRFIEAYEYYSAVFESLDMTLPRESQERMNVERQCLARDIVNIVACEGEERIERY 528

Query: 576 ETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQGWKGRIVYA 400
           E   +W  R M AGF P P++ ++    ++  K  Y   + + E+   L   W+ + +  
Sbjct: 529 EAAGKWRARMMMAGFNPKPMSAKVTNNIQNLIKQQYCNKYKLKEEMGELHFCWEEKSLIV 588

Query: 399 LSSWR 385
            S+WR
Sbjct: 589 ASAWR 593



>pir|T51234|T51234 scarecrow-like protein 1 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 352

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 42/125 (33%), Positives = 70/125 (56%), Gaps = 1/125 (0%)
 Frame = -3

Query: 756 SPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERP 577
           SPFF  RF EA  ++S++F+ LD  +PR   ER+ +E+    ++  N++ACE  ER+ER 
Sbjct: 229 SPFF-PRFIEAYEYYSAVFESLDMTLPRESQERMNVERQCLARDIVNIVACEGEERIERY 287

Query: 576 ETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAK-VYNKDFVIDEDGEWLLQGWKGRIVYA 400
           E   +W  R M AGF P P++ ++    ++  K  Y   + + E+   L   W+ + +  
Sbjct: 288 EAAGKWRARMMMAGFNPKPMSAKVTNNIQNLIKQQYCNKYKLKEEMGELHFCWEEKSLIV 347

Query: 399 LSSWR 385
            S+WR
Sbjct: 348 ASAWR 352



>gb:AB189844_1529557 Daucus carota DcLSLP mRNA for lateral
           suppressor-like protein, complete cds.
          Length = 431

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 41/130 (31%), Positives = 74/130 (56%), Gaps = 5/130 (3%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF EAL H+++LFD L+  +P N  +RI +E+  FG+E  ++IA E   R E
Sbjct: 304 HNLPIFLQRFVEALDHYTALFDSLEATLPPNSRQRIEVEQIWFGREIADIIASEGETRRE 363

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY-----NKDFVIDEDGEWLLQGWK 418
           R E ++ W +    +GF  L L+   +  ++   ++Y      K  ++++   W   GW+
Sbjct: 364 RHERFRAWELMLRGSGFHNLALSPFALSQAKLLLRLYYPSEGYKLHILNDSFFW---GWQ 420

Query: 417 GRIVYALSSW 388
            + ++++SSW
Sbjct: 421 NQHLFSVSSW 430



>gb:AP000378_1819856 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:T4M5.
          Length = 640

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 38/125 (30%), Positives = 69/125 (55%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ R  E+   + +L + +++ VP    +R  +E+ I G++  N +ACE  +R+ER
Sbjct: 517 NTAPFLGRVSESCACYGALLESVESTVPSTNSDRAKVEEGI-GRKLVNAVACEGIDRIER 575

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E + +W +R   AGF  +PL+++I +  + R    +  F + ED   +  GW GR +  
Sbjct: 576 CEVFGKWRMRMSMAGFELMPLSEKIAESMKSRGNRVHPGFTVKEDNGGVCFGWMGRALTV 635

Query: 399 LSSWR 385
            S+WR
Sbjct: 636 ASAWR 640



>gb:AF036305_1762941 Arabidopsis thaliana scarecrow-like 8 (SCL8)
           mRNA, partial cds.
          Length = 573

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 38/125 (30%), Positives = 69/125 (55%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ R  E+   + +L + +++ VP    +R  +E+ I G++  N +ACE  +R+ER
Sbjct: 450 NTAPFLGRVSESCACYGALLESVESTVPSTNSDRAKVEEGI-GRKLVNAVACEGIDRIER 508

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E + +W +R   AGF  +PL+++I +  + R    +  F + ED   +  GW GR +  
Sbjct: 509 CEVFGKWRMRMSMAGFELMPLSEKIAESMKSRGNRVHPGFTVKEDNGGVCFGWMGRALTV 568

Query: 399 LSSWR 385
            S+WR
Sbjct: 569 ASAWR 573



>gb:AY099686_1576711 Arabidopsis thaliana SCARECROW transcriptional
           regulator-like (At5g52510) mRNA, complete
           cds.>gb:AY128868_1580948 Arabidopsis thaliana SCARECROW
           transcriptional regulator-like (At5g52510) mRNA,
           complete cds.
          Length = 371

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 38/125 (30%), Positives = 69/125 (55%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ R  E+   + +L + +++ VP    +R  +E+ I G++  N +ACE  +R+ER
Sbjct: 248 NTAPFLGRVSESCACYGALLESVESTVPSTNSDRAKVEEGI-GRKLVNAVACEGIDRIER 306

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E + +W +R   AGF  +PL+++I +  + R    +  F + ED   +  GW GR +  
Sbjct: 307 CEVFGKWRMRMSMAGFELMPLSEKIAESMKSRGNRVHPGFTVKEDNGGVCFGWMGRALTV 366

Query: 399 LSSWR 385
            S+WR
Sbjct: 367 ASAWR 371



>pir|T51239|T51239 scarecrow-like protein 8 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 573

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 38/125 (30%), Positives = 69/125 (55%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F+ R  E+   + +L + +++ VP    +R  +E+ I G++  N +ACE  +R+ER
Sbjct: 450 NTAPFLGRVSESCACYGALLESVESTVPSTNSDRAKVEEGI-GRKLVNAVACEGIDRIER 508

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E + +W +R   AGF  +PL+++I +  + R    +  F + ED   +  GW GR +  
Sbjct: 509 CEVFGKWRMRMSMAGFELMPLSEKIAESMKSRGNRVHPGFTVKEDNGGVCFGWMGRALTV 568

Query: 399 LSSWR 385
            S+WR
Sbjct: 569 ASAWR 573



>gb:AF036308_1762944 Arabidopsis thaliana scarecrow-like 13 (SCL13)
           mRNA, partial cds.
          Length = 284

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/125 (32%), Positives = 68/125 (54%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+   ++RF E L +++++F+ +D   PR+  +RI  E+    ++  N+IACE +ERVER
Sbjct: 153 NTSPLVSRFVETLDYYTAMFESIDAARPRDDKQRISAEQHCVARDIVNMIACEESERVER 212

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W VR M AGF   P++      + +  K Y+K++ +      L   WK R +  
Sbjct: 213 HEVLGKWRVRMMMAGFTGWPVSTSAAFAASEMLKAYDKNYKLGGHEGALYLFWKRRPMAT 272

Query: 399 LSSWR 385
            S W+
Sbjct: 273 CSVWK 277



>pir|T51241|T51241 scarecrow-like protein 13 [imported] -
           Arabidopsis thaliana  (fragment)
          Length = 284

 Score = 75.9 bits (185), Expect = 9e-13
 Identities = 40/125 (32%), Positives = 68/125 (54%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+   ++RF E L +++++F+ +D   PR+  +RI  E+    ++  N+IACE +ERVER
Sbjct: 153 NTSPLVSRFVETLDYYTAMFESIDAARPRDDKQRISAEQHCVARDIVNMIACEESERVER 212

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E   +W VR M AGF   P++      + +  K Y+K++ +      L   WK R +  
Sbjct: 213 HEVLGKWRVRMMMAGFTGWPVSTSAAFAASEMLKAYDKNYKLGGHEGALYLFWKRRPMAT 272

Query: 399 LSSWR 385
            S W+
Sbjct: 273 CSVWK 277



>gb:AP003259_1826533 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0466H10.
          Length = 442

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 42/128 (32%), Positives = 72/128 (56%), Gaps = 1/128 (0%)
 Frame = -3

Query: 765 AYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERV 586
           ++N+     RF EAL ++++LFD L+    R   ER  +E+ + G+E KN++AC+  ER 
Sbjct: 310 SHNAAGLTERFVEALNYYAALFDCLEVGAARGSVERARVERWLLGEEIKNIVACDGGERR 369

Query: 585 ERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRI 409
           ER E  ++W  R   AGF  +PL+   +  +R  A+    D F + E+       W+ R 
Sbjct: 370 ERHERLERWARRLEGAGFGRVPLSYYALLQARRVAQGLGCDGFKVREEKGNFFLCWQDRA 429

Query: 408 VYALSSWR 385
           ++++S+WR
Sbjct: 430 LFSVSAWR 437



>gb:AY052239_1562612 Arabidopsis thaliana At2g01570/F2I9.19 mRNA,
           complete cds.
          Length = 587

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/128 (33%), Positives = 70/128 (54%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+  VP N  ++++ E    G++  N++ACE  +RVE
Sbjct: 457 HNGPVFLDRFTESLHYYSTLFDSLE-GVP-NSQDKVMSE-VYLGKQICNLVACEGPDRVE 513

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   +G  P  L     K +     V+N  + + ++E    L+ GW  R 
Sbjct: 514 RHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRP 573

Query: 408 VYALSSWR 385
           +   S+W+
Sbjct: 574 LITTSAWK 581



>gb:ATY15194_1557522 Arabidopsis thaliana mRNA for GRS protein.
          Length = 587

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/128 (33%), Positives = 70/128 (54%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+  VP N  ++++ E    G++  N++ACE  +RVE
Sbjct: 457 HNGPVFLDRFTESLHYYSTLFDSLE-GVP-NSQDKVMSE-VYLGKQICNLVACEGPDRVE 513

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   +G  P  L     K +     V+N  + + ++E    L+ GW  R 
Sbjct: 514 RHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRP 573

Query: 408 VYALSSWR 385
           +   S+W+
Sbjct: 574 LITTSAWK 581



>gb:ATY15193_1557521 Arabidopsis thaliana GAI gene.
          Length = 532

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +NSP F+ RF E+L ++S+LFD L+  VP    ++++ E    G++  NV+AC+  +RVE
Sbjct: 404 HNSPIFLDRFTESLHYYSTLFDSLE-GVPSG-QDKVMSE-VYLGKQICNVVACDGPDRVE 460

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   AGF    +     K +     ++N  + + ++E    L+ GW  R 
Sbjct: 461 RHETLSQWRNRFGSAGFAAAHIGSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRP 520

Query: 408 VYALSSWR 385
           + A S+W+
Sbjct: 521 LIATSAWK 528



>gb:ATRGA2_1554046 A.thaliana mRNA for RGA2 gene.
          Length = 532

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +NSP F+ RF E+L ++S+LFD L+  VP    ++++ E    G++  NV+AC+  +RVE
Sbjct: 404 HNSPIFLDRFTESLHYYSTLFDSLE-GVPSG-QDKVMSE-VYLGKQICNVVACDGPDRVE 460

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   AGF    +     K +     ++N  + + ++E    L+ GW  R 
Sbjct: 461 RHETLSQWRNRFGSAGFAAAHIGSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRP 520

Query: 408 VYALSSWR 385
           + A S+W+
Sbjct: 521 LIATSAWK 528



>gb:ATRGA1_1554045 A.thaliana mRNA for RGA1 gene.
          Length = 587

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/128 (33%), Positives = 70/128 (54%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+  VP N  ++++ E    G++  N++ACE  +RVE
Sbjct: 457 HNGPVFLDRFTESLHYYSTLFDSLE-GVP-NSQDKVMSE-VYLGKQICNLVACEGPDRVE 513

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   +G  P  L     K +     V+N  + + ++E    L+ GW  R 
Sbjct: 514 RHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRP 573

Query: 408 VYALSSWR 385
           +   S+W+
Sbjct: 574 LITTSAWK 581



>gb:AE005173_893441 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC002328_1530231 Genomic sequence
           for Arabidopsis thaliana BAC F20N2 from chromosome I,
           complete sequence.>gb:AY196482_1588932 Arabidopsis
           thaliana lateral suppressor (LAS) mRNA, complete cds.
          Length = 445

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 38/127 (29%), Positives = 70/127 (55%), Gaps = 6/127 (4%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+ RF EA+ H+ ++FD L+  +P N  ER+ +E+  FG+E  +V+A E  ER +R   +
Sbjct: 323 FLNRFSEAVDHYMAIFDSLEATLPPNSRERLTLEQRWFGKEILDVVAAEETERKQRHRRF 382

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKV------YNKDFVIDEDGEWLLQGWKGRIV 406
           + W     R GF+ +P+    +  ++   ++      YN  F+ +     L  GW+ R +
Sbjct: 383 EIWEEMMKRFGFVNVPIGSFALSQAKLLLRLHYPSEGYNLQFLNNS----LFLGWQNRPL 438

Query: 405 YALSSWR 385
           +++SSW+
Sbjct: 439 FSVSSWK 445



>pir|H86282|H86282 protein F10B6.34 [imported] - Arabidopsis
           thaliana>gb:AE005172_890491 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006917_1534694 Genomic sequence for
           Arabidopsis thaliana BAC F10B6 from chromosome I,
           complete sequence.>gb:AY058194_1564329 Arabidopsis
           thaliana At1g14920/F10B6_15 mRNA, complete
           cds.>gb:AY142002_1582839 Arabidopsis thaliana
           At1g14920/F10B6_15 mRNA, complete cds.
          Length = 533

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/128 (33%), Positives = 71/128 (55%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +NSP F+ RF E+L ++S+LFD L+  VP    ++++ E    G++  NV+AC+  +RVE
Sbjct: 405 HNSPIFLDRFTESLHYYSTLFDSLE-GVPSG-QDKVMSE-VYLGKQICNVVACDGPDRVE 461

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   AGF    +     K +     ++N  + + ++E    L+ GW  R 
Sbjct: 462 RHETLSQWRNRFGSAGFAAAHIGSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRP 521

Query: 408 VYALSSWR 385
           + A S+W+
Sbjct: 522 LIATSAWK 529



>pir|D84426|D84426 hypothetical protein At2g01570 [imported] -
           Arabidopsis thaliana>gb:AC005560_1532823 Arabidopsis
           thaliana chromosome 2 clone F2I9 map rga, complete
           sequence.>gb:AY054160_1562982 Arabidopsis thaliana
           At2g01570/F2I9.19 mRNA, complete
           cds.>gb:BT010467_1640413 Arabidopsis thaliana
           At2g01570/F2I9.19 gene, complete cds.
          Length = 587

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 43/128 (33%), Positives = 70/128 (54%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+  VP N  ++++ E    G++  N++ACE  +RVE
Sbjct: 457 HNGPVFLDRFTESLHYYSTLFDSLE-GVP-NSQDKVMSE-VYLGKQICNLVACEGPDRVE 513

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   +G  P  L     K +     V+N  + + ++E    L+ GW  R 
Sbjct: 514 RHETLSQWGNRFGSSGLAPAHLGSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRP 573

Query: 408 VYALSSWR 385
           +   S+W+
Sbjct: 574 LITTSAWK 581



>gb:AY269087_1594027 Lycopersicon esculentum GAI-like protein mRNA,
           complete cds.
          Length = 588

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 42/141 (29%), Positives = 75/141 (53%), Gaps = 15/141 (10%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTN-------------VPRNIHERILIEKTIFGQEA 622
           +N+  FI RF EAL ++S++FD L+++              P   ++ +++ +   G++ 
Sbjct: 434 HNAGVFIDRFNEALHYYSTMFDSLESSGSSSSASPTGILPQPPVNNQDLVMSEVYLGRQI 493

Query: 621 KNVIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDE 448
            NV+ACE ++RVER ET  QW VR   +GF P+ L     K +     ++     + ++E
Sbjct: 494 CNVVACEGSDRVERHETLNQWRVRMNSSGFDPVHLGSNAFKQASMLLALFAGGDGYRVEE 553

Query: 447 DGEWLLQGWKGRIVYALSSWR 385
           +   L+ GW  R + A S+W+
Sbjct: 554 NDGCLMLGWHTRPLIATSAWK 574



>gb:LES303345_1684555 Lycopersicon esculentum lateral suppressor
           gene, ORF1 and ORF2.>gb:AF098674_1767929 Lycopersicon
           esculentum lateral suppressor protein (Ls) mRNA,
           complete cds.
          Length = 428

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 35/128 (27%), Positives = 72/128 (56%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF EAL +++++FD L+  +P    ER+ +E+  FG+E  +++A E  +R E
Sbjct: 301 HNHPLFLQRFIEALDYYTAVFDSLEATLPPGSRERMTVEQVWFGREIVDIVAMEGDKRKE 360

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R E ++ W V     GF  + L+   +  ++   +++  ++ + +         GW+ + 
Sbjct: 361 RHERFRSWEVMLRSCGFSNVALSPFALSQAKLLLRLHYPSEGYQLGVSSNSFFLGWQNQP 420

Query: 408 VYALSSWR 385
           ++++SSWR
Sbjct: 421 LFSISSWR 428



>gb:AY326307_1599658 Cucurbita maxima gibberellic acid insensitive
           phloem B (GAIP-B) mRNA, complete cds.
          Length = 587

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 40/128 (31%), Positives = 71/128 (55%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+++ P N  +  ++ +   G++  NV+ACE ++RVE
Sbjct: 453 HNGPVFMDRFTESLHYYSTLFDSLESS-PNNQDK--MMSEMYLGKQICNVVACEGSDRVE 509

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
             ET  QW  R   +GF P+ L     K +     ++   + + ++E+   L  GW  R 
Sbjct: 510 WHETLTQWRTRLCSSGFEPIHLGSNAFKQASMLLALFGSGEGYRVEENNGSLTLGWHTRP 569

Query: 408 VYALSSWR 385
           +   S+W+
Sbjct: 570 LIVTSAWK 577



>gb:OSJN00086_1694639 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064M23, complete sequence.
          Length = 619

 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 42/125 (33%), Positives = 61/125 (48%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+    TRF +A  H+ ++ + LD  +PR   ER   E  + G+ A N +A E A+R+ER
Sbjct: 496 NTAPLTTRFTDACAHYGAILESLDATIPRESAERARAEAALGGRAA-NAVAREGADRLER 554

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E + +W  R   AGF P+ L   I      R       F +  +   L  GW GR+V  
Sbjct: 555 CEVFGKWRSRFGMAGFRPVALGPGIADQVLARQGPVAAGFAVKAENGVLRLGWMGRVVTV 614

Query: 399 LSSWR 385
            S+WR
Sbjct: 615 ASAWR 619



>gb:ATA224957_1542702 Arabidopsis thaliana RGAL gene.
          Length = 662

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/128 (33%), Positives = 69/128 (53%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N   F+ RF E+L ++SSLFD L+    +   +R++ E    G++  N++ACE  +RVE
Sbjct: 534 HNGTVFLDRFTESLHYYSSLFDSLEGPPSQ---DRVMSE-LFLGRQILNLVACEGEDRVE 589

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R    GF P+ +     K +     +Y     + ++E+   LL GW+ R 
Sbjct: 590 RHETLNQWRNRFGLGGFKPVSIGSNAYKQASMLLALYAGADGYNVEENEGCLLLGWQTRP 649

Query: 408 VYALSSWR 385
           + A S+WR
Sbjct: 650 LIATSAWR 657



>pir|G96688|G96688 hypothetical protein T27F4.10 [imported] -
           Arabidopsis thaliana>gb:AE005173_894283 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC020665_1538587 Arabidopsis thaliana
           chromosome 1 BAC T27F4 genomic sequence, complete
           sequence.>gb:AY048749_1561789 Arabidopsis thaliana RGL1
           protein mRNA, complete cds.>gb:AY070035_1566678
           Arabidopsis thaliana putative gibberellin regulatory
           protein (At1g66350) mRNA, complete
           cds.>gb:AY096506_1576048 Arabidopsis thaliana putative
           gibberellin regulatory protein (At1g66350) mRNA,
           complete cds.
          Length = 511

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 43/128 (33%), Positives = 69/128 (53%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N   F+ RF E+L ++SSLFD L+    +   +R++ E    G++  N++ACE  +RVE
Sbjct: 383 HNGTVFLDRFTESLHYYSSLFDSLEGPPSQ---DRVMSE-LFLGRQILNLVACEGEDRVE 438

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R    GF P+ +     K +     +Y     + ++E+   LL GW+ R 
Sbjct: 439 RHETLNQWRNRFGLGGFKPVSIGSNAYKQASMLLALYAGADGYNVEENEGCLLLGWQTRP 498

Query: 408 VYALSSWR 385
           + A S+WR
Sbjct: 499 LIATSAWR 506



>gb:AX081276_1460755 Sequence 1 from Patent WO0109356.
          Length = 572

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 40/128 (31%), Positives = 70/128 (54%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+   P +  ++++ E    G++  N++ACE  +RVE
Sbjct: 443 HNGPVFLDRFTESLHYYSTLFDSLE-GAPSS-QDKVMSE-VYLGKQICNLVACEGPDRVE 499

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   +GF P  L     K +     ++N  + + ++E+   L+  W  R 
Sbjct: 500 RHETLSQWSNRFGSSGFAPAHLGSNAFKQASTLLALFNGGEGYRVEENNGCLMLSWHTRP 559

Query: 408 VYALSSWR 385
           +   S+W+
Sbjct: 560 LITTSAWK 567



>gb:AY389546_1178192 Hyacinthus orientalis GAI-like protein mRNA,
           partial cds.
          Length = 215

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 6/134 (4%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNI----HERILIEKTIFGQEAKNVIACETA 595
           +N   F  RF EAL ++S++FD L+     +      +  ++ +   G++  NV+ACE A
Sbjct: 80  HNGGLFAERFTEALHYYSTMFDSLEGGASADAVSGGQQNQVMSEVYLGRQICNVVACEGA 139

Query: 594 ERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGW 421
           ER ER ET  QW  R   AGF P+ L     K +     ++     + ++E    L  GW
Sbjct: 140 ERTERHETLVQWRNRLSPAGFEPVHLGSNAFKQASMLLALFAGGNGYRVEEKDGCLTLGW 199

Query: 420 KGRIVYALSSWRSA 379
             R + A S+WR A
Sbjct: 200 HTRPLIATSAWRVA 213



>gb:AF492570_1804930 Argyroxiphium kauense clone AkBcopy1n
           GIA/RGA-like gibberellin response modulator (GAI-B)
           gene, partial cds.
          Length = 538

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 36/92 (39%), Positives = 56/92 (60%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +NS  F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 424 HNSAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 483

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 484 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 515



>pir|T51475|T51475 RGA-like protein - Arabidopsis
           thaliana>gb:ATK3M16_1553522 Arabidopsis thaliana DNA
           chromosome 5, BAC clone K3M16 (ESSA
           project).>gb:BT005905_1638827 Arabidopsis thaliana
           At5g17490 gene, complete cds.>gb:AK117226_1815271
           Arabidopsis thaliana At5g17490 mRNA for RGA-like
           protein, complete cds, clone: RAFL16-78-A02.
          Length = 523

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 2/131 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N   F+ RF EAL ++SSLFD L+  V     +R++ E    G++  N++A E ++R+E
Sbjct: 390 HNGDVFLDRFNEALHYYSSLFDSLEDGVVIPSQDRVMSE-VYLGRQILNLVATEGSDRIE 448

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   AGF P+ L  +  K +     +      + ++E+   L+  W+ + 
Sbjct: 449 RHETLAQWRKRMGSAGFDPVNLGSDAFKQASLLLALSGGGDGYRVEENDGSLMLAWQTKP 508

Query: 408 VYALSSWRSAS 376
           + A S+W+ A+
Sbjct: 509 LIAASAWKLAA 519



>gb:AY184482_1587927 Brassica rapa subsp. pekinensis phytochrome A
           signal transduction 1 protein (PAT1) mRNA, partial cds.
          Length = 142

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 32/82 (39%), Positives = 51/82 (62%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F  RF+E + ++ ++F+ +D  +PRN  +RI +E+    ++  N+IACE A+RVER
Sbjct: 58  NTAAFFPRFKETMDYYDAMFESIDVTLPRNHKQRINVEQHCLARDVVNIIACEGADRVER 117

Query: 579 PETYKQWHVRNMRAGFLPLPLN 514
            E   +W  R   AGF P PL+
Sbjct: 118 HELLGKWRSRFGMAGFTPYPLS 139



>gb:AX081278_1460756 Sequence 3 from Patent WO0109356.
          Length = 572

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 39/128 (30%), Positives = 70/128 (54%), Gaps = 2/128 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF E+L ++S+LFD L+   P +  ++++ E    G++  N++ACE  +RVE
Sbjct: 443 HNGPVFLDRFTESLHYYSTLFDSLE-GAPSS-QDKVMSE-VYLGKQICNLVACEGPDRVE 499

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN--KDFVIDEDGEWLLQGWKGRI 409
           R ET  QW  R   +GF P  L     K +     ++N  + + ++++   L+  W  R 
Sbjct: 500 RHETLSQWSNRFGSSGFAPAHLGSNAFKQASTLLALFNGGEGYRVEKNNGCLMLSWHTRP 559

Query: 408 VYALSSWR 385
           +   S+W+
Sbjct: 560 LITTSAWK 567



>gb:AF492575_1804934 Carlquistia muirii clone Cm1 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 548

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTN---VPRNIHERILIEKTIFGQEAKNVIACETAE 592
           +N   F+ RF EAL ++S++FD L+++   +P N  + +++ +   G++  NV+ACE  E
Sbjct: 434 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNN-QDDLVMSEVYLGRQICNVVACEGTE 492

Query: 591 RVERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           RVER ET  QW VR   AGF P+ L     K +
Sbjct: 493 RVERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 525



>gb:AF492572_1804932 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsBcopy2 GIA/RGA-like gibberellin response
           modulator (GAI-B) gene, partial cds.
          Length = 537

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 423 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 482

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 483 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 514



>gb:AF492571_1804931 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsBcopy1 GIA/RGA-like gibberellin response
           modulator (GAI-B) gene, partial cds.
          Length = 538

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 424 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 483

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 484 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 515



>gb:AF492568_1804928 Wilkesia gymnoxiphium clone WgBcopy2
           GIA/RGA-like gibberellin response modulator (GAI-B)
           gene, partial cds.>gb:AF492569_1804929 Wilkesia
           gymnoxiphium clone WgBcopy1 GIA/RGA-like gibberellin
           response modulator (GAI-B) gene, partial cds.
          Length = 538

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 424 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 483

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 484 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 515



>gb:AF492567_1804927 Dubautia raillardioides clone DrBcopy
           GIA/RGA-like gibberellin response modulator (GAI-B)
           gene, partial cds.
          Length = 538

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 424 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 483

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 484 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 515



>gb:AF492566_1804926 Dubautia menziesii clone DmeBcopy GIA/RGA-like
           gibberellin response modulator (GAI-B) gene, partial
           cds.
          Length = 536

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 422 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 481

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 482 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 513



>gb:AF492565_1804925 Dubautia ciliolata subsp. glutinosa clone
           DcK20B GIA/RGA-like gibberellin response modulator
           (GAI-B) gene, partial cds.
          Length = 536

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 422 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 481

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 482 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 513



>gb:AF492564_1804924 Dubautia ciliolata subsp. glutinosa clone
           DcK05B GIA/RGA-like gibberellin response modulator
           (GAI-B) gene, partial cds.
          Length = 536

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 422 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 481

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 482 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 513



>gb:AF492563_1804923 Dubautia arborea clone DaBcopy2 GIA/RGA-like
           gibberellin response modulator (GAI-B) gene, partial
           cds.
          Length = 538

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 424 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 483

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 484 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 515



>gb:AF492562_1804922 Dubautia arborea clone DaBcopy1 GIA/RGA-like
           gibberellin response modulator (GAI-B) gene, partial
           cds.
          Length = 540

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 35/92 (38%), Positives = 55/92 (59%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE A+R
Sbjct: 426 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGADR 485

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 486 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 517



>gb:AF492576_1804935 Carlquistia muirii clone Cm2 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 548

 Score = 69.7 bits (169), Expect = 7e-11
 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTN---VPRNIHERILIEKTIFGQEAKNVIACETAE 592
           +N   F+ RF EAL ++S++FD L+++   +P N  + +++ +   G++  NV+ACE  E
Sbjct: 434 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNN-QDDLVMSEVYLGRQICNVVACEGTE 492

Query: 591 RVERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           RVER ET  QW VR   AGF P+ L     K +
Sbjct: 493 RVERHETLTQWRVRMNLAGFEPVHLGSNAFKQA 525



>gb:AY208992_1589641 Gossypium hirsutum GIA/RGA-like gibberellin
           response modulator (GAI) mRNA, GAI-Dwarf8 allele,
           complete cds.
          Length = 537

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 38/123 (30%), Positives = 63/123 (51%), Gaps = 2/123 (1%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF EAL ++S+LFD L+ +      + + + +   G++  NV+ACE  +RVE
Sbjct: 406 HNGPVFLDRFTEALHYYSTLFDSLEGSGVAPASQDLAMSELYLGRQICNVVACEGMDRVE 465

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRI 409
           R E   QW  R   AG  P+ L     K +     ++     + ++E+   L+ GW  R 
Sbjct: 466 RHEPLTQWRTRMETAGVSPVHLGSNAYKQASMLLALFASGDGYRVEENNGCLMLGWHTRP 525

Query: 408 VYA 400
           + A
Sbjct: 526 LIA 528



>gb:AB030956_1518584 Oryza sativa (japonica cultivar-group) mRNA for
           OsGAI, complete cds.>gb:AC087797_1734173 Oryza sativa
           chromosome 3 BAC OSJNBb0022E02 genomic sequence,
           complete sequence.
          Length = 625

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 45/143 (31%), Positives = 70/143 (48%), Gaps = 14/143 (9%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIH------------ERILIEKTIFGQEAK 619
           +NS  F+ RF E+L ++S++FD L+                    ++++ E    G++  
Sbjct: 483 HNSGSFLDRFTESLHYYSTMFDSLEGGSSGQAELSPPAAGGGGGTDQVMSE-VYLGRQIC 541

Query: 618 NVIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDED 445
           NV+ACE AER ER ET  QW  R  RAGF P+ L     K +     ++     + ++E 
Sbjct: 542 NVVACEGAERTERHETLGQWRNRLGRAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEK 601

Query: 444 GEWLLQGWKGRIVYALSSWRSAS 376
              L  GW  R + A S+WR A+
Sbjct: 602 EGCLTLGWHTRPLIATSAWRVAA 624



>gb:AF492573_1804933 Madia sativa clone MsCod1 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 535

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 421 HNGAVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 480

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 481 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 512



>gb:AF492590_1804949 Dubautia microcephala clone DmiAcopy1
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 537

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 423 HNGNVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 482

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 483 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 514



>gb:AF492589_1804948 Dubautia raillardioides clone DrAcopy1
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 539

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 425 HNGNVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 484

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 485 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 516



>gb:AF492587_1804946 Dubautia knudsenii clone DkAcopy1 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 537

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 423 HNGNVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 482

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 483 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 514



>gb:AF492586_1804945 Dubautia arborea clone DaAcopy1 GIA/RGA-like
           gibberellin response modulator (GAI-A) gene, partial
           cds.
          Length = 534

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 420 HNGNVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 479

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 480 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 511



>gb:AF492582_1804941 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsAcopy2 GIA/RGA-like gibberellin response
           modulator (GAI-A) gene, partial cds.
          Length = 541

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 427 HNGNVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 486

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 487 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 518



>gb:AF492581_1804940 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsAcopy1 GIA/RGA-like gibberellin response
           modulator (GAI-A) gene, partial cds.
          Length = 542

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 428 HNGNVFMERFNEALHYYSTMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 487

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 488 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 519



>gb:AF492580_1804939 Anisocarpus madioides clone ANm2b GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 143

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 34/92 (36%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 29  HNGALFMERFNEALHYYSTMFDSLESSALTLPNSPDDLVMSEVYLGRQICNVVACEGTDR 88

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 89  VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 120



>gb:AF492578_1804937 Calycadenia multiglandulosa clone CLmCod7
           GIA/RGA-like gibberellin response modulator (GAI) gene,
           partial cds.
          Length = 540

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 33/92 (35%), Positives = 54/92 (58%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNV--PRNIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 426 HNGVVFMDRFNEALHYYSTMFDSLESSALTQPNSQQDLVMSEVYLGRQICNVVACEGPDR 485

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW  R + AGF P+ L     K +
Sbjct: 486 VERHETLTQWRTRMISAGFEPVHLGSNAFKQA 517



>gb:AF492584_1804943 Argyroxiphium kauense clone AkAcopy2
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 544

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 34/92 (36%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+ +     N  + +++ +   G++  NV+ACE  +R
Sbjct: 430 HNGNVFMERFNEALHYYSTMFDSLEGSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 489

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 490 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 521



>gb:AF492583_1804942 Argyroxiphium kauense clone AkAcopy1
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 542

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 34/92 (36%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F+ RF EAL ++S++FD L+ +     N  + +++ +   G++  NV+ACE  +R
Sbjct: 428 HNGNVFMERFNEALHYYSTMFDSLEGSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 487

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 488 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 519



>gb:ZMA242530_1731466 Zea mays partial d8 gene for gibberellin
           response modulator.
          Length = 630

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 43/142 (30%), Positives = 68/142 (47%), Gaps = 13/142 (9%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDG 442
           V+ACE AER ER ET  QW  R   +GF P+ L     K +     ++     + ++E  
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHLGSNAYKQASTLLALFAGGDGYRVEEKD 604

Query: 441 EWLLQGWKGRIVYALSSWRSAS 376
             L  GW  R + A S+WR A+
Sbjct: 605 GCLTLGWHTRPLIATSAWRVAA 626



>gb:AY117079_1579155 Gossypioides kirkii putative RGA1 protein gene,
           partial cds.
          Length = 124

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 33/90 (36%), Positives = 50/90 (55%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF EAL ++S+LFD L+ +      + + + +   G++  NV+ACE  +RVE
Sbjct: 25  HNGPVFLDRFTEALHYYSTLFDSLEGSGVAPPSQDLAMSELYLGRQICNVVACEGMDRVE 84

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           R E   QW  R   AGF P+ L     K +
Sbjct: 85  RHEPLTQWRTRMETAGFSPVHLGSNAYKQA 114



>gb:AY117075_1579151 Gossypium herbaceum putative RGA1 protein gene,
           partial cds.>gb:AY117076_1579152 Gossypium raimondii
           putative RGA1 protein gene, partial
           cds.>gb:AY117077_1579153 Gossypium barbadense
           A-subgenome putative RGA1 protein gene, partial cds.
          Length = 124

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 33/90 (36%), Positives = 50/90 (55%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF EAL ++S+LFD L+ +      + + + +   G++  NV+ACE  +RVE
Sbjct: 25  HNGPVFLDRFTEALHYYSTLFDSLEGSGVAPPSQDLAMSELYLGRQICNVVACEGMDRVE 84

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           R E   QW  R   AGF P+ L     K +
Sbjct: 85  RHEPLTQWRTRMETAGFSPVHLGSNAYKQA 114



>gb:AF492588_1804947 Dubautia menziesii clone DmeAcopy1 GIA/RGA-like
           gibberellin response modulator (GAI-A) gene, partial
           cds.
          Length = 537

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 33/92 (35%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPR--NIHERILIEKTIFGQEAKNVIACETAER 589
           +N   F  RF EAL +++++FD L+++     N  + +++ +   G++  NV+ACE  +R
Sbjct: 423 HNGNVFKERFNEALHYYATMFDSLESSALTLPNSQDDLVMSEVYLGRQICNVVACEGTDR 482

Query: 588 VERPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           VER ET  QW VR   AGF P+ L     K +
Sbjct: 483 VERHETLTQWRVRMNSAGFEPVHLGSNAFKQA 514



>gb:TAE242531_1724288 Triticum aestivum rht-D1a gene for gibberellin
           response modulator.
          Length = 623

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 43/145 (29%), Positives = 66/145 (45%), Gaps = 17/145 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTN---------------VPRNIHERILIEKTIFGQ 628
           +NS  F+ RF E+L ++S++FD L+                  P       ++ +   G+
Sbjct: 477 HNSGTFLDRFTESLHYYSTMFDSLEGGSSGGGPSEVSSGAAAAPAAAGTDQVMSEVYLGR 536

Query: 627 EAKNVIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVI 454
           +  NV+ACE AER ER ET  QW  R   AGF  + L     K +     ++     + +
Sbjct: 537 QICNVVACEGAERTERHETLGQWRNRLGNAGFETVHLGSNAYKQASTLLALFAGGDGYKV 596

Query: 453 DEDGEWLLQGWKGRIVYALSSWRSA 379
           +E    L  GW  R + A S+WR A
Sbjct: 597 EEKEGCLTLGWHTRPLIATSAWRLA 621



>gb:AY117078_1579154 Gossypium barbadense D-subgenome putative RGA1
           protein gene, partial cds.
          Length = 124

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 32/90 (35%), Positives = 49/90 (54%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N P F+ RF EAL ++S+LFD L+ +      + + + +   G++  NV+ACE  +RVE
Sbjct: 25  HNGPVFLDRFTEALHYYSTLFDSLEGSGVAPASQDLAMSELYLGRQICNVVACEGMDRVE 84

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMS 493
           R E   QW  R   AGF  + L     K +
Sbjct: 85  RHEPLTQWRTRMETAGFSTVHLGSNAYKQA 114



>gb:AP002910_1823868 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0707D10.>gb:AP003234_1825872 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0038D11.
          Length = 493

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N   F+ RF EALF++S++FD LD           + E     +E  +++  E A R E
Sbjct: 322 HNKTGFLDRFTEALFYYSAVFDSLDAASASGGAGNAMAE-AYLQREICDIVCGEGAARRE 380

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN-KDFVIDEDGEWLLQGWKGRIV 406
           R E   +W  R  RAG   +PL    ++ +R    +++ +   ++E    L  GW GR +
Sbjct: 381 RHEPLSRWRDRLTRAGLSAVPLGSNALRQARMLVGLFSGEGHSVEEADGCLTLGWHGRPL 440

Query: 405 YALSSWRSA 379
           ++ S+W +A
Sbjct: 441 FSASAWEAA 449



>gb:AY464568_1607946 Oryza sativa GAI protein mRNA, complete cds.
          Length = 493

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 1/129 (0%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +N   F+ RF EALF++S++FD LD           + E     +E  +++  E A R E
Sbjct: 322 HNKTGFLDRFTEALFYYSAVFDSLDAASASGGAGNAMAE-AYLQREICDIVCGEGAARRE 380

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN-KDFVIDEDGEWLLQGWKGRIV 406
           R E   +W  R  RAG   +PL    ++ +R    +++ +   ++E    L  GW GR +
Sbjct: 381 RHEPLSRWRDRLTRAGLSAVPLGSNALRQARMLVGLFSGEGHSVEEADGCLTLGWHGRPL 440

Query: 405 YALSSWRSA 379
           ++ S+W +A
Sbjct: 441 FSASAWEAA 449



>pir|D96656|D96656 hypothetical protein F16M19.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_893978 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010795_1537090 Arabidopsis thaliana
           chromosome 1 BAC F16M19 genomic sequence, complete
           sequence.
          Length = 658

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 38/139 (27%), Positives = 72/139 (51%), Gaps = 14/139 (10%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVE 583
           +NS    TR   +L ++S++FD + TN+  +   R+ +E+ +FG+E +N++ACE + R E
Sbjct: 515 HNSEQLETRVCNSLKYYSAMFDAIHTNLATDSLMRVKVEEMLFGREIRNIVACEGSHRQE 574

Query: 582 RPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD----FVI---DED------- 445
           R   ++ W     + GF  L +++  +  S+   ++Y  D    F +   DED       
Sbjct: 575 RHVGFRHWRRMLEQLGFRSLGVSEREVLQSKMLLRMYGSDNEGFFNVERSDEDNGGEGGR 634

Query: 444 GEWLLQGWKGRIVYALSSW 388
           G  +   W  + +Y +S+W
Sbjct: 635 GGGVTLRWSEQPLYTISAW 653



>gb:AF460219_1801797 Hordeum vulgare subsp. vulgare nuclear
           transcription factor SLN1 gene, complete cds.
          Length = 618

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 16/145 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLD---TNVPRNIHER-----------ILIEKTIFGQE 625
           +NS  F+ RF E+L ++S++FD L+   +  P  +               ++ +   G++
Sbjct: 473 HNSGSFLDRFTESLHYYSTMFDSLEGGSSGGPSEVSSGGAAPAAAAGTDQVMSEVYLGRQ 532

Query: 624 AKNVIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVID 451
             NV+ACE  ER ER ET  QW  R   AGF  + L     K +     ++     + ++
Sbjct: 533 ICNVVACEGTERTERHETLGQWRNRLGNAGFETVHLGSNAYKQASTLLALFAGGDGYKVE 592

Query: 450 EDGEWLLQGWKGRIVYALSSWRSAS 376
           E    L  GW  R + A S+WR A+
Sbjct: 593 EKEGCLTLGWHTRPLIATSAWRLAA 617



>gb:AY062209_1565004 Oryza sativa chitin-inducible
           gibberellin-responsive protein (CIGR1) mRNA, complete
           cds.
          Length = 572

 Score = 59.3 bits (142), Expect = 9e-08
 Identities = 28/77 (36%), Positives = 42/77 (54%)
 Frame = -3

Query: 618 NVIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGE 439
           N+IACE  +RVER E   +W  R   AGF P PL+  +  + R     Y+  + +DE   
Sbjct: 495 NIIACEGKDRVERHELLGKWKSRLTMAGFRPYPLSSYVNSVIRKLLACYSDKYTLDEKDG 554

Query: 438 WLLQGWKGRIVYALSSW 388
            +L GW+ R + + S+W
Sbjct: 555 AMLLGWRSRKLISASAW 571



>gb:AC146936_1744640 Oryza sativa chromosome 3 B1154F06 genomic
           sequence, complete sequence.
          Length = 578

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 7/132 (5%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACET-AERVE 583
           N   F+ RF  AL ++ SLF+ LD  + R+  ER+ +E+ +FG+  +  +  E  A+R E
Sbjct: 450 NRAGFVDRFANALSYYRSLFESLDVAMTRDSPERVRVERWMFGERIQRAVGPEEGADRTE 509

Query: 582 RPETYKQWHVRNMRAGFLPLPLNK------EIMKMSRDRAKVYNKDFVIDEDGEWLLQGW 421
           R     +W       GF P+PL+       +++  + D    Y+   +++    +L   W
Sbjct: 510 RMAGSSEWQTLMEWCGFEPVPLSNYARSQADLLLWNYDSKYKYS---LVELPPAFLSLAW 566

Query: 420 KGRIVYALSSWR 385
           + R +  +S+WR
Sbjct: 567 EKRPLLTVSAWR 578



>gb:AY224426_1590628 Oryza sativa (japonica cultivar-group) isolate
           20145 scarecrow transcriptional regulator-like protein
           mRNA, complete cds.>gb:AP004178_1838558 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1123_G04.
          Length = 618

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/125 (29%), Positives = 59/125 (47%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+     RF +A  H+ ++ + LD  + R+  +R   E  +  + A N +  E  +RVER
Sbjct: 495 NTAPMAARFSDASAHYGAVLESLDATLGRDSADRTRAEAALASKVA-NAVGREGPDRVER 553

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYA 400
            E + +W  R   AGF  + + ++I    R R       F +  D   L  GW GR+V  
Sbjct: 554 CEVFGKWRARFGMAGFRAVAIGEDIGGRVRARLGPALPAFDVKLDNGRLGVGWMGRVVTV 613

Query: 399 LSSWR 385
            S+WR
Sbjct: 614 ASAWR 618



>gb:AP003985_1835945 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1047_C01.>gb:AP005437_1851729 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1113_E01.
          Length = 629

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 34/128 (26%), Positives = 63/128 (49%), Gaps = 7/128 (5%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+  F E L  FS+  D L+ + P+  +ER+ +E+   G+   ++++C  +E +ER ET 
Sbjct: 502 FLKVFGEGLRFFSAYMDSLEESFPKTSNERLALERGA-GRAIVDLVSCPASESMERRETA 560

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDE-------DGEWLLQGWKGRI 409
             W  R   AGF P+  ++++    R   + Y + + + E        G  +   WK + 
Sbjct: 561 ASWARRMRSAGFSPVAFSEDVADDVRSLLRRYREGWSMREAGTDDSAAGAGVFLAWKEQP 620

Query: 408 VYALSSWR 385
           +   S+WR
Sbjct: 621 LVWASAWR 628



>gb:AY062538_1565194 Arabidopsis thaliana SCARECROW gene regulator
           (At5g66770; MUD21.1) mRNA, complete
           cds.>gb:BT002580_1636183 Arabidopsis thaliana SCARECROW
           gene regulator (At5g66770) mRNA, complete cds.
          Length = 573

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 4/125 (3%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE-TAERVERPET 571
           F  R + AL  +S++F+ L+ N+ R+  ER+ +E+ +FG+    +I  E T    ER E 
Sbjct: 449 FANRVKNALQFYSAVFESLEPNLGRDSEERVRVERELFGRRISGLIGPEKTGIHRERMEE 508

Query: 570 YKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD---FVIDEDGEWLLQGWKGRIVYA 400
            +QW V    AGF  + L+   +  ++     YN      +++    ++   W    +  
Sbjct: 509 KEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSNLYSIVESKPGFISLAWNDLPLLT 568

Query: 399 LSSWR 385
           LSSWR
Sbjct: 569 LSSWR 573



>gb:AB010700_1511253 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUD21.
          Length = 584

 Score = 56.2 bits (134), Expect = 8e-07
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 4/125 (3%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE-TAERVERPET 571
           F  R + AL  +S++F+ L+ N+ R+  ER+ +E+ +FG+    +I  E T    ER E 
Sbjct: 460 FANRVKNALQFYSAVFESLEPNLGRDSEERVRVERELFGRRISGLIGPEKTGIHRERMEE 519

Query: 570 YKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD---FVIDEDGEWLLQGWKGRIVYA 400
            +QW V    AGF  + L+   +  ++     YN      +++    ++   W    +  
Sbjct: 520 KEQWRVLMENAGFESVKLSNYAVSQAKILLWNYNYSNLYSIVESKPGFISLAWNDLPLLT 579

Query: 399 LSSWR 385
           LSSWR
Sbjct: 580 LSSWR 584



>gb:AF413158_1797449 Zea mays cultivar NC320 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L H+S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHHYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413117_1797408 Zea mays cultivar CMV3 DWARF8 gene, partial
           cds.
          Length = 579

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 9/91 (9%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML---------DTNVPRNIHERILIEKTIFGQEAKNVI 610
           +NS  F+ RF E+L ++S++FD L         D +         ++ +   G++  NV+
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGSGQSADASPAAAGGTDQVMSEVYLGRQICNVV 544

Query: 609 ACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 ACEGAERTERHETLGQWRSRLGGSGFAPVHL 575



>gb:AF413114_1797405 Zea mays cultivar CM7 DWARF8 gene, partial cds.
          Length = 578

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 9/91 (9%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML---------DTNVPRNIHERILIEKTIFGQEAKNVI 610
           +NS  F+ RF E+L ++S++FD L         D +         ++ +   G++  NV+
Sbjct: 484 HNSGTFLDRFTESLHYYSTMFDSLEGAGSGQSADASPAAAGGTDQVMSEVYLGRQICNVV 543

Query: 609 ACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 544 ACEGAERTERHETLGQWRSRLGGSGFAPVHL 574



>gb:AF413112_1797403 Zea mays cultivar A619 DWARF8 gene, partial
           cds.>gb:AF413115_1797406 Zea mays cultivar CM174 DWARF8
           gene, partial cds.>gb:AF413116_1797407 Zea mays cultivar
           F7 DWARF8 gene, partial cds.>gb:AF413118_1797409 Zea
           mays cultivar F2834T DWARF8 gene, partial
           cds.>gb:AF413119_1797410 Zea mays cultivar P39 DWARF8
           gene, partial cds.>gb:AF413120_1797411 Zea mays cultivar
           OH43 DWARF8 gene, partial cds.>gb:AF413121_1797412 Zea
           mays cultivar CM105 DWARF8 gene, partial
           cds.>gb:AF413202_1797493 Zea mays cultivar N192 DWARF8
           gene, partial cds.
          Length = 579

 Score = 53.9 bits (128), Expect = 4e-06
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 9/91 (9%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML---------DTNVPRNIHERILIEKTIFGQEAKNVI 610
           +NS  F+ RF E+L ++S++FD L         D +         ++ +   G++  NV+
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGSGQSADASPAAAGGTDQVMSEVYLGRQICNVV 544

Query: 609 ACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 ACEGAERTERHETLGQWRSRLGGSGFAPVHL 575



>gb:AF413186_1797477 Zea mays cultivar M37W DWARF8 gene, partial
           cds.>gb:AF413187_1797478 Zea mays cultivar Tzi10 DWARF8
           gene, partial cds.
          Length = 581

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 11/94 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPLN 514
           V+ACE AER ER ET  QW  R   +GF P+ L+
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHLS 578



>gb:AF413141_1797432 Zea mays cultivar NC260 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 11/94 (11%)
 Frame = -3

Query: 765 AYNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAK 619
           ++NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  
Sbjct: 484 SHNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQIC 543

Query: 618 NVIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           NV+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 544 NVVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413192_1797483 Zea mays cultivar EP1 DWARF8 gene, partial cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413189_1797480 Zea mays cultivar B103 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413176_1797467 Zea mays cultivar MO24W DWARF8 gene, partial
           cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413171_1797462 Zea mays cultivar GT112 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413138_1797429 Zea mays cultivar Q6199 DWARF8 gene, partial
           cds.>gb:AF413139_1797430 Zea mays cultivar NC354 DWARF8
           gene, partial cds.>gb:AF413140_1797431 Zea mays cultivar
           CML258 DWARF8 gene, partial cds.>gb:AF413159_1797450 Zea
           mays cultivar CML5 DWARF8 gene, partial cds.
          Length = 582

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 486 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 545

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 546 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 578



>gb:AF413135_1797426 Zea mays cultivar H99 DWARF8 gene, partial cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413129_1797420 Zea mays cultivar WF9 DWARF8 gene, partial
           cds.>gb:AF413130_1797421 Zea mays cultivar U267Y DWARF8
           gene, partial cds.>gb:AF413133_1797424 Zea mays cultivar
           PA91 DWARF8 gene, partial cds.>gb:AF413134_1797425 Zea
           mays cultivar W64A DWARF8 gene, partial cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AF413113_1797404 Zea mays cultivar I29 DWARF8 gene, partial
           cds.>gb:AF413122_1797413 Zea mays cultivar OH7B DWARF8
           gene, partial cds.>gb:AF413123_1797414 Zea mays cultivar
           C103 DWARF8 gene, partial cds.>gb:AF413124_1797415 Zea
           mays cultivar W182B DWARF8 gene, partial
           cds.>gb:AF413125_1797416 Zea mays cultivar 38-11 DWARF8
           gene, partial cds.>gb:AF413126_1797417 Zea mays cultivar
           Mo17 DWARF8 gene, partial cds.>gb:AF413127_1797418 Zea
           mays cultivar M162W DWARF8 gene, partial
           cds.>gb:AF413131_1797422 Zea mays cultivar TX601 DWARF8
           gene, partial cds.>gb:AF413132_1797423 Zea mays cultivar
           SC213 DWARF8 gene, partial cds.>gb:AF413136_1797427 Zea
           mays cultivar KUI21 DWARF8 gene, partial
           cds.>gb:AF413137_1797428 Zea mays cultivar I137TN DWARF8
           gene, partial cds.>gb:AF413142_1797433 Zea mays cultivar
           MS153 DWARF8 gene, partial cds.>gb:AF413143_1797434 Zea
           mays cultivar ND246 DWARF8 gene, partial
           cds.>gb:AF413144_1797435 Zea mays cultivar NC304 DWARF8
           gene, partial cds.>gb:AF413146_1797437 Zea mays cultivar
           NC352 DWARF8 gene, partial cds.>gb:AF413147_1797438 Zea
           mays cultivar NC350 DWARF8 gene, partial
           cds.>gb:AF413148_1797439 Zea mays cultivar SG18 DWARF8
           gene, partial cds.>gb:AF413149_1797440 Zea mays cultivar
           W117HT DWARF8 gene, partial cds.>gb:AF413150_1797441 Zea
           mays cultivar T232 DWARF8 gene, partial
           cds.>gb:AF413151_1797442 Zea mays cultivar SA24 DWARF8
           gene, partial cds.>gb:AF413152_1797443 Zea mays cultivar
           KUI3 DWARF8 gene, partial cds.>gb:AF413153_1797444 Zea
           mays cultivar B68 DWARF8 gene, partial
           cds.>gb:AF413154_1797445 Zea mays cultivar B104 DWARF8
           gene, partial cds.>gb:AF413155_1797446 Zea mays cultivar
           A632 DWARF8 gene, partial cds.>gb:AF413156_1797447 Zea
           mays cultivar NC348 DWARF8 gene, partial
           cds.>gb:AF413157_1797448 Zea mays cultivar Tzi18 DWARF8
           gene, partial cds.>gb:AF413160_1797451 Zea mays cultivar
           A272 DWARF8 gene, partial cds.>gb:AF413161_1797452 Zea
           mays cultivar B37 DWARF8 gene, partial
           cds.>gb:AF413162_1797453 Zea mays cultivar B73 DWARF8
           gene, partial cds.>gb:AF413163_1797454 Zea mays cultivar
           CML281 DWARF8 gene, partial cds.>gb:AF413164_1797455 Zea
           mays cultivar B84 DWARF8 gene, partial
           cds.>gb:AF413165_1797456 Zea mays cultivar CML277 DWARF8
           gene, partial cds.>gb:AF413166_1797457 Zea mays cultivar
           KUI2007 DWARF8 gene, partial cds.>gb:AF413167_1797458
           Zea mays cultivar CML333 DWARF8 gene, partial
           cds.>gb:AF413169_1797460 Zea mays cultivar N28HT DWARF8
           gene, partial cds.>gb:AF413170_1797461 Zea mays cultivar
           K55 DWARF8 gene, partial cds.>gb:AF413172_1797463 Zea
           mays cultivar F44 DWARF8 gene, partial
           cds.>gb:AF413173_1797464 Zea mays cultivar A441 DWARF8
           gene, partial cds.>gb:AF413174_1797465 Zea mays cultivar
           CML10 DWARF8 gene, partial cds.>gb:AF413175_1797466 Zea
           mays cultivar CML261 DWARF8 gene, partial
           cds.>gb:AF413177_1797468 Zea mays cultivar SC55 DWARF8
           gene, partial cds.>gb:AF413178_1797469 Zea mays cultivar
           NC298 DWARF8 gene, partial cds.>gb:AF413179_1797470 Zea
           mays cultivar IL677A DWARF8 gene, partial
           cds.>gb:AF413180_1797471 Zea mays cultivar TZI8 DWARF8
           gene, partial cds.>gb:AF413181_1797472 Zea mays cultivar
           IA2132 DWARF8 gene, partial cds.>gb:AF413182_1797473 Zea
           mays cultivar D940Y DWARF8 gene, partial
           cds.>gb:AF413183_1797474 Zea mays cultivar W153R DWARF8
           gene, partial cds.>gb:AF413184_1797475 Zea mays cultivar
           B97 DWARF8 gene, partial cds.>gb:AF413185_1797476 Zea
           mays cultivar NC300 DWARF8 gene, partial
           cds.>gb:AF413188_1797479 Zea mays cultivar KUI11 DWARF8
           gene, partial cds.>gb:AF413190_1797481 Zea mays cultivar
           CML254 DWARF8 gene, partial cds.>gb:AF413191_1797482 Zea
           mays cultivar CML247 DWARF8 gene, partial
           cds.>gb:AF413193_1797484 Zea mays cultivar CI187 DWARF8
           gene, partial cds.>gb:AF413194_1797485 Zea mays cultivar
           NC338 DWARF8 gene, partial cds.>gb:AF413195_1797486 Zea
           mays cultivar NC296 DWARF8 gene, partial
           cds.>gb:AF413196_1797487 Zea mays cultivar KUI44 DWARF8
           gene, partial cds.>gb:AF413197_1797488 Zea mays cultivar
           CML287 DWARF8 gene, partial cds.>gb:AF413198_1797489 Zea
           mays cultivar B14A DWARF8 gene, partial
           cds.>gb:AF413199_1797490 Zea mays cultivar IDS28 DWARF8
           gene, partial cds.>gb:AF413200_1797491 Zea mays cultivar
           Ky21 DWARF8 gene, partial cds.>gb:AF413201_1797492 Zea
           mays cultivar A6 DWARF8 gene, partial
           cds.>gb:AF413203_1797494 Zea mays cultivar A554 DWARF8
           gene, partial cds.
          Length = 581

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AJ870306_1815094 Cucumis sativus mRNA for SCARECROW (scr
            gene).>gb:AJ870307_1815095 Cucumis sativus scr gene for
            SCARECROW, exons 1-2.
          Length = 858

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 32/122 (26%), Positives = 59/122 (48%), Gaps = 1/122 (0%)
 Frame = -3

Query: 747  FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
            F+ RF EA+ ++S+LFD L  +      ER L+E+ +  +E +NV+A     R    + +
Sbjct: 715  FLGRFVEAIHYYSALFDSLGVSYGEESEERHLVEQQLLSREIRNVLAVGGPSRSGEVK-F 773

Query: 567  KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIVYALSS 391
            + W  +  ++GF  + L       +     ++  D + + ED   L  GWK   +   S+
Sbjct: 774  QNWREKLQQSGFKGISLAGNAATQATLLLGMFPSDGYTLVEDNGTLKLGWKDLCLLTASA 833

Query: 390  WR 385
            W+
Sbjct: 834  WK 835



>gb:AC133861_1741586 Oryza sativa chromosome 3 BAC OSJNBb0031F05
           genomic sequence, complete sequence.
          Length = 603

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 32/132 (24%), Positives = 61/132 (46%), Gaps = 11/132 (8%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+  F E L  FS+  D L+ + P+  +ER+ +E+ + G+   ++++C  ++  ER ET 
Sbjct: 472 FVKVFGEGLRFFSAYMDSLEESFPKTSNERLSLERAV-GRAIVDLVSCPASQSAERRETA 530

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDG-----------EWLLQGW 421
             W  R   AGF P   ++++    R   + Y + + + + G                 W
Sbjct: 531 ASWARRMRSAGFSPAAFSEDVADDVRSLLRRYKEGWSMRDAGGATDDAAGAAAAGAFLAW 590

Query: 420 KGRIVYALSSWR 385
           K + V   S+W+
Sbjct: 591 KEQPVVWASAWK 602



>gb:AC098832_1736897 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1268_B08, complete sequence.
          Length = 500

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 35/133 (26%), Positives = 65/133 (48%), Gaps = 4/133 (3%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERI---LIEKTIFGQEAKNVIACETAE 592
           +N    + RF  +LF+++S+FD L+        +     L E  + G+ A ++++ E + 
Sbjct: 326 HNKSSLLERFTNSLFYYASMFDSLEAISRHGGGDGAGNPLAEAYLQGEIA-DIVSREGSS 384

Query: 591 RVERPETYKQWHVRNMRAGFLPLPLNKE-IMKMSRDRAKVYNKDFVIDEDGEWLLQGWKG 415
           RVER E   +W  R  R G   LPL    + + +    +     F + E+G +L   W  
Sbjct: 385 RVERHEQMPRWVERLRRGGMTQLPLGATGLWQAAMQLREFSGAGFGVQENGGFLTLTWHS 444

Query: 414 RIVYALSSWRSAS 376
           + +Y+ S+WR+ +
Sbjct: 445 QRLYSASAWRATA 457



>gb:AY074547_1567587 Arabidopsis thaliana putative SHORT-ROOT (SHR)
           protein (At4g37650) mRNA, partial cds.
          Length = 478

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 3/124 (2%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+  F E L  F   F+  + + PR  +ER+++E+   G+   +++ACE ++  ER ET 
Sbjct: 354 FLRGFGECLRWFRVCFESWEESFPRTSNERLMLERAA-GRAIVDLVACEPSDSTERRETA 412

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNK---DFVIDEDGEWLLQGWKGRIVYAL 397
           ++W  R   +GF  +  + E+    R   + Y +     V   D   +   W+ + V   
Sbjct: 413 RKWSRRMRNSGFGAVGYSDEVADDVRALLRRYKEGVWSMVQCPDAAGIFLCWRDQPVVWA 472

Query: 396 SSWR 385
           S+WR
Sbjct: 473 SAWR 476



>pir|T04722|T04722 hypothetical protein F19F18.140 - Arabidopsis
           thaliana>gb:ATCHRIV87_1547719 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           87.>gb:ATF19F18_1549305 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19F18 (ESSA
           project).>gb:AF233752_1779477 Arabidopsis thaliana
           short-root protein (shr) gene, complete cds.
          Length = 531

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 33/124 (26%), Positives = 60/124 (48%), Gaps = 3/124 (2%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+  F E L  F   F+  + + PR  +ER+++E+   G+   +++ACE ++  ER ET 
Sbjct: 407 FLRGFGECLRWFRVCFESWEESFPRTSNERLMLERAA-GRAIVDLVACEPSDSTERRETA 465

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNK---DFVIDEDGEWLLQGWKGRIVYAL 397
           ++W  R   +GF  +  + E+    R   + Y +     V   D   +   W+ + V   
Sbjct: 466 RKWSRRMRNSGFGAVGYSDEVADDVRALLRRYKEGVWSMVQCPDAAGIFLCWRDQPVVWA 525

Query: 396 SSWR 385
           S+WR
Sbjct: 526 SAWR 529



>gb:AF413145_1797436 Zea mays cultivar F2 DWARF8 gene, partial cds.
          Length = 581

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/93 (34%), Positives = 49/93 (52%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLD----------TNVPRNIHERILIEKTIF-GQEAKN 616
           +NS  F+ RF E+L ++S++FD L+             P        ++  ++ G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVKSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AP003866_1834548 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1092_A07.
          Length = 306

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 37/124 (29%), Positives = 57/124 (45%), Gaps = 4/124 (3%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTN---VPRNIHERILIEKTIFGQEAKNVIACETAERVERP 577
           F+ RF EAL ++S+LFD L            ER  +E+ + G E +N++A    +R    
Sbjct: 160 FLGRFVEALHYYSALFDALGDGAGAAEEEAAERHAVERQLLGAEIRNIVAVGGPKRTGEV 219

Query: 576 ETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN-KDFVIDEDGEWLLQGWKGRIVYA 400
              ++W     RAGF P+ L       +R    +Y  K + + E+   L  GWK   +  
Sbjct: 220 RV-ERWGDELRRAGFRPVTLAGSPAAQARLLLGMYPWKGYTLVEEDGCLKLGWKDLSLLT 278

Query: 399 LSSW 388
            SSW
Sbjct: 279 ASSW 282



>gb:AF263457_1781688 Zea mays SCARECROW (SCR) gene, complete cds.
          Length = 668

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           +S  F+ RF EA+ ++S+LFD LD +   +  ER ++E+ +  +E +NV+A     R   
Sbjct: 536 HSGSFLARFVEAIHYYSALFDSLDASYGEDSPERHVVEQQLLSREIRNVLAVGGPARTGD 595

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIVY 403
            + +  W  +  ++GF    L       +     ++  D + + E+   L  GWK   + 
Sbjct: 596 VK-FGSWREKLAQSGFRAASLAGSAAAQASLLLGMFPSDGYTLVEENGALKLGWKDLCLL 654

Query: 402 ALSSWR 385
             S+WR
Sbjct: 655 TASAWR 660



>gb:AC105767_1738174 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1126_B11, complete
           sequence.>gb:AC136218_1743033 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0039A21,
           complete sequence.
          Length = 560

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 38/131 (29%), Positives = 60/131 (45%), Gaps = 8/131 (6%)
 Frame = -3

Query: 753 PFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE-TAERVERP 577
           P F  RF  AL ++  LF  ++      + ER   E+ +  +E K+VIAC+    R  R 
Sbjct: 429 PSFTDRFASALPYYEQLFAAMEEAGAATV-ERKAAERYLLREEIKDVIACDHDGPRWARH 487

Query: 576 ETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN-------KDFVIDEDGEWLLQGWK 418
           ET  +W VR   AGF   P    +    R RA           + + + E G WL+   +
Sbjct: 488 ETLGRWVVRMGAAGFALAPAITVVTAAGRVRAVAARLPGGGDERRYGVTEGGGWLILNRE 547

Query: 417 GRIVYALSSWR 385
            + ++ +S+WR
Sbjct: 548 EKPMFCVSAWR 558



>gb:AF413128_1797419 Zea mays cultivar KUI43 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 31/93 (33%), Positives = 48/93 (51%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           ++S  F+ RF E+L ++S++FD L           D +         ++ +   G++  N
Sbjct: 485 HDSGTFLDRFTESLHYYSTMFDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>gb:AY367051_1602916 Zea mays scarecrow-like 23 (scl23) mRNA,
           partial cds.
          Length = 313

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 36/127 (28%), Positives = 57/127 (44%), Gaps = 4/127 (3%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTN---VPRNIHERILIEKTIFGQEAKNVIACETAERVERP 577
           F+ RF EAL ++S+LFD L            ER  +E+ + G E +N++A    +R    
Sbjct: 178 FLGRFVEALHYYSALFDALGDGAGAAEEESAERYAVERQLLGAEIRNIVAVGGPKRTGEV 237

Query: 576 ETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYN-KDFVIDEDGEWLLQGWKGRIVYA 400
              ++W      AGF P+ L       +R    +Y  K + + E+   L  GWK   +  
Sbjct: 238 RV-ERWSHELRHAGFRPVSLAGSPAAQARLLLGMYPWKGYTLVEEDACLKLGWKDLSLLT 296

Query: 399 LSSWRSA 379
            S+W  A
Sbjct: 297 ASAWEPA 303



>gb:AB048713_1520745 Pisum sativum PsSCR mRNA for SCARECROW, complete
            cds.
          Length = 819

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 33/126 (26%), Positives = 60/126 (47%), Gaps = 1/126 (0%)
 Frame = -3

Query: 759  NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
            N+  F+ RF EA+ ++S+LFD L ++      ER ++E+ +  +E +NV+A     R   
Sbjct: 682  NAGSFLGRFVEAIHYYSALFDSLGSSYGEESEERHVVEQQLLSREIRNVLAVGGPSRSGE 741

Query: 579  PETYKQWHVRNMRAGFLPLPL-NKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVY 403
             + +  W  +  + GF  + L      + S       ++ + + ED   L  GWK   + 
Sbjct: 742  IK-FHNWREKLQQCGFRGVSLAGNAATQASLLLGMFPSEGYTLVEDNGILKLGWKDLCLL 800

Query: 402  ALSSWR 385
              S+WR
Sbjct: 801  TASAWR 806



>gb:AB017067_1513401 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJC20.
          Length = 405

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 36/124 (29%), Positives = 57/124 (45%), Gaps = 2/124 (1%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+ RF EAL ++S+LFD L   +     ER  +E+ + G E +N++A     R       
Sbjct: 284 FLGRFVEALHYYSALFDALGDGLGEESGERFTVEQIVLGTEIRNIVAHGGGRRKR----- 338

Query: 567 KQWHVRNMRAGFLPLPL--NKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYALS 394
            +W     R GF P+ L  N             +N   +++E+G  L  GWK   +   S
Sbjct: 339 MKWKEELSRVGFRPVSLRGNPATQAGLLLGMLPWNGYTLVEENGT-LRLGWKDLSLLTAS 397

Query: 393 SWRS 382
           +W+S
Sbjct: 398 AWKS 401



>gb:ATCHRIV46_1545525 Arabidopsis thaliana DNA chromosome 4, contig
           fragment No. 46.
          Length = 287

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 24/62 (38%), Positives = 41/62 (66%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F++RF E L +++++F+ +D   PR+  +RI  E+    ++  N+IACE +ERVER
Sbjct: 218 NTSPFLSRFVETLDYYTAMFESIDAARPRDDKQRISAEQHCVARDIVNMIACEESERVER 277

Query: 579 PE 574
            E
Sbjct: 278 HE 279



>gb:AB180961_1528999 Oryza sativa (japonica cultivar-group) OsSCR
           mRNA for SCARECROW, complete cds.
          Length = 660

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 1/126 (0%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           +S  F+ RF EA+ ++S+LFD LD +   +  ER ++E+ +  +E +NV+A     R   
Sbjct: 529 HSGSFLARFVEAIHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGD 588

Query: 579 PETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIVY 403
            + +  W  +  ++GF    L       +     ++  D + + E+   L  GWK   + 
Sbjct: 589 VK-FGSWREKLAQSGFRVSSLAGSAAAQAVLLLGMFPSDGYTLIEENGALKLGWKDLCLL 647

Query: 402 ALSSWR 385
             S+WR
Sbjct: 648 TASAWR 653



>pir|C71441|C71441 probable SCARECROW - Arabidopsis
           thaliana>gb:ATFCA8_1551773 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No. 8.
          Length = 375

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 24/62 (38%), Positives = 41/62 (66%)
 Frame = -3

Query: 759 NSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVER 580
           N+  F++RF E L +++++F+ +D   PR+  +RI  E+    ++  N+IACE +ERVER
Sbjct: 306 NTSPFLSRFVETLDYYTAMFESIDAARPRDDKQRISAEQHCVARDIVNMIACEESERVER 365

Query: 579 PE 574
            E
Sbjct: 366 HE 367



>gb:AF413168_1797459 Zea mays cultivar NC250 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 11/93 (11%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDML-----------DTNVPRNIHERILIEKTIFGQEAKN 616
           +NS  F+ RF E+L ++S++ D L           D +         ++ +   G++  N
Sbjct: 485 HNSGTFLDRFTESLHYYSTMSDSLEGAGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICN 544

Query: 615 VIACETAERVERPETYKQWHVRNMRAGFLPLPL 517
           V+ACE AER ER ET  QW  R   +GF P+ L
Sbjct: 545 VVACEGAERTERHETLGQWRSRLGGSGFAPVHL 577



>pir|T51244|T51244 SCARECROW protein [imported] - Arabidopsis
           thaliana>gb:ATU62798_1557135 Arabidopsis thaliana
           SCARECROW (SCARECROW1) gene, complete cds.
          Length = 653

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+ RF EA+ ++S+LFD L  +      ER ++E+ +  +E +NV+A     R    + +
Sbjct: 530 FLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVK-F 588

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIVYALSS 391
           + W  +  + GF  + L       +     ++  D + + +D   L  GWK   +   S+
Sbjct: 589 ESWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKLGWKDLSLLTASA 648

Query: 390 WRSAS 376
           W   S
Sbjct: 649 WTPRS 653



>pir|T47581|T47581 SCARECROW1 - Arabidopsis
           thaliana>gb:ATF24B22_1549831 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24B22.>gb:AY056315_1563626
           Arabidopsis thaliana putative SCARECROW1 protein
           (At3g54220) mRNA, complete cds.>gb:AY080840_1568533
           Arabidopsis thaliana putative SCARECROW1 protein
           (At3g54220) mRNA, complete cds.>gb:AY113991_1578402
           Arabidopsis thaliana putative SCARECROW1 protein
           (At3g54220) mRNA, complete cds.
          Length = 653

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 1/125 (0%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+ RF EA+ ++S+LFD L  +      ER ++E+ +  +E +NV+A     R    + +
Sbjct: 530 FLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVK-F 588

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKD-FVIDEDGEWLLQGWKGRIVYALSS 391
           + W  +  + GF  + L       +     ++  D + + +D   L  GWK   +   S+
Sbjct: 589 ESWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKLGWKDLSLLTASA 648

Query: 390 WRSAS 376
           W   S
Sbjct: 649 WTPRS 653



>gb:AJ832139_1814394 Pisum sativum sym7 gene for GRAS family
           protein.
          Length = 503

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 3/127 (2%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+ RF ++L H+S++FD L+   P     R L+E+  FG      +        +  E  
Sbjct: 373 FVERFMDSLHHYSAVFDSLEAGFPMQNRARALVERVFFGPRIAGSLGRIYRTGGDGEEER 432

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDG---EWLLQGWKGRIVYAL 397
           + W      AGF  +P++      ++    ++N  + ++E G     L+  WK R + + 
Sbjct: 433 RSWGEWLGAAGFRGVPVSFANHCQAKLLLGLFNDGYRVEEVGLGSNKLVLDWKSRRLLSA 492

Query: 396 SSWRSAS 376
           S W  +S
Sbjct: 493 SVWTCSS 499



>pir|T46142|T46142 scarecrow-like 7 (SCL7) - Arabidopsis
           thaliana>gb:ATT3A5_1555933 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T3A5.
          Length = 542

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 31/132 (23%), Positives = 67/132 (50%), Gaps = 11/132 (8%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACE-----TAERVE 583
           F  R + +L  +S++F+ L+ N+ R+  ER+ +E+ +FG+   +++  +        R  
Sbjct: 414 FANRVKNSLRFYSAVFESLEPNLDRDSKERLRVERVLFGRRIMDLVRSDDDNNKPGTRFG 473

Query: 582 RPETYKQWHVRNMRAGFLPL-PLNKEIMKMSRDRAKVYNKDF-----VIDEDGEWLLQGW 421
             E  +QW V   +AGF P+ P N  +   S+ +  ++N ++     +++ +  ++   W
Sbjct: 474 LMEEKEQWRVLMEKAGFEPVKPSNYAV---SQAKLLLWNYNYSTLYSLVESEPGFISLAW 530

Query: 420 KGRIVYALSSWR 385
               +  +SSWR
Sbjct: 531 NNVPLLTVSSWR 542



>pir|T10552|T10552 hypothetical protein T12G13.90 - Arabidopsis
           thaliana>gb:ATCHRIV22_1544541 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           22.>gb:ATT12G13_1554340 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12G13, partial sequence (ESSA
           project).
          Length = 483

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 37/132 (28%), Positives = 61/132 (46%), Gaps = 3/132 (2%)
 Frame = -3

Query: 768 GAYNSPFFITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAE- 592
           G   +  F+ RF + L  FS++FD L+  +      R  +E+   G    N +   TA  
Sbjct: 350 GLMGNQGFLYRFMDLLHQFSAIFDSLEAGLSIANPARGFVERVFIGPWVANWLTRITAND 409

Query: 591 -RVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGE-WLLQGWK 418
             VE   ++ QW   N   GF PL ++      ++    ++N  F ++E G+  L+ GWK
Sbjct: 410 AEVESFASWPQWLETN---GFKPLEVSFTNRCQAKLLLSLFNDGFRVEELGQNGLVLGWK 466

Query: 417 GRIVYALSSWRS 382
            R + + S W S
Sbjct: 467 SRRLVSASFWAS 478



>gb:AC120987_1740028 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0007A06, complete
           sequence.>gb:AC136218_1743030 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0039A21,
           complete sequence.
          Length = 551

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 4/76 (5%)
 Frame = -3

Query: 738 RFREALFHFSSLFDMLDTNV--PRNI--HERILIEKTIFGQEAKNVIACETAERVERPET 571
           R   AL ++++LFD L+ +   P  +  HER  +E+ + G+E K+++  E   R ER ET
Sbjct: 376 RVWNALNYYAALFDALEASSTPPAAVPPHERACVERWVLGEEIKDIVVREGTGRRERHET 435

Query: 570 YKQWHVRNMRAGFLPL 523
             +W  R + AGF P+
Sbjct: 436 LGRWAERMVAAGFSPV 451



>gb:AP003750_1832856 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1174_G05.>gb:AP005149_1848341 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0005G07.
          Length = 472

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 33/119 (27%), Positives = 53/119 (44%)
 Frame = -3

Query: 744 ITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYK 565
           + R R A       +D +DT +P+   +R   E  + G + +NV+A E  ERVER E   
Sbjct: 352 VGRLRAAFNFLWIPYDAVDTFLPKGSEQRRWYEAEV-GWKVENVLAQEGVERVERQEDRT 410

Query: 564 QWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYALSSW 388
           +W  R   AGF      +E     +     +   + +  + + L+  WKG  V   S+W
Sbjct: 411 RWGQRMRAAGFRAAAFGEEAAGEVKAMLNDHAAGWGMKREDDDLVLTWKGHNVVFASAW 469



>gb:AJ832138_1814393 Medicago truncatula nsp2 gene for GRAS family
           protein.
          Length = 508

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 3/127 (2%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETY 568
           F+ RF ++L H+S++FD L+   P     R L+E+  FG      +      R    E  
Sbjct: 379 FVERFMDSLHHYSAVFDSLEAGFPMQNRARTLVERVFFGPRIAGSLG--RIYRTGGEEER 436

Query: 567 KQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDG---EWLLQGWKGRIVYAL 397
           + W       GF  +P++      ++    ++N  + ++E G     L+  WK R + + 
Sbjct: 437 RSWGEWLGEVGFRGVPVSFANHCQAKLLLGLFNDGYRVEEVGVGSNKLVLDWKSRRLLSA 496

Query: 396 SSWRSAS 376
           S W  +S
Sbjct: 497 SLWTCSS 503



>gb:AP003616_1831461 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0490F09.
          Length = 507

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 28/119 (23%), Positives = 62/119 (52%), Gaps = 2/119 (1%)
 Frame = -3

Query: 726 ALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYKQWHVRN 547
           A+ H+S++F+ L+  VP    ER+ +E+ + G+E +  +   +  R  R    ++W    
Sbjct: 391 AMDHYSAVFEALEATVPPGSRERLAVEQEVLGREIEAAVG-PSGGRWWR--GIERWGGAA 447

Query: 546 MRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRIVYALSSWRSAS 376
             AGF   PL+   +  +R   +++  ++ +++ E       GW+ R + ++S+W+ +S
Sbjct: 448 RAAGFAARPLSAFAVSQARLLLRLHYPSEGYLVQEARGACFLGWQTRPLLSVSAWQPSS 506



>sp|Q84MM9|MOC_ORYSA Protein MONOCULM 1.>gb:AY242058_1592361 Oryza
           sativa (japonica cultivar-group) MONOCULM 1 (MOC1) gene,
           complete cds.
          Length = 441

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 28/119 (23%), Positives = 62/119 (52%), Gaps = 2/119 (1%)
 Frame = -3

Query: 726 ALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYKQWHVRN 547
           A+ H+S++F+ L+  VP    ER+ +E+ + G+E +  +   +  R  R    ++W    
Sbjct: 325 AMDHYSAVFEALEATVPPGSRERLAVEQEVLGREIEAAVG-PSGGRWWR--GIERWGGAA 381

Query: 546 MRAGFLPLPLNKEIMKMSRDRAKVY--NKDFVIDEDGEWLLQGWKGRIVYALSSWRSAS 376
             AGF   PL+   +  +R   +++  ++ +++ E       GW+ R + ++S+W+ +S
Sbjct: 382 RAAGFAARPLSAFAVSQARLLLRLHYPSEGYLVQEARGACFLGWQTRPLLSVSAWQPSS 440



>gb:AC093952_1736166 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1004_E02, complete
           sequence.>gb:AC118289_1739560 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0099O15,
           complete sequence.
          Length = 493

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 37/123 (30%), Positives = 51/123 (41%), Gaps = 3/123 (2%)
 Frame = -3

Query: 747 FITRFREALFHFSSLFDMLDTNVPRNIH-ERILIEKTIFGQEAKNVIACETAERVERPET 571
           F+ RF  AL H+S++FD +  + P      R L E  + G+E  NV+A     R    E 
Sbjct: 362 FLDRFVSALHHYSAVFDAMGASRPDGEDASRHLAEHGVLGREIANVLAVGGPARSSGREG 421

Query: 570 YKQWHVRNMRAGFLPLPLNKEIMKMSRDRAKVYNKDFVI--DEDGEWLLQGWKGRIVYAL 397
              W     R GF                A      + +  D DG   L GWKG  +YA+
Sbjct: 422 PGSWREVLARHGFAHAGGGGGGRAQLVAAACPGGLGYTVAGDHDGTVRL-GWKGTPLYAV 480

Query: 396 SSW 388
           S+W
Sbjct: 481 SAW 483



>gb:AF067400_1765608 Zea mays Scl1 protein (Scl1) mRNA, partial cds.
          Length = 313

 Score = 40.8 bits (94), Expect = 0.033
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 8/133 (6%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDT----NVPRNIHERILIEKTIFGQEAKNVIACETA 595
           +N P  + RF  ALFH++++FD L+        R+I +  L E  + G E  +++  E +
Sbjct: 150 HNRPPLLERFTNALFHYATMFDSLEAMHRCTSGRDITDS-LTEVYLRG-EIFDIVCGEGS 207

Query: 594 ERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDR----AKVYNKDFVIDEDGEWLLQ 427
            R ER E +  W  R   AG   +  + + +   +D+      +    F I      L  
Sbjct: 208 ARTERHELFGHWRERLTYAGLTQVWFDPDEVDTLKDQLIHVTSLSGSGFNILVCDGSLAL 267

Query: 426 GWKGRIVYALSSW 388
            W  R +Y  ++W
Sbjct: 268 AWHNRPLYVATAW 280



>pir|T51242|T51242 Scl1 protein [imported] - maize (fragment)
          Length = 313

 Score = 40.8 bits (94), Expect = 0.033
 Identities = 34/133 (25%), Positives = 59/133 (44%), Gaps = 8/133 (6%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLDT----NVPRNIHERILIEKTIFGQEAKNVIACETA 595
           +N P  + RF  ALFH++++FD L+        R+I +  L E  + G E  +++  E +
Sbjct: 150 HNRPPLLERFTNALFHYATMFDSLEAMHRCTSGRDITDS-LTEVYLRG-EIFDIVCGEGS 207

Query: 594 ERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRDR----AKVYNKDFVIDEDGEWLLQ 427
            R ER E +  W  R   AG   +  + + +   +D+      +    F I      L  
Sbjct: 208 ARTERHELFGHWRERLTYAGLTQVWFDPDEVDTLKDQLIHVTSLSGSGFNILVCDGSLAL 267

Query: 426 GWKGRIVYALSSW 388
            W  R +Y  ++W
Sbjct: 268 AWHNRPLYVATAW 280



>pir|T45848|T45848 hypothetical protein F3A4.30 - Arabidopsis
           thaliana>gb:ATF3A4_1550549 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F3A4.>gb:BT012553_1641623
           Arabidopsis thaliana At3g49950 gene, complete cds.
          Length = 410

 Score = 40.8 bits (94), Expect = 0.033
 Identities = 36/123 (29%), Positives = 57/123 (46%), Gaps = 4/123 (3%)
 Frame = -3

Query: 744 ITRFREALFHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYK 565
           + R + A  +F   FD  DT +     +R   E  I   + +NV+A E AERVER ET +
Sbjct: 291 VNRLKSAFNYFWIPFDTTDTFMSE---QRRWYEAEI-SWKIENVVAKEGAERVERTETKR 346

Query: 564 QWHVRNMRAGFLPLPLNK----EIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYAL 397
           +W  R   A F  + + +    ++  M  + A  +      ++D E L+  WKG  V   
Sbjct: 347 RWIERMREAEFGGVRVKEDAVADVKAMLEEHAVGWG--MKKEDDDESLVLTWKGHSVVFA 404

Query: 396 SSW 388
           + W
Sbjct: 405 TVW 407



>gb:AF036304_1762940 Arabidopsis thaliana scarecrow-like 7 (SCL7)
           mRNA, partial cds.
          Length = 112

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 26/114 (22%), Positives = 56/114 (49%), Gaps = 11/114 (9%)
 Frame = -3

Query: 693 LDTNVPRNIHERILIEKTIFGQEAKNVIACE-----TAERVERPETYKQWHVRNMRAGFL 529
           L+ N+ R+  ER+ +E+ +FG+   +++  +        R    E  +QW V   +AGF 
Sbjct: 2   LEPNLDRDSKERLRVERVLFGRRIMDLVRSDDDNNKPGTRFGLMEEKEQWRVLMEKAGFE 61

Query: 528 PL-PLNKEIMKMSRDRAKVYNKDF-----VIDEDGEWLLQGWKGRIVYALSSWR 385
           P+ P N  +   S+ +  ++N ++     +++ +  ++   W    +  +SSWR
Sbjct: 62  PVKPSNYAV---SQAKLLLWNYNYSTLYSLVESEPGFISLAWNNVPLLTVSSWR 112



>pir|T51238|T51238 scarecrow-like protein 7 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 112

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 26/114 (22%), Positives = 56/114 (49%), Gaps = 11/114 (9%)
 Frame = -3

Query: 693 LDTNVPRNIHERILIEKTIFGQEAKNVIACE-----TAERVERPETYKQWHVRNMRAGFL 529
           L+ N+ R+  ER+ +E+ +FG+   +++  +        R    E  +QW V   +AGF 
Sbjct: 2   LEPNLDRDSKERLRVERVLFGRRIMDLVRSDDDNNKPGTRFGLMEEKEQWRVLMEKAGFE 61

Query: 528 PL-PLNKEIMKMSRDRAKVYNKDF-----VIDEDGEWLLQGWKGRIVYALSSWR 385
           P+ P N  +   S+ +  ++N ++     +++ +  ++   W    +  +SSWR
Sbjct: 62  PVKPSNYAV---SQAKLLLWNYNYSTLYSLVESEPGFISLAWNNVPLLTVSSWR 112



>gb:BC068322_2555010 Danio rerio frizzled homolog 7a, mRNA (cDNA
           clone MGC:85603 IMAGE:6520247), complete cds.
          Length = 554

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 45/166 (27%), Positives = 61/166 (36%), Gaps = 20/166 (12%)
 Frame = -3

Query: 822 GSSSGS*IHTFLYRGIVN-----GAYNSPFFITRFREALF---HFSSLF--------DML 691
           G   G  +    Y GI N     G   +P F+  F    F    F SLF        D  
Sbjct: 380 GQVDGDMLTGVCYVGIYNVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGT 439

Query: 690 DTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYKQWHVRNMRAGFLPLPLNK 511
            T     +  RI +   ++   A  VIAC   E+  R +  K WH++  +   +P P+N 
Sbjct: 440 KTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCPVN- 498

Query: 510 EIMKMSRD----RAKVYNKDFVIDEDGEWLLQGWKGRIVYALSSWR 385
               MS D      K      V    G W+   W G+    L SWR
Sbjct: 499 NFAPMSPDFTVFMIKYLMTMIVGITSGFWI---WSGK---TLQSWR 538



>gb:AF336123_2488138 Danio rerio frizzled 7b mRNA, complete cds.
          Length = 559

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 43/154 (27%), Positives = 58/154 (37%), Gaps = 20/154 (12%)
 Frame = -3

Query: 786 YRGIVN-----GAYNSPFFITRFREALF---HFSSLF--------DMLDTNVPRNIHERI 655
           Y GI N     G   +P F+  F    F    F SLF        D   T     +  RI
Sbjct: 397 YVGIYNVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEELEKLMVRI 456

Query: 654 LIEKTIFGQEAKNVIACETAERVERPETYKQWHVRNMRAGFLPLPLNKEIMKMSRD---- 487
            +   ++   A  VIAC   E+  R +  K WH++  +   +P P+N     MS D    
Sbjct: 457 GVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCPIN-NFAPMSPDFTVF 515

Query: 486 RAKVYNKDFVIDEDGEWLLQGWKGRIVYALSSWR 385
             K      V    G W+   W G+    L SWR
Sbjct: 516 MIKYLMTMIVGITSGFWI---WSGK---TLQSWR 543



>pir|T33997|T33997 hypothetical protein W03G1.5 - Caenorhabditis
           elegans>gb:AF125964_1243207 Caenorhabditis elegans
           cosmid W03G1, complete sequence.
          Length = 471

 Score = 21.6 bits (44), Expect(5) = 4.1
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 373 SRSGSPGGK 399
           SRSGSPGG+
Sbjct: 342 SRSGSPGGR 350



 Score = 21.6 bits (44), Expect(5) = 4.1
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 373 SRSGSPGGK 399
           SRSGSPGG+
Sbjct: 312 SRSGSPGGR 320



 Score = 21.6 bits (44), Expect(5) = 4.1
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 373 SRSGSPGGK 399
           SRSGSPGG+
Sbjct: 263 SRSGSPGGR 271



 Score = 21.6 bits (44), Expect(5) = 4.1
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 373 SRSGSPGGK 399
           SRSGSPGG+
Sbjct: 244 SRSGSPGGR 252



 Score = 20.8 bits (42), Expect(5) = 4.1
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = +1

Query: 370 KSRSGSPGGK 399
           + RSGSPGG+
Sbjct: 226 RGRSGSPGGR 235



>gb:AY347800_1177961 Malus x domestica clone 19-4 unknown mRNA.
          Length = 56

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 12/25 (48%), Positives = 20/25 (80%)
 Frame = -3

Query: 762 YNSPFFITRFREALFHFSSLFDMLD 688
           +N P F+ RF EAL+++S++FD L+
Sbjct: 26  HNKPGFLDRFTEALYYYSTMFDSLE 50



>pir|AD2556|AD2556 hypothetical protein all8043 [imported] - Nostoc
           sp. (strain PCC 7120) plasmid
           pCC7120gamma>gb:AP003603_555120 Nostoc sp. PCC 7120
           plasmid pCC7120gamma DNA, complete genome.
          Length = 318

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 16/35 (45%), Positives = 20/35 (57%)
 Frame = +2

Query: 173 FLYLRLFRFCFWCAYIWVDGWLSLSLMHFQMTNLC 277
           FL L LF F     Y WV GWLSL+L+    + +C
Sbjct: 226 FLVLSLFPFGAKPIYAWVSGWLSLTLVLMSYSIVC 260



>gb:BC049397_2550210 Danio rerio frizzled homolog 7b, mRNA (cDNA
           clone MGC:55191 IMAGE:5777452), complete cds.
          Length = 556

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 44/166 (26%), Positives = 60/166 (36%), Gaps = 20/166 (12%)
 Frame = -3

Query: 822 GSSSGS*IHTFLYRGIVN-----GAYNSPFFITRFREALF---HFSSLF--------DML 691
           G   G  +    Y GI N     G   +P F+  F    F    F SLF        D  
Sbjct: 383 GQVDGDLLTGVCYVGIYNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGT 442

Query: 690 DTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYKQWHVRNMRAGFLPLPLNK 511
            T     +  RI +   ++   A  VIAC   E+  R +  K WH++  +   +P P N 
Sbjct: 443 KTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCP-NN 501

Query: 510 EIMKMSRD----RAKVYNKDFVIDEDGEWLLQGWKGRIVYALSSWR 385
               M+ D      K      V    G W+   W G+    L SWR
Sbjct: 502 NFAPMTPDFTVFMIKYLMTMIVGITSGFWI---WSGK---TLQSWR 541



>gb:AF336124_2488139 Danio rerio frizzled 7a mRNA, complete
           cds.>gb:AF437316_2494308 Danio rerio frizzled-7A (fz7A)
           mRNA, complete cds.>gb:AF510101_2498603 Danio rerio
           frizzled 7b (fz7b) mRNA, complete cds.
          Length = 557

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 44/166 (26%), Positives = 60/166 (36%), Gaps = 20/166 (12%)
 Frame = -3

Query: 822 GSSSGS*IHTFLYRGIVN-----GAYNSPFFITRFREALF---HFSSLF--------DML 691
           G   G  +    Y GI N     G   +P F+  F    F    F SLF        D  
Sbjct: 384 GQVDGDLLTGVCYVGIYNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGT 443

Query: 690 DTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYKQWHVRNMRAGFLPLPLNK 511
            T     +  RI +   ++   A  VIAC   E+  R +  K WH++  +   +P P N 
Sbjct: 444 KTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCP-NN 502

Query: 510 EIMKMSRD----RAKVYNKDFVIDEDGEWLLQGWKGRIVYALSSWR 385
               M+ D      K      V    G W+   W G+    L SWR
Sbjct: 503 NFAPMTPDFTVFMIKYLMTMIVGITSGFWI---WSGK---TLQSWR 542



>gb:AC113332_1738914 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1057_B02, complete
           sequence.>gb:AC130597_1740684 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0017K09,
           complete sequence.
          Length = 425

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 27/111 (24%), Positives = 49/111 (44%)
 Frame = -3

Query: 720 FHFSSLFDMLDTNVPRNIHERILIEKTIFGQEAKNVIACETAERVERPETYKQWHVRNMR 541
           FH+  L D LD + P++   R+  E  + G++ ++VI  E  +  ER E   +   R  R
Sbjct: 316 FHWI-LLDALDMSAPKDSPRRLEQEAAV-GRKIESVIGEE--DGAERSEPGARLAERMSR 371

Query: 540 AGFLPLPLNKEIMKMSRDRAKVYNKDFVIDEDGEWLLQGWKGRIVYALSSW 388
            GF  +  ++E     R     +   + +  + + L+  WKG       +W
Sbjct: 372 KGFAGVVFDEEAAAEVRRLLSEHATGWGVKREDDMLVLTWKGHAAVFTGAW 422



>gb:CR522870_101095 Desulfotalea psychrophila LSv54 chromosome.
          Length = 544

 Score = 32.7 bits (73), Expect = 9.0
 Identities = 24/87 (27%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
 Frame = +2

Query: 539 ARMFLTCHCLYV--SGLSTLSAVSHAITFFASCPNIVFSISILSWILRGTLVSSMSNKDE 712
           AR+FL CH + +  SG   +S+   + +F     + V   + ++W  R   +  ++N   
Sbjct: 190 ARLFLHCHSIRLAESGHEFISSTPDSFSFVLKQRDKVLIDTAIAWERRLGWLQLITNS-- 247

Query: 713 K*NKASRNRVIKKGEL*APLTIPLYKN 793
                   R+I++GEL  P++I LY N
Sbjct: 248 -------YRLIQRGELDLPVSIDLYDN 267


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 961,301,778
Number of Sequences: 1806583
Number of extensions: 20971558
Number of successful extensions: 51957
Number of sequences better than 10.0: 173
Number of HSP's better than 10.0 without gapping: 49816
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51816
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 57913030826
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)