BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13276
         (864 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY500155_1609647 Nicotiana benthamiana MAP3Ka mRNA, complete ...   103   2e-34   
gb:AY500156_1609648 Lycopersicon esculentum MAP3Ka mRNA, complet...   103   4e-21   
gb:BNA010091_1633259 Brassica napus mRNA for MAP3K alpha 1 prote...    51   3e-11   
gb:AF419572_1798434 Arabidopsis thaliana At1g53570/F22G10_18 mRN...    55   5e-11   
pir|G96575|G96575 probable MEK kinase MAP3Ka, 84794-81452 [impor...    55   5e-11   Arabidopsis thaliana [mouse-ear cress]
gb:ATU58918_1557105 Arabidopsis thaliana MEK kinase (MAP3Ka) mRN...    55   7e-11   
pir|T51625|T51625 MAP3K alpha protein kinase (EC 2.7.1.-) [impor...    55   7e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AB167408_1528748 Lotus corniculatus var. japonicus LjM3Kalpha...    64   5e-09   
gb:AF172282_1774428 Oryza sativa adh1-adh2 region.                     55   2e-06   
gb:OSJN00024_1693491 Oryza sativa genomic DNA, chromosome 4, BAC...    49   1e-04   
gb:AY357949_1601929 Arabidopsis thaliana ecotype C24 YDA (At1g63...    48   3e-04   
pir|A96662|A96662 hypothetical protein F24D7.11 [imported] - Ara...    48   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY093683_1575362 Suaeda maritima subsp. salsa mitogen-activat...    47   4e-04   
gb:AC090713_1734433 Oryza sativa chromosome 3 BAC OSJNBa0002J24 ...    47   6e-04   
gb:OSJN00087_1694651 Oryza sativa genomic DNA, chromosome 4, BAC...    47   6e-04   
pir|T51338|T51338 mitogen-activated protein kinase kinase (EC 2....    46   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:AP003810_1833696 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:AE016959_1020797 Oryza sativa (japonica cultivar-group) chrom...    45   0.001   
gb:AX048730_1458082 Sequence 1 from Patent WO0070059.                  45   0.002   
gb:AB000798_1508429 Arabidopsis thaliana mRNA for NPK1-related p...    45   0.002   
gb:DDU87912_1377448 Dictyostelium discoideum MAP kinase kinase p...    45   0.002   
sp|Q9FZ36|M3K2_ARATH|M3K2_ARATH Mitogen-activated protein kinase kinase kin...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AP004139_1838159 Oryza sativa (japonica cultivar-group) genom...    44   0.003   
gb:AY057533_1563951 Arabidopsis thaliana AT5g66850/MUD21_11 mRNA...    44   0.003   
gb:AY040040_1560539 Arabidopsis thaliana putative MAP protein ki...    44   0.003   
gb:ATY14316_1557514 Arabidopsis thaliana mRNA for MAP3K gamma pr...    44   0.003   
gb:ATCRK_1548021 A.thaliana mRNA for CDPK-related protein kinase...    44   0.003   
gb:AB010700_1511262 Arabidopsis thaliana genomic DNA, chromosome...    44   0.003   
gb:AE016959_1020798 Oryza sativa (japonica cultivar-group) chrom...    44   0.003   
pir|T46084|T46084 CDPK-related protein kinase - Arabidopsis thal...    44   0.003   Arabidopsis thaliana [mouse-ear cress]
pir|T52621|T52621 mitogen-activated protein kinase MAP3K [import...    44   0.003   Arabidopsis thaliana [mouse-ear cress]
gb:AE017349_1758910 Cryptococcus neoformans var. neoformans JEC2...    44   0.005   
gb:BX842680_1644227 Neurospora crassa DNA linkage group I cosmid...    44   0.005   
gb:AB000797_1508428 Arabidopsis thaliana mRNA for NPK1-related p...    44   0.005   
gb:AB000796_1508427 Arabidopsis thaliana mRNA for NPK1-related p...    44   0.005   
sp|O22040|M3K1_ARATH|M3K1_ARATH Mitogen-activated protein kinase kinase kin...    44   0.005   Arabidopsis thaliana [mouse-ear cress]
gb:AP005312_1850405 Oryza sativa (japonica cultivar-group) genom...    43   0.009   
gb:BC055124_2551212 Danio rerio zgc:63495, mRNA (cDNA clone MGC:...    42   0.012   
gb:AP004017_1836428 Oryza sativa (japonica cultivar-group) genom...    42   0.012   
gb:AF214654_1777853 Arthrobotrys dactyloides calmodulin-binding ...    42   0.020   
gb:AE016819_1748621 Ashbya gossypii (= Eremothecium gossypii) AT...    42   0.020   
gb:CR382128_1661001 Yarrowia lipolytica chromosome B of strain C...    42   0.020   
gb:AP005301_1850176 Oryza sativa (japonica cultivar-group) genom...    41   0.026   
gb:AP004738_1844097 Oryza sativa (japonica cultivar-group) genom...    41   0.026   
gb:AP004738_1844096 Oryza sativa (japonica cultivar-group) genom...    41   0.026   
gb:AY691331_1622564 Lycopersicon esculentum MAPKK (LeMKK2) mRNA,...    41   0.026   
pir|T51735|T51735 mitogen-activated protein kinase kinase (EC 2....    41   0.026   Arabidopsis thaliana [mouse-ear cress]
gb:AF100165_2473636 Xenopus laevis polo-like kinase kinase 1 (xP...    41   0.034   
gb:AP004738_1844098 Oryza sativa (japonica cultivar-group) genom...    41   0.034   
gb:OSJN00039_1693730 Oryza sativa genomic DNA, chromosome 4, BAC...    41   0.034   
gb:MMU85608_2123692 Mus musculus MEK kinase 4b (MEKK4b) mRNA, co...    40   0.044   
gb:BC058719_2103443 Mus musculus mitogen activated protein kinas...    40   0.044   
gb:AK122219_2068884 Mus musculus mRNA for mKIAA0213 protein.           40   0.044   
gb:AE017341_1754573 Cryptococcus neoformans var. neoformans JEC2...    40   0.044   
gb:MVA293274_1687747 Medicago sativa subsp. x varia mRNA for MEK...    40   0.044   
gb:CR382123_1655501 Kluyveromyces lactis strain NRRL Y-1140 chro...    40   0.044   
gb:AF485269_1188174 Mus musculus strain C57BL/6J chromosome 17 c...    40   0.044   
sp|O08648|M3K4_MOUSE|M3K4_MOUSE Mitogen-activated protein kinase kinase kin...    40   0.044   Mus musculus [mouse]
gb:BC073247_2557099 Xenopus laevis hypothetical protein LOC44363...    40   0.058   
gb:BC072290_2556542 Xenopus laevis hypothetical protein LOC43218...    40   0.058   
gb:AY335639_2144857 Synthetic construct Homo sapiens hypothetica...    40   0.058   
gb:D86968_1995185 Homo sapiens mRNA for KIAA0213 gene, partial cds.    40   0.058   
gb:AF308302_1896090 Homo sapiens serologically defined breast ca...    40   0.058   
gb:AP004057_1837038 Oryza sativa (japonica cultivar-group) genom...    40   0.058   
gb:AE016819_1749560 Ashbya gossypii (= Eremothecium gossypii) AT...    40   0.058   
gb:AF116604_1149868 Homo sapiens PRO0412 mRNA, complete cds.           40   0.058   
pir|T02550|T02550 NPK1-related protein kinase homolog T26B15.7 -...    40   0.058   Arabidopsis thaliana [mouse-ear cress]
pir|T08542|T08542 mitogen-activated protein kinase kinase (EC 2....    40   0.058   Arabidopsis thaliana [mouse-ear cress]
sp|Q9Y6R4|M3K4_HUMAN|M3K4_HUMAN Mitogen-activated protein kinase kinase kin...    40   0.058   Homo sapiens [man]
sp|O22042|M3K3_ARATH|M3K3_ARATH Mitogen-activated protein kinase kinase kin...    40   0.058   Arabidopsis thaliana [mouse-ear cress]
gb:AC133334_1741354 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    40   0.075   
gb:TOBPK_1725493 Tobacco mRNA for protein kinase, complete cds.        40   0.075   
gb:AB091780_1525067 Solanum tuberosum StMEK1 mRNA for mitogen-ac...    40   0.075   
gb:LME243118_1387682 Leishmania mexicana mkk gene for putative m...    40   0.075   
gb:LAM243183_1387092 Leishmania amazonensis mkk gene for putativ...    40   0.075   
pir|A48084|A48084 STE11 protein kinase homolog NPK1 - common tob...    40   0.075   Nicotiana tabacum [American tobacco]
pir|T01835|T01835 serine/threonine-specific protein kinase ARA.K...    40   0.075   Arabidopsis thaliana [mouse-ear cress]
pir|T02056|T02056 protein kinase MEK1 (EC 2.7.1.-) - maize>gb:ZM...    40   0.075   Zea mays [maize]
sp|Q9P7I2|KCC1_SCHPO|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase...    40   0.075   Schizosaccharomyces pombe
gb:AY335751_2144969 Synthetic construct Homo sapiens serine/thre...    39   0.098   
gb:BC004650_2089673 Mus musculus serine/threonine kinase 24 (STE...    39   0.098   
gb:CR542227_1994452 Homo sapiens full open reading frame cDNA cl...    39   0.098   
gb:BC065378_1986832 Homo sapiens serine/threonine kinase 24 (STE...    39   0.098   
gb:AL137249_1919567 Human DNA sequence from clone RP11-111L24 on...    39   0.098   
gb:AL137249_1919566 Human DNA sequence from clone RP11-111L24 on...    39   0.098   
gb:AL137249_1919565 Human DNA sequence from clone RP11-111L24 on...    39   0.098   
gb:AF024636_1877194 Homo sapiens STE20-like kinase 3 (mst-3) mRN...    39   0.098   
gb:AP004890_1846683 Oryza sativa (japonica cultivar-group) genom...    39   0.098   
gb:AF216314_1778078 Oryza sativa MAP kinase kinase 1 mRNA, compl...    39   0.098   
gb:AF073893_1765941 Schizosaccharomyces pombe calmodulin kinase ...    39   0.098   
gb:AE017347_1757925 Cryptococcus neoformans var. neoformans JEC2...    39   0.098   
gb:MSA575100_1687043 Medicago sativa mRNA for putative mitogen-a...    39   0.098   
gb:BNA010093_1633260 Brassica napus mRNA for MAP3K beta 1 protei...    39   0.098   
gb:CR382398_1374882 Plasmodium falciparum chromosome 6, complete...    39   0.098   
gb:CEY59A8B_1370753 Caenorhabditis elegans YAC Y59A8B, complete ...    39   0.098   
gb:BT001630_1356403 Drosophila melanogaster RE38276 full insert ...    39   0.098   
gb:AY741200_1349106 Caenorhabditis elegans STE20-like serine/thr...    39   0.098   
gb:AF093689_1240446 Dictyostelium discoideum MEK kinase alpha (m...    39   0.098   
gb:AF006640_1231359 Drosophila melanogaster Ste20-like protein k...    39   0.098   
gb:AE014297_1140216 Drosophila melanogaster chromosome 3R, compl...    39   0.098   
gb:AE014297_1139989 Drosophila melanogaster chromosome 3R, compl...    39   0.098   
gb:AE005172_890799 Arabidopsis thaliana chromosome 1, top arm co...    39   0.098   
pir|T51339|T51339 mitogen-activated protein kinase kinase (EC 2....    39   0.098   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SZ67|WR19_ARATH|WR19_ARATH Probable WRKY transcription factor 19 (WRKY...    39   0.098   Arabidopsis thaliana [mouse-ear cress]
sp|Q9Y6E0|ST24_HUMAN|ST24_HUMAN Serine/threonine-protein kinase 24 (EC 2.7....    39   0.098   Homo sapiens [man]
gb:BC072113_2556376 Xenopus laevis hypothetical protein MGC79096...    39   0.13    
gb:BC081911_2108156 Rattus norvegicus protein kinase LYK5, mRNA ...    39   0.13    
gb:AY327409_2083606 Rattus norvegicus protein kinase LYK5 (Lyk5)...    39   0.13    
gb:AF172271_1887686 Homo sapiens Traf2 and NCK interacting kinas...    39   0.13    
gb:AF172270_1887685 Homo sapiens Traf2 and NCK interacting kinas...    39   0.13    
gb:AF172269_1887684 Homo sapiens Traf2 and NCK interacting kinas...    39   0.13    
gb:AF172268_1887683 Homo sapiens Traf2 and NCK interacting kinas...    39   0.13    
gb:AF172267_1887682 Homo sapiens Traf2 and NCK interacting kinas...    39   0.13    
gb:AF172266_1887681 Homo sapiens Traf2 and NCK interacting kinas...    39   0.13    
gb:AF172265_1887680 Homo sapiens Traf2 and NCK interacting kinas...    39   0.13    
gb:AB011123_1864283 Homo sapiens mRNA for KIAA0551 protein, part...    39   0.13    
gb:AF391808_1795300 Zea mays chromosome 9S bz genomic region str...    39   0.13    
gb:AY062459_1565115 Arabidopsis thaliana Unknown protein (At4g08...    39   0.13    
gb:ATHATMEKK1_1553029 Arabidopsis thaliana mRNA for mitogen-acti...    39   0.13    
gb:ATHARAK_1553012 Arabidopsis thaliana serine/threonine kinase ...    39   0.13    
gb:CQ782708_1452108 Sequence 2848 from Patent EP1396543.>gb:AK07...    39   0.13    
gb:HSM803715_1187012 Homo sapiens mRNA; cDNA DKFZp667F1913 (from...    39   0.13    
gb:CR858650_1182809 Pongo pygmaeus mRNA; cDNA DKFZp459D2043 (fro...    39   0.13    
gb:AK041777_1166106 Mus musculus 3 days neonate thymus cDNA, RIK...    39   0.13    
gb:AK039113_1165286 Mus musculus adult male hypothalamus cDNA, R...    39   0.13    
gb:AK011451_1156409 Mus musculus 10 days embryo whole body cDNA,...    39   0.13    
pir|T01833|T01833 serine/threonine-specific protein kinase ARA.K...    39   0.13    Arabidopsis thaliana [mouse-ear cress]
pir|C86185|C86185 hypothetical protein [imported] - Arabidopsis ...    39   0.13    Arabidopsis thaliana [mouse-ear cress]
sp|P83510|TNIK_MOUSE|TNIK_MOUSE Traf2 and NCK interacting kinase (EC 2.7.1....    39   0.13    Mus musculus [mouse]
sp|Q9UKE5|TNIK_HUMAN|TNIK_HUMAN TRAF2 and NCK interacting kinase (EC 2.7.1....    39   0.13    Homo sapiens [man]
gb:AY335689_2144907 Synthetic construct Homo sapiens serine/thre...    39   0.17    
gb:BC070077_1988417 Homo sapiens serine/threonine kinase 10, mRN...    39   0.17    
gb:AL670729_1932114 Human DNA sequence from clone RP11-245P10 on...    39   0.17    
gb:AB046859_1867498 Homo sapiens mRNA for KIAA1639 protein, part...    39   0.17    
gb:AF325168_1786568 Nicotiana tabacum mitogen-activated protein ...    39   0.17    
gb:YLI7565_1728017 Yarrowia lipolytica SSL2 gene.                      39   0.17    
gb:CR382131_1664595 Yarrowia lipolytica chromosome E of strain C...    39   0.17    
gb:CR380956_1652146 Candida glabrata strain CBS138 chromosome J ...    39   0.17    
gb:AY533302_1612157 Petroselinum crispum mitogen-activated prote...    39   0.17    
gb:AX039412_1457707 Sequence 5 from Patent WO0063381.                  39   0.17    
gb:AX039410_1457706 Sequence 3 from Patent WO0063381.                  39   0.17    
gb:AX039409_1457705 Sequence 2 from Patent WO0063381.                  39   0.17    
gb:LMA243188_1387637 Leishmania major mkk gene for putative mito...    39   0.17    
gb:LAE243186_1387083 Leishmania aethiopica mkk gene for putative...    39   0.17    
sp|O94804|STKA_HUMAN|STKA_HUMAN Serine/threonine-protein kinase 10 (EC 2.7....    39   0.17    Homo sapiens [man]
gb:AL732544_2504427 Zebrafish DNA sequence from clone BUSM1-6I1 ...    38   0.22    
gb:AL691521_2504380 Zebrafish DNA sequence from clone BUSM1-186K...    38   0.22    
gb:AL592105_2504065 Zebrafish DNA sequence from clone BUSM1-150L...    38   0.22    
gb:AY335708_2144926 Synthetic construct Homo sapiens serine/thre...    38   0.22    
gb:AY335620_2144838 Synthetic construct Homo sapiens nuclear rec...    38   0.22    
gb:RNMST2KIN_2135279 Rattus norvegicus mRNA for MST2 kinase.           38   0.22    
gb:MMU28726_2120226 Mus musculus protein kinase homolog (mess1) ...    38   0.22    
gb:BC037440_2098045 Mus musculus serine/threonine kinase 3 (Ste2...    38   0.22    
gb:AF302138_2062087 Mus musculus HLS7-interacting protein kinase...    38   0.22    
gb:HSU26424_2023032 Human Ste20-like kinase (MST2) mRNA, complet...    38   0.22    
gb:AF435452_1799832 Nicotiana tabacum calcium/calmodulin-depende...    38   0.22    
gb:CR382125_1657903 Kluyveromyces lactis strain NRRL Y-1140 chro...    38   0.22    
gb:BT004308_1637384 Arabidopsis thaliana clone RAFL15-49-N24 (R5...    38   0.22    
gb:AY533301_1612156 Petroselinum crispum mitogen-activated prote...    38   0.22    
gb:AY074935_1567732 Zea mays NPK1-related protein kinase-like pr...    38   0.22    
gb:ATH010092_1551888 Arabidopsis thaliana mRNA for MAP3K beta 3 ...    38   0.22    
gb:AX876616_1476614 Sequence 11521 from Patent EP1074617.>gb:AK0...    38   0.22    
gb:U16029_1401910 Leishmania donovani protein kinase (lpk) mRNA,...    38   0.22    
gb:LIN243184_1387551 Leishmania infantum mkk gene for putative m...    38   0.22    
gb:LDO243185_1387278 Leishmania donovani mkk gene for putative m...    38   0.22    
gb:AF238312_1253810 Dictyostelium discoideum putative serine-thr...    38   0.22    
gb:HSM801650_1186336 Homo sapiens mRNA; cDNA DKFZp564D1878 (from...    38   0.22    
gb:CR858945_1183088 Pongo pygmaeus mRNA; cDNA DKFZp469L2223 (fro...    38   0.22    
gb:CR858669_1182826 Pongo pygmaeus mRNA; cDNA DKFZp459G2032 (fro...    38   0.22    
gb:AK046142_1167659 Mus musculus adult male corpora quadrigemina...    38   0.22    
gb:AK002914_1151536 Mus musculus adult male kidney cDNA, RIKEN f...    38   0.22    
pir|D85084|D85084 probable mitogen-activated protein kinase [imp...    38   0.22    Arabidopsis thaliana [mouse-ear cress]
pir|T01836|T01836 serine/threonine-specific protein kinase ARA.K...    38   0.22    Arabidopsis thaliana [mouse-ear cress]
pir|T51736|T51736 mitogen-activated protein kinase MAP3K beta [i...    38   0.22    Arabidopsis thaliana [mouse-ear cress]
sp|Q9JI10|STK3_MOUSE|STK3_MOUSE Serine/threonine-protein kinase 3 (EC 2.7.1...    38   0.22    Mus musculus [mouse]
sp|Q13188|STK3_HUMAN|STK3_HUMAN Serine/threonine-protein kinase 3 (EC 2.7.1...    38   0.22    Homo sapiens [man]
gb:BC073258_2557110 Xenopus laevis MGC80614 protein, mRNA (cDNA ...    38   0.29    
gb:AJ720237_2502424 Gallus gallus mRNA for hypothetical protein,...    38   0.29    
gb:AK000556_1907998 Homo sapiens cDNA FLJ20549 fis, clone KAT11561.    38   0.29    
gb:AB040057_1866763 Homo sapiens mRNA for serine/threonine prote...    38   0.29    
gb:AX647521_1472388 Sequence 1713 from Patent EP1270724.               38   0.29    
gb:CQ783222_1452359 Sequence 3362 from Patent EP1396543.>gb:AK07...    38   0.29    
gb:CQ783144_1452321 Sequence 3284 from Patent EP1396543.>gb:AK07...    38   0.29    
gb:CQ782788_1452148 Sequence 2928 from Patent EP1396543.>gb:AX88...    38   0.29    
gb:AC115605_1205884 Dictyostelium discoideum chromosome 2 map 58...    38   0.29    
gb:AK034609_1163813 Mus musculus 12 days embryo embryonic body b...    38   0.29    
pir|C84831|C84831 probable protein kinase [imported] - Arabidops...    38   0.29    Arabidopsis thaliana [mouse-ear cress]
gb:BC083536_2563336 Danio rerio zgc:92836, mRNA (cDNA clone MGC:...    37   0.37    
gb:AY603754_2086808 Mus musculus obscurin-MLCK mRNA, complete cds.     37   0.37    
gb:AL669844_2072492 Mouse DNA sequence from clone RP23-395O6 on ...    37   0.37    
gb:AL669844_2072491 Mouse DNA sequence from clone RP23-395O6 on ...    37   0.37    
gb:AK122218_2068883 Mus musculus mRNA for mKIAA0204 protein.           37   0.37    
gb:AF112855_2054940 Mus musculus Ste20-related kinase SMAK (SMAK...    37   0.37    
gb:SPWIS4GEN_1722341 S.pombe wis4+ gene.                               37   0.37    
gb:SPWAK1_1722337 S.pombe wak1 gene.                                   37   0.37    
gb:AY247756_1592604 Glycine max seed calcium dependent protein k...    37   0.37    
gb:BT020904_1436262 Bos taurus serine/threonine kinase 4 (STK4),...    37   0.37    
gb:AY071688_1295772 Drosophila melanogaster RH10407 full insert ...    37   0.37    
gb:AF061281_1237277 Dictyostelium discoideum kinase responsive t...    37   0.37    
gb:AK029491_1161517 Mus musculus adult male testis cDNA, RIKEN f...    37   0.37    
gb:AK028838_1161190 Mus musculus 10 days neonate skin cDNA, RIKE...    37   0.37    
gb:AE013599_1132765 Drosophila melanogaster chromosome 2R, compl...    37   0.37    
gb:AE013599_1132764 Drosophila melanogaster chromosome 2R, compl...    37   0.37    
pir|S53804|S53804 protein kinase NPK2 (EC 2.7.1.-) - common toba...    37   0.37    Nicotiana tabacum [American tobacco]
pir|T14157|T14157 serine/threonine protein kinase - mouse>gb:AF0...    37   0.37    Mus musculus [mouse]
pir|T08874|T08874 calcium-dependent protein kinase (EC 2.7.1.-) ...    37   0.37    Glycine max [soybeans]
sp|O14299|WIS4_SCHPO|WIS4_SCHPO MAP kinase kinase kinase wis4 (EC 2.7.1.-) ...    37   0.37    Schizosaccharomyces pombe
sp|O55098|STKA_MOUSE|STKA_MOUSE Serine/threonine-protein kinase 10 (EC 2.7....    37   0.37    Mus musculus [mouse]
gb:BC074684_2558178 Xenopus tropicalis nuclear receptor binding ...    37   0.49    
gb:BC070834_2555803 Xenopus laevis hypothetical protein LOC43182...    37   0.49    
gb:BC054651_2551060 Danio rerio zgc:66137, mRNA (cDNA clone MGC:...    37   0.49    
gb:AY242842_2521697 Squalus acanthias STE20-like kinase (MST1/2)...    37   0.49    
gb:BC056650_2102456 Mus musculus cDNA clone MGC:68239 IMAGE:5036...    37   0.49    
gb:AK129191_2069422 Mus musculus mRNA for mKIAA0687 protein.           37   0.49    
gb:AY212247_1939418 Homo sapiens Ste20 group protein kinase HGK ...    37   0.49    
gb:AF096300_1882786 Homo sapiens HPK/GCK-like kinase HGK mRNA, c...    37   0.49    
gb:AB014587_1864616 Homo sapiens mRNA for KIAA0687 protein, part...    37   0.49    
gb:AE017348_1758139 Cryptococcus neoformans var. neoformans JEC2...    37   0.49    
gb:MSCDPK_1687079 M.sativa mRNA for protein kinase.                    37   0.49    
gb:AY427829_1605796 Solanum chacoense fertilization-related kina...    37   0.49    
gb:ATH505745_1552820 Arabidopsis thaliana mRNA for map 4 kinase ...    37   0.49    
gb:AB013392_1512094 Arabidopsis thaliana genomic DNA, chromosome...    37   0.49    
gb:CQ782869_1452188 Sequence 3009 from Patent EP1396543.               37   0.49    
gb:BT020921_1436279 Bos taurus protein kinase LYK5 (LYK5), mRNA,...    37   0.49    
gb:U53153_1404868 Caenorhabditis elegans cosmid T19A5, complete ...    37   0.49    
gb:U53153_1404867 Caenorhabditis elegans cosmid T19A5, complete ...    37   0.49    
gb:U53153_1404866 Caenorhabditis elegans cosmid T19A5, complete ...    37   0.49    
gb:LMFL7171_1388356 Leishmania major Friedlin chromosome 21 cosm...    37   0.49    
gb:HSM802392_1186694 Homo sapiens mRNA; cDNA DKFZp434A025 (from ...    37   0.49    
pir|T34356|T34356 hypothetical protein T19A5.2 - Caenorhabditis ...    37   0.49    Caenorhabditis elegans [roundworm]
pir|T47507|T47507 probable protein kinase - Arabidopsis thaliana...    37   0.49    Arabidopsis thaliana [mouse-ear cress]
pir|T46481|T46481 hypothetical protein DKFZp434A025.1 - human (f...    37   0.49    Homo sapiens [man]
sp|P97820|M4K4_MOUSE|M4K4_MOUSE Mitogen-activated protein kinase kinase kin...    37   0.49    Mus musculus [mouse]
sp|O95819|M4K4_HUMAN|M4K4_HUMAN Mitogen-activated protein kinase kinase kin...    37   0.49    Homo sapiens [man]
sp|Q00771|KCC1_EMENI|KCC1_EMENI Calcium/calmodulin-dependent protein kinase...    37   0.49    
gb:BC089072_2566038 Xenopus tropicalis cDNA clone MGC:107743 IMA...    37   0.64    
gb:AY247742_2521837 Gallus gallus TRB2 protein mRNA, complete cds.     37   0.64    
gb:AJ720430_2502617 Gallus gallus mRNA for hypothetical protein,...    37   0.64    
gb:AJ719477_2501664 Gallus gallus mRNA for hypothetical protein,...    37   0.64    
gb:AE017341_1754586 Cryptococcus neoformans var. neoformans JEC2...    37   0.64    
gb:AE016816_1746807 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.64    
gb:AC135206_1742024 Oryza sativa (japonica cultivar-group) chrom...    37   0.64    
gb:CR382137_1670218 Debaryomyces hansenii chromosome E of strain...    37   0.64    
gb:BNA9608_1633372 Brassica napus mRNA for MAP4K alpha 1 protein.      37   0.64    
gb:AY188756_1588362 Zea mays GCK-like kinase MIK mRNA, complete ...    37   0.64    
gb:AY080818_1568515 Arabidopsis thaliana unknown protein (At4g26...    37   0.64    
gb:ATH505744_1552819 Arabidopsis thaliana mRNA for map 4 kinase ...    37   0.64    
pir|T04812|T04812 NPK1-related protein kinase homolog F10M23.230...    37   0.64    Arabidopsis thaliana [mouse-ear cress]
pir|D96532|D96532 probable CDPK-related protein kinase [imported...    37   0.64    Arabidopsis thaliana [mouse-ear cress]
pir|C96572|C96572 protein F12M16.4 [imported] - Arabidopsis thal...    37   0.64    Arabidopsis thaliana [mouse-ear cress]
pir|C84774|C84774 probable calcium-dependent protein kinase [imp...    37   0.64    Arabidopsis thaliana [mouse-ear cress]
pir|G96761|G96761 probable MAP kinase T9L24.32 [imported] - Arab...    37   0.64    Arabidopsis thaliana [mouse-ear cress]
gb:BC074181_2557698 Xenopus laevis MGC82018 protein, mRNA (cDNA ...    36   0.83    
gb:BC045867_2549385 Danio rerio zgc:77029, mRNA (cDNA clone MGC:...    36   0.83    
gb:AY346154_2529001 Gallus gallus serine/threonine kinase 25 mRN...    36   0.83    
gb:AB074001_2463263 Xenopus laevis MKK7 mRNA for MAPK kinase 7, ...    36   0.83    
gb:BC052913_2101355 Mus musculus serine/threonine kinase 25 (yea...    36   0.83    
gb:AY346152_2083947 Rattus norvegicus serine/threonine kinase 25...    36   0.83    
gb:HSU18297_2022590 Human MST1 (MST1) mRNA, complete cds.              36   0.83    
gb:HSJ1069P2_2015676 Human DNA sequence from clone RP5-1069P2 on...    36   0.83    
gb:HS211D12_1997495 Human DNA sequence from clone RP1-211D12 on ...    36   0.83    
gb:D86959_1995176 Homo sapiens mRNA for KIAA0204 gene, partial cds.    36   0.83    
gb:BC064804_1986621 Homo sapiens STE20-like kinase (yeast), mRNA...    36   0.83    
gb:BC058916_1985576 Homo sapiens serine/threonine kinase 4, mRNA...    36   0.83    
gb:BC047885_1984042 Homo sapiens STE20-like kinase (yeast), mRNA...    36   0.83    
gb:BC047762_1984008 Homo sapiens STE20-like kinase (yeast), mRNA...    36   0.83    
gb:BC015793_1975311 Homo sapiens serine/threonine kinase 25 (STE...    36   0.83    
gb:AY227114_1939785 Homo sapiens kinase/transmembrane domain fus...    36   0.83    
gb:AF273048_1894178 Homo sapiens CTCL tumor antigen se20-9 mRNA,...    36   0.83    
gb:AB002804_1863710 Homo sapiens mRNA for hSLK, complete cds.>gb...    36   0.83    
gb:AP004054_1836996 Oryza sativa (japonica cultivar-group) genom...    36   0.83    
gb:AP002844_1823113 Oryza sativa (japonica cultivar-group) genom...    36   0.83    
gb:AC097277_1736528 Oryza sativa chromosome 3 BAC OSJNBa0022C08 ...    36   0.83    
gb:CR382135_1668516 Debaryomyces hansenii chromosome C of strain...    36   0.83    
gb:CR380959_1654238 Candida glabrata strain CBS138 chromosome M ...    36   0.83    
gb:AY155462_1585317 Physcomitrella patens Ca2+/calmodulin-depend...    36   0.83    
gb:AB010071_1510890 Arabidopsis thaliana genomic DNA, chromosome...    36   0.83    
gb:AY346153_1429201 Bos taurus serine/threonine kinase 25 mRNA, ...    36   0.83    
gb:U60169_1405440 Dictyostelium discoideum putative protein kina...    36   0.83    
gb:AF059534_1237140 Dictyostelium discoideum severin kinase mRNA...    36   0.83    
gb:ACTWITCH_1208280 A.californica mRNA for twitchin-like protein.      36   0.83    
gb:AC116986_1207517 Dictyostelium discoideum chromosome 2 map 22...    36   0.83    
gb:CR933633_1185667 Homo sapiens mRNA; cDNA DKFZp686A2068 (from ...    36   0.83    
pir|S49128|S49128 twitchin-like protein - California sea hare (f...    36   0.83    
pir|S71886|S71886 Ste20-like protein kinase - human>gb:HSSTE20_2...    36   0.83    
pir|T18532|T18532 serine/threoine protein kinase - guinea pig>gb...    36   0.83    
pir|T34021|T34021 protein kinase SK2 - rat>gb:AB003357_2043228 R...    36   0.83    
pir|T01479|T01479 hypothetical protein F17O7.3 - Arabidopsis tha...    36   0.83    
sp|Q13043|STK4_HUMAN|STK4_HUMAN Serine/threonine-protein kinase 4 (EC 2.7.1...    36   0.83    
sp|Q9Z2W1|ST25_MOUSE|ST25_MOUSE Serine/threonine-protein kinase 25 (EC 2.7....    36   0.83    
sp|O00506|ST25_HUMAN|ST25_HUMAN Serine/threonine-protein kinase 25 (EC 2.7....    36   0.83    
sp|P32490|MKK1_YEAST|MKK1_YEAST MAP kinase kinase MKK1/SSP32 (EC 2.7.1.-).>...    36   0.83    
gb:BX545848_2567633 Zebrafish DNA sequence from clone DKEY-8O19 ...    36   1.1     
gb:BX248523_2567139 Zebrafish DNA sequence from clone CH211-257G...    36   1.1     
gb:BC088682_2565808 Xenopus laevis hypothetical LOC496220, mRNA ...    36   1.1     
gb:BC070568_2555549 Xenopus laevis hypothetical protein MGC80023...    36   1.1     
gb:BC048033_2549994 Danio rerio serine/threonine kinase 3 (STE20...    36   1.1     
gb:AP004840_1845808 Oryza sativa (japonica cultivar-group) genom...    36   1.1     
gb:SCCMK2_1707353 S. cerevisiae CMK2 gene for calmodulin-depende...    36   1.1     
gb:NTA302651_1691329 Nicotiana tabacum mRNA for MAP kinase (mek1...    36   1.1     
gb:BNA9609_1633373 Brassica napus mRNA for MAP4K alpha2 protein.       36   1.1     
gb:AC069144_1540615 Arabidopsis thaliana chromosome 1 BAC F14C21...    36   1.1     
gb:AB055514_1521492 Nicotiana tabacum mRNA for NQK1 MAPKK, compl...    36   1.1     
gb:U80845_1406492 Caenorhabditis elegans cosmid C24A8, complete ...    36   1.1     
gb:U80845_1406491 Caenorhabditis elegans cosmid C24A8, complete ...    36   1.1     
gb:AF271359_1257584 Caenorhabditis elegans STE20-like kinase MST...    36   1.1     
gb:AC114263_1205639 Dictyostelium discoideum chromosome 2 map 21...    36   1.1     
gb:AC006630_1203443 Caenorhabditis elegans cosmid F14H12, comple...    36   1.1     
gb:AC006630_1203442 Caenorhabditis elegans cosmid F14H12, comple...    36   1.1     
gb:BC068926_2555420 Xenopus laevis hypothetical protein MGC83167...    35   1.4     
gb:BC067372_2554705 Danio rerio zgc:55494, mRNA (cDNA clone MGC:...    35   1.4     
gb:BC055134_2551222 Danio rerio zgc:63535, mRNA (cDNA clone MGC:...    35   1.4     
gb:BC045434_2549271 Danio rerio polo-like kinase 4 (Drosophila),...    35   1.4     
gb:BC044183_2548571 Danio rerio zgc:55494, mRNA (cDNA clone MGC:...    35   1.4     
gb:AB109112_2465439 Xenopus tropicalis Xtrbl mRNA for serine/thr...    35   1.4     
gb:AB109111_2465438 Xenopus tropicalis Xtrbl mRNA for serine/thr...    35   1.4     
gb:AB109110_2465437 Xenopus tropicalis Xtrbl mRNA for serine/thr...    35   1.4     
gb:AB109109_2465436 Xenopus tropicalis Xtrbl mRNA for serine/thr...    35   1.4     
gb:AB109108_2465435 Xenopus tropicalis Xtrbl mRNA for serine/thr...    35   1.4     
gb:AB109106_2465433 Xenopus laevis Xtrbl mRNA for serine/threoni...    35   1.4     
gb:AB109104_2465431 Xenopus laevis Xtrbl mRNA for serine/threoni...    35   1.4     
gb:AB109102_2465429 Xenopus laevis Xtrbl mRNA for serine/threoni...    35   1.4     
gb:AY335660_2144878 Synthetic construct Homo sapiens TRB2 protei...    35   1.4     
gb:BC060956_2104195 Mus musculus amyotrophic lateral sclerosis 2...    35   1.4     
gb:BC027159_2095789 Mus musculus tribbles homolog 2 (Drosophila)...    35   1.4     
gb:AF358867_2064080 Mus musculus TRB-2 mRNA, complete cds.             35   1.4     
gb:BC071579_1988664 Homo sapiens mitogen-activated protein kinas...    35   1.4     
gb:AY245544_1940193 Homo sapiens TRB2 protein mRNA, complete cds...    35   1.4     
gb:AF000145_1875696 Homo sapiens germinal center kinase related ...    35   1.4     
gb:AC007684_1875264 Homo sapiens BAC clone RP11-449G16 from 2, c...    35   1.4     
gb:AF034963_1762839 Glomerella cingulata calmodulin-dependent pr...    35   1.4     
gb:AC079889_1733017 Oryza sativa chromosome 3 BAC OSJNBa0092M19 ...    35   1.4     
gb:NCB16M17_1689402 Neurospora crassa DNA linkage group V BAC cl...    35   1.4     
gb:AY691332_1622565 Lycopersicon esculentum MAPKK (LeMKK3) mRNA,...    35   1.4     
gb:AY562224_1614996 Nicotiana tabacum calcium/calmodulin protein...    35   1.4     
gb:AY462110_1607511 Pleurotus djamor PDSTE3.3 mating-type pherom...    35   1.4     
gb:AY072199_1567087 Arabidopsis thaliana putative serine threoni...    35   1.4     
gb:AC008262_1536609 Genomic sequence for Arabidopsis thaliana BA...    35   1.4     
gb:AX883768_1479469 Sequence 18673 from Patent EP1074617.>gb:AB0...    35   1.4     
gb:AY360147_1429458 Bos taurus tribbles-like protein 2 mRNA, com...    35   1.4     
gb:AY247741_1427955 Bos taurus TRB2 protein mRNA, complete cds.        35   1.4     
gb:CNS07EGA_1372975 chromosome III of strain GB-M1 of Encephalit...    35   1.4     
gb:CR861369_1185368 Pongo pygmaeus mRNA; cDNA DKFZp459A202 (from...    35   1.4     
gb:CR860627_1184686 Pongo pygmaeus mRNA; cDNA DKFZp459C1524 (fro...    35   1.4     
gb:CR857816_1182022 Pongo pygmaeus mRNA; cDNA DKFZp459M2254 (fro...    35   1.4     
gb:AK080096_1172876 Mus musculus adult male aorta and vein cDNA,...    35   1.4     
gb:AK044747_1167109 Mus musculus adult retina cDNA, RIKEN full-l...    35   1.4     
gb:AF116618_1149881 Homo sapiens PRO1038 mRNA, complete cds.           35   1.4     
gb:AE005173_895485 Arabidopsis thaliana chromosome 1, bottom arm...    35   1.4     
pir|A86371|A86371 hypothetical protein F5O8.25 - Arabidopsis tha...    35   1.4     
pir|T49257|T49257 protein kinase-like - Arabidopsis thaliana>gb:...    35   1.4     
pir|B96716|B96716 probable serine/threonine kinase F23O10.20 [im...    35   1.4     
sp|Q8IVH8|M4K3_HUMAN|M4K3_HUMAN Mitogen-activated protein kinase kinase kin...    35   1.4     
gb:AF512506_2498734 Morone saxatilis class IIIB myosin short iso...    35   1.9     
gb:AB098710_2464860 Xenopus laevis mRNA for Ca2+/calmodulin-depe...    35   1.9     
gb:AY487425_2085562 Mus musculus p21-activated kinase 5 (Pak7) m...    35   1.9     
gb:HS1119D92_1996833 Novel human gene on chromosome 20, similar ...    35   1.9     
gb:BC024179_1978253 Homo sapiens p21(CDKN1A)-activated kinase 7,...    35   1.9     
gb:AB033090_1866270 Homo sapiens mRNA for KIAA1264 protein, part...    35   1.9     
gb:AP004309_1840019 Oryza sativa (japonica cultivar-group) genom...    35   1.9     
gb:AJ631227_1812786 Silene diclinis partial mRNA for putative ca...    35   1.9     
gb:AJ631225_1812784 Silene dioica partial mRNA for putative calc...    35   1.9     
gb:AJ631223_1812782 Silene latifolia partial mRNA for putative c...    35   1.9     
gb:AF276999_1782715 Funaria hygrometrica calcium-dependent prote...    35   1.9     
gb:AF249887_1780788 Pneumocystis carinii map kinase kinase (mkk1...    35   1.9     
gb:CR380958_1653222 Candida glabrata strain CBS138 chromosome L ...    35   1.9     
gb:BT002752_1636355 Arabidopsis thaliana clone C104851 putative ...    35   1.9     
gb:AY664415_1620630 Zea mays cultivar B73 locus 9009, complete s...    35   1.9     
gb:AY395740_1604829 Vitis aestivalis putative mitogen-activated ...    35   1.9     
gb:AY065426_1566532 Arabidopsis thaliana putative protein kinase...    35   1.9     
gb:AX040998_1457761 Sequence 45 from Patent WO0065040.                 35   1.9     
gb:DDY10158_1377476 D.discoideum mRNA for STE20/pak kinase homol...    35   1.9     
gb:DDU67716_1377396 Dictyostelium discoideum myosin I heavy chai...    35   1.9     
gb:AC115606_1205903 Dictyostelium discoideum chromosome 2 map 15...    35   1.9     
gb:CR860016_1184112 Pongo pygmaeus mRNA; cDNA DKFZp459F2425 (fro...    35   1.9     
gb:CR859233_1183358 Pongo pygmaeus mRNA; cDNA DKFZp459C1225 (fro...    35   1.9     
gb:AK079080_1172579 Mus musculus adult male diencephalon cDNA, R...    35   1.9     
gb:AK032593_1162983 Mus musculus adult male olfactory brain cDNA...    35   1.9     
pir|S56909|S56909 polymyxin B resistance protein PBS2 - yeast (S...    35   1.9     
pir|A71407|A71407 probable Ste20-like kinase - Arabidopsis thali...    35   1.9     
pir|T51417|T51417 protein kinase-like protein - Arabidopsis thal...    35   1.9     
sp|O14305|SID1_SCHPO|SID1_SCHPO Serine/threonine-protein kinase sid1 (EC 2....    35   1.9     
sp|P08018|PBS2_YEAST|PBS2_YEAST Polymyxin B resistance protein kinase (EC 2...    35   1.9     
sp|Q9P286|PAK7_HUMAN|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 (EC 2...    35   1.9     
sp|Q924I2|M4K3_RAT|M4K3_RAT Mitogen-activated protein kinase kinase kinas...    35   1.9     
gb:BC081364_2562247 Xenopus tropicalis MGC89810 protein, mRNA (c...    35   2.4     
gb:BC077793_2560446 Xenopus laevis oxidative-stress responsive 1...    35   2.4     
gb:BC067933_2554918 Xenopus tropicalis hypothetical protein MGC6...    35   2.4     
gb:BC063903_2553606 Xenopus tropicalis hypothetical protein MGC7...    35   2.4     
gb:BC060493_2552956 Xenopus laevis hypothetical protein MGC68762...    35   2.4     
gb:SCCMK1_1707352 S. cerevisiae CMK1 gene for Ca2+/calmodulin-de...    35   2.4     
gb:MVA293275_1687748 Medicago sativa subsp. x varia mRNA for MAP...    35   2.4     
gb:AY691333_1622566 Lycopersicon esculentum MAPKK (LeMKK4) mRNA,...    35   2.4     
gb:AY081272_1568618 Arabidopsis thaliana MAP kinase kinase 5 (At...    35   2.4     
gb:AY072126_1567020 Arabidopsis thaliana putative calcium-depend...    35   2.4     
gb:AY070230_1566752 Glycine max mitogen-activated protein kinase...    35   2.4     
gb:AB010076_1511003 Arabidopsis thaliana genomic DNA, chromosome...    35   2.4     
gb:AB007727_1510289 Arabidopsis thaliana genomic DNA, chromosome...    35   2.4     
gb:AB007727_1510280 Arabidopsis thaliana genomic DNA, chromosome...    35   2.4     
gb:AY854948_1354104 Drosophila ezoana strain 15010-0971.2 fused1...    35   2.4     
gb:AY854943_1354099 Drosophila americana strain G96.11 fused1 (f...    35   2.4     
gb:AY854942_1354098 Drosophila virilis strain A11 fused1 (fu1) g...    35   2.4     
gb:AY014481_1287998 Drosophila montana strain Utah3 fused protei...    35   2.4     
gb:AY014479_1287996 Drosophila montana strain Oulanka25 fused pr...    35   2.4     
gb:AY014467_1287984 Drosophila montana strain Oulanka13 fused pr...    35   2.4     
gb:AY014456_1287973 Drosophila montana strain Oulanka2 fused pro...    35   2.4     
gb:AY014455_1287972 Drosophila montana strain Oulanka1 fused pro...    35   2.4     
gb:AY014454_1287971 Drosophila americana strain FP99.91 fused1 p...    35   2.4     
gb:AY014451_1287968 Drosophila americana strain FP99.71 fused1 p...    35   2.4     
gb:AY014450_1287967 Drosophila americana strain FP99.65 fused1 p...    35   2.4     
gb:AY014448_1287965 Drosophila americana strain FP99.51 fused1 p...    35   2.4     
gb:AY014447_1287964 Drosophila americana strain FP99.31 fused1 p...    35   2.4     
gb:AY014446_1287963 Drosophila americana strain FP99.29 fused1 p...    35   2.4     
gb:AY014445_1287962 Drosophila americana strain FP99.27 fused1 p...    35   2.4     
gb:AY014443_1287960 Drosophila americana strain G96.41 fused1 pr...    35   2.4     
gb:AY014441_1287958 Drosophila americana strain G96.36 fused1 pr...    35   2.4     
gb:AY014440_1287957 Drosophila americana strain G96.31 fused1 pr...    35   2.4     
gb:AY014439_1287956 Drosophila americana strain G96.30 fused1 pr...    35   2.4     
gb:AY014438_1287955 Drosophila americana strain G96.27 fused1 pr...    35   2.4     
gb:AY014435_1287952 Drosophila americana strain G96.21 fused1 pr...    35   2.4     
gb:AY014434_1287951 Drosophila americana strain G96.10 fused1 pr...    35   2.4     
gb:AF239866_1253941 Drosophila lummei fused protein (fu) gene, p...    35   2.4     
gb:AF162547_1246455 Drosophila virilis strain b22 fused protein ...    35   2.4     
gb:AF162541_1246449 Drosophila virilis strain skt fused protein ...    35   2.4     
gb:AF162537_1246445 Drosophila virilis strain 15010-1051.47 fuse...    35   2.4     
gb:AF162536_1246444 Drosophila virilis strain 15010-1051.9 fused...    35   2.4     
gb:AC116984_1207324 Dictyostelium discoideum chromosome 2 map 25...    35   2.4     
gb:AB038236_1195438 Drosophila melanogaster mRNA for DASK1, comp...    35   2.4     
gb:AK046790_1167917 Mus musculus 10 days neonate medulla oblonga...    35   2.4     
gb:AE014297_1140386 Drosophila melanogaster chromosome 3R, compl...    35   2.4     
gb:AE014297_1140385 Drosophila melanogaster chromosome 3R, compl...    35   2.4     
pir|JC4673|JC4673 protein kinase (EC 2.7.1.37) 2B - fruit fly (D...    35   2.4     
pir|JC4234|JC4234 gene fused protein - fruit fly (Drosophila mel...    35   2.4     
pir|T14616|T14616 hypothetical protein - Trypanosoma cruzi>gb:AC...    35   2.4     
pir|E86206|E86206 hypothetical protein [imported] - Arabidopsis ...    35   2.4     
pir|T05500|T05500 calcium-dependent protein kinase homolog T19K4...    35   2.4     
pir|T52635|T52635 mitogen-activated protein kinase kinase (EC 2....    35   2.4     
pir|T51340|T51340 mitogen-activated protein kinase kinase (EC 2....    35   2.4     
sp|P41892|CC7_SCHPO|CC7_SCHPO Cell division control protein 7 (EC 2.7.1.-)...    35   2.4     
gb:BC077350_2560063 Xenopus laevis MGC81192 protein, mRNA (cDNA ...    34   3.2     
gb:AY335780_2144998 Synthetic construct Homo sapiens pim-1 oncog...    34   3.2     
gb:AY335710_2144928 Synthetic construct Homo sapiens mitogen-act...    34   3.2     
gb:HUMPIM1_2035653 Human pim-1 oncogene mRNA, complete cds.            34   3.2     
gb:HSU71088_2025835 Human MAP kinase kinase MEK5c mRNA, complete...    34   3.2     
gb:HSSTPKSAK_2020561 Homo sapiens mRNA for serine/threonine prot...    34   3.2     
gb:BC036023_1981801 Homo sapiens polo-like kinase 4 (Drosophila)...    34   3.2     
gb:BC008838_1971624 Homo sapiens mitogen-activated protein kinas...    34   3.2     
gb:AK055778_1911562 Homo sapiens cDNA FLJ31216 fis, clone KIDNE2...    34   3.2     
gb:AF391558_1900541 Homo sapiens myosin IIIB variant MYO3B.5 (MY...    34   3.2     
gb:AF391557_1900540 Homo sapiens myosin IIIB variant MYO3B.4 (MY...    34   3.2     
gb:AF391556_1900539 Homo sapiens myosin IIIB variant MYO3B.3 (MY...    34   3.2     
gb:AF391554_1900537 Homo sapiens myosin IIIB variant MYO3B.1 (MY...    34   3.2     
gb:AF369908_1899314 Homo sapiens myosin IIIB (MYO3B) mRNA, compl...    34   3.2     
gb:AB006972_1863904 Homo sapiens mRNA for Sak, complete cds.           34   3.2     
gb:AP003018_1824189 Oryza sativa (japonica cultivar-group) genom...    34   3.2     
gb:AF294841_1783919 Filobasidiella neoformans var. neoformans St...    34   3.2     
gb:AE017344_1756533 Cryptococcus neoformans var. neoformans JEC2...    34   3.2     
gb:YSCSSP31_1730695 Saccharomyces cerevisiae gene for Ssp31 prot...    34   3.2     
gb:YSCMKK2_1729905 S.cerevisiae gene for Mkk2 protein kinase, co...    34   3.2     
gb:SCYJL094C_1712655 S.cerevisiae chromosome X reading frame ORF...    34   3.2     
gb:SCCMK2P_1707354 S.cerevisiae CMK2 gene for CaM kinase II (par...    34   3.2     
gb:SCBCK1_1706549 S.cerevisiae BCK1 gene for protein kinase.           34   3.2     
gb:CR382126_1658981 Kluyveromyces lactis strain NRRL Y-1140 chro...    34   3.2     
gb:CR380958_1653316 Candida glabrata strain CBS138 chromosome L ...    34   3.2     
gb:CR380957_1652628 Candida glabrata strain CBS138 chromosome K ...    34   3.2     
gb:AY855074_1630892 Cicer arietinum calcium-dependent/calmodulin...    34   3.2     
gb:AY710430_1623938 Cryptococcus gattii strain WM276 MATalpha lo...    34   3.2     
gb:AY050891_1562384 Arabidopsis thaliana putative calcium depend...    34   3.2     
gb:U38377_1402922 Caenorhabditis elegans cosmid K08A8, complete ...    34   3.2     
gb:AF359250_1265310 Trypanosoma brucei dual-specificity tyrosine...    34   3.2     
pir|A56708|A56708 MAPK/ERK kinase 5 - human                            34   3.2     
pir|T30565|T30565 MAP kinase kinase kinase - yeast (Kluyveromyce...    34   3.2     
pir|T16583|T16583 hypothetical protein K08A8.1 - Caenorhabditis ...    34   3.2     
pir|D85059|D85059 probable calcium dependent protein kinase [imp...    34   3.2     
pir|T04262|T04262 mitogen-activated protein kinase kinase (EC 2....    34   3.2     
sp|P33886|WIS1_SCHPO|WIS1_SCHPO Protein kinase wis1 (EC 2.7.1.-) (Protein k...    34   3.2     
sp|Q91822|PIM3_XENLA|PIM3_XENLA Serine/threonine-protein kinase Pim-3 (EC 2...    34   3.2     
sp|P11309|PIM1_HUMAN|PIM1_HUMAN Proto-oncogene serine/threonine-protein kin...    34   3.2     
sp|Q9N0P9|PIM1_BOVIN|PIM1_BOVIN Proto-oncogene serine/threonine-protein kin...    34   3.2     
sp|Q8WXR4|MY3B_HUMAN|MY3B_HUMAN Myosin IIIB (EC 2.7.1.37).>gb:AF391555_1900...    34   3.2     
sp|Q13163|MPK5_HUMAN|MPK5_HUMAN Dual specificity mitogen-activated protein ...    34   3.2     
sp|P32491|MKK2_YEAST|MKK2_YEAST MAP kinase kinase MKK2/SSP33 (EC 2.7.1.-).>...    34   3.2     
sp|Q10407|MKH1_SCHPO|MKH1_SCHPO MAP kinase kinase kinase mkh1 (EC 2.7.1.-)....    34   3.2     
sp|P22517|KCC2_YEAST|KCC2_YEAST Calcium/calmodulin-dependent protein kinase...    34   3.2     
sp|P27466|KCC1_YEAST|KCC1_YEAST Calcium/calmodulin-dependent protein kinase...    34   3.2     
sp|Q8T0S6|HPO_DROME|HPO_DROME Serine/threonine-protein kinase hippo (EC 2....    34   3.2     
sp|Q01389|BCK1_YEAST|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/S...    34   3.2     
gb:BC068805_2555305 Xenopus laevis hypothetical protein MGC81395...    34   4.1     
gb:AJ720823_2503010 Gallus gallus mRNA for hypothetical protein,...    34   4.1     
gb:BT008276_2151208 Synthetic construct Homo sapiens STE20-like ...    34   4.1     
gb:AY335598_2144816 Synthetic construct Homo sapiens oxidative-s...    34   4.1     
gb:BC060645_2104112 Mus musculus oxidative-stress responsive 1, ...    34   4.1     
gb:AK129291_2069522 Mus musculus mRNA for mKIAA1101 protein.           34   4.1     
gb:AF263311_1893700 Homo sapiens STE20-like kinase mRNA, partial...    34   4.1     
gb:AF181985_1888451 Homo sapiens serine/threonine kinase (KDS) m...    34   4.1     
gb:AF179867_1888382 Homo sapiens STE20-like kinase (JIK) mRNA, c...    34   4.1     
gb:AF135158_1885685 Homo sapiens serine kinase mRNA, complete cd...    34   4.1     
gb:AF087893_1881907 Homo sapiens DCHT2 mRNA, complete cds.             34   4.1     
gb:AB029024_1865880 Homo sapiens mRNA for KIAA1101 protein, part...    34   4.1     
gb:AB017642_1864871 Homo sapiens mRNA for oxidative-stress respo...    34   4.1     


>gb:AY500155_1609647 Nicotiana benthamiana MAP3Ka mRNA, complete
           cds.
          Length = 611

 Score =  103 bits (258), Expect(2) = 2e-34
 Identities = 63/152 (41%), Positives = 85/152 (55%)
 Frame = -1

Query: 774 LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR 595
           +K ++  K+ H  V  E  PRSFDG+ TPP    +L    RN +   G+YA + ++ + R
Sbjct: 463 VKNQSTTKVTHVGVTKEAYPRSFDGNRTPP----VLDSGGRNISPTKGNYASHPVITISR 518

Query: 594 PMISSRDNAKTITXXXXXXXXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD 415
           P+   R+  KTIT             R  E ARRSCYLSPP+P+ Y     + +  N  D
Sbjct: 519 PLSCPREIVKTITSLPVSPTSSPL--RQYEPARRSCYLSPPHPA-YGIGGHSGYDEN--D 573

Query: 414 YSSTFAARVNTRNTLDPWLDIPQYRTQTPGRS 319
           Y   F AR  TRNTL+PWL+IPQ++ QTP RS
Sbjct: 574 YLM-FQARPTTRNTLEPWLEIPQFKVQTPSRS 604



 Score = 65.5 bits (158), Expect(2) = 2e-34
 Identities = 28/38 (73%), Positives = 37/38 (97%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           ++AK+FI+ CLQREPSARPTASQLL+HPF+K+Q+T+KV
Sbjct: 434 NDAKNFIKLCLQREPSARPTASQLLEHPFVKNQSTTKV 471



>gb:AY500156_1609648 Lycopersicon esculentum MAP3Ka mRNA, complete
           cds.
          Length = 614

 Score =  103 bits (257), Expect = 4e-21
 Identities = 70/158 (44%), Positives = 89/158 (56%), Gaps = 6/158 (3%)
 Frame = -1

Query: 774 LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQR------NFASLDGDYAVNH 613
           +K ++  K+ H  V  E   RSFDGS TPP  LEL HP  R      N +  +G+YA + 
Sbjct: 458 VKNQSTAKVAHVGVTKESYLRSFDGSRTPPV-LEL-HPGGRTISPGRNISPAEGNYASHP 515

Query: 612 MVNVFRPMISSRDNAKTITXXXXXXXXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQF 433
           ++ V RP+I +R+N K IT             R  E AR+SCYLSPP+ SSY      Q 
Sbjct: 516 VITVSRPLICARENVKAITSLPVSPTSSPL--RQYEPARKSCYLSPPH-SSYG--IGGQS 570

Query: 432 GNNHPDYSSTFAARVNTRNTLDPWLDIPQYRTQTPGRS 319
           G    DYS  F  R +TR TL+PWL+IP +RTQTP RS
Sbjct: 571 GYEANDYSM-FQTRPSTRITLEPWLEIPHFRTQTPSRS 607



 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 29/39 (74%), Positives = 37/39 (94%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           ++AKSFIR CLQREPS RPTAS+LL+HPF+K+Q+T+KVA
Sbjct: 429 NDAKSFIRSCLQREPSLRPTASKLLEHPFVKNQSTAKVA 467



>gb:BNA010091_1633259 Brassica napus mRNA for MAP3K alpha 1 protein
           kinase.
          Length = 591

 Score = 50.8 bits (120), Expect(2) = 3e-11
 Identities = 20/31 (64%), Positives = 28/31 (90%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           ++AK+FIR CLQR P+ RPTA+QLL+HPF++
Sbjct: 428 NDAKNFIRLCLQRNPTVRPTAAQLLEHPFLR 458



 Score = 40.0 bits (92), Expect(2) = 3e-11
 Identities = 39/143 (27%), Positives = 60/143 (41%), Gaps = 1/143 (0%)
 Frame = -1

Query: 753 KLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMIS-SR 577
           ++ + ++  +V PR +DGS + P                +  Y+  H V  F P+ S SR
Sbjct: 463 RVANTSMHKDVPPRPYDGSSSMPTR--------------EPPYSGRHPV--FHPIKSPSR 506

Query: 576 DNAKTITXXXXXXXXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFA 397
           +N + IT             R    A +SC+LSPP+PS  + F   + G NH    + FA
Sbjct: 507 ENVRAITSLPVSPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPVQESGYNH---QAEFA 559

Query: 396 ARVNTRNTLDPWLDIPQYRTQTP 328
           A           ++   YR Q P
Sbjct: 560 ASPFRFKKDTSLIEPSSYRAQAP 582



>gb:AF419572_1798434 Arabidopsis thaliana At1g53570/F22G10_18 mRNA,
           complete cds.
          Length = 609

 Score = 55.5 bits (132), Expect(2) = 5e-11
 Identities = 25/39 (64%), Positives = 34/39 (87%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct: 441 NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA 477



 Score = 34.7 bits (78), Expect(2) = 5e-11
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 2/132 (1%)
 Frame = -1

Query: 717 PRSFDGSCTPPAALELLHPSQRNFASL--DGDYAVNHMVNVFRPMISSRDNAKTITXXXX 544
           PRS+DG+ +       L P++  +       +YA   +    +    SR+N + IT    
Sbjct: 487 PRSYDGNFS-------LQPTREPYPGRLSHDNYAKQPLSRTIKS--PSRENVRAITSLPV 537

Query: 543 XXXXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRNTLDP 364
                    R    A +SC+LSPP+PS  + F     G N  +++++       R   D 
Sbjct: 538 SPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPGQDSGYNLAEFAAS-----PFRMKKDA 588

Query: 363 WLDIPQYRTQTP 328
            ++   +RTQTP
Sbjct: 589 MMEPSSFRTQTP 600



>pir|G96575|G96575 probable MEK kinase MAP3Ka, 84794-81452
           [imported] - Arabidopsis thaliana>gb:AE005173_893257
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539301 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.>gb:AY140005_1582446 Arabidopsis thaliana MAP3K
           alpha protein kinase, putative (At1g53570) mRNA,
           complete cds.>gb:BT002598_1636201 Arabidopsis thaliana
           MAP3K alpha protein kinase, putative (At1g53570) mRNA,
           complete cds.>gb:T3F20_1724038 Sequence of BAC T3F20
           from Arabidopsis thaliana chromosome 1, complete
           sequence.
          Length = 608

 Score = 55.5 bits (132), Expect(2) = 5e-11
 Identities = 25/39 (64%), Positives = 34/39 (87%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct: 441 NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA 477



 Score = 34.7 bits (78), Expect(2) = 5e-11
 Identities = 34/130 (26%), Positives = 57/130 (43%)
 Frame = -1

Query: 717 PRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFRPMISSRDNAKTITXXXXXX 538
           PRS+DG+ + P      +P + +      +YA   +    +    SR+N + IT      
Sbjct: 487 PRSYDGNFSLPTREP--YPGRLSH----DNYAKQPLSRTIKS--PSRENVRAITSLPVSP 538

Query: 537 XXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRNTLDPWL 358
                  R    A +SC+LSPP+PS  + F     G N  +++++       R   D  +
Sbjct: 539 CSSPL--RQLGPAYKSCFLSPPHPS--YAFPGQDSGYNLAEFAAS-----PFRMKKDAMM 589

Query: 357 DIPQYRTQTP 328
           +   +RTQTP
Sbjct: 590 EPSSFRTQTP 599



>gb:ATU58918_1557105 Arabidopsis thaliana MEK kinase (MAP3Ka) mRNA,
           complete cds.
          Length = 608

 Score = 55.5 bits (132), Expect(2) = 7e-11
 Identities = 25/39 (64%), Positives = 34/39 (87%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct: 440 NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA 476



 Score = 34.3 bits (77), Expect(2) = 7e-11
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 2/132 (1%)
 Frame = -1

Query: 717 PRSFDGSCTPPAALELLHPSQRNFASL--DGDYAVNHMVNVFRPMISSRDNAKTITXXXX 544
           PRS+DG+ +       L P++  +       +YA   +    +    SR+N + IT    
Sbjct: 486 PRSYDGNFS-------LQPTREPYPGRLSHDNYAKQPLSRTIKS--PSRENVRPITSLPV 536

Query: 543 XXXXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRNTLDP 364
                    R    A +SC+LSPP+PS  + F     G N  +++++       R   D 
Sbjct: 537 SPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPGQDSGYNLAEFAAS-----PFRMKKDA 587

Query: 363 WLDIPQYRTQTP 328
            ++   +RTQTP
Sbjct: 588 MMEPSSFRTQTP 599



>pir|T51625|T51625 MAP3K alpha protein kinase (EC 2.7.1.-)
           [imported] - Arabidopsis thaliana>gb:ATH010090_1551887
           Arabidopsis thaliana mRNA for MAP3K alpha protein
           kinase.
          Length = 582

 Score = 55.5 bits (132), Expect(2) = 7e-11
 Identities = 25/39 (64%), Positives = 34/39 (87%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           ++AK+FIR CLQR P+ RPTASQLL+HPF++  NT++VA
Sbjct: 414 NDAKNFIRLCLQRNPTVRPTASQLLEHPFLR--NTTRVA 450



 Score = 34.3 bits (77), Expect(2) = 7e-11
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 2/132 (1%)
 Frame = -1

Query: 717 PRSFDGSCTPPAALELLHPSQRNFASL--DGDYAVNHMVNVFRPMISSRDNAKTITXXXX 544
           PRS+DG+ +       L P++  +       +YA   +    +    SR+N + IT    
Sbjct: 460 PRSYDGNFS-------LQPTREPYPGRLSHDNYAKQPLSRTIKS--PSRENVRPITSLPV 510

Query: 543 XXXXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPDYSSTFAARVNTRNTLDP 364
                    R    A +SC+LSPP+PS  + F     G N  +++++       R   D 
Sbjct: 511 SPCSSPL--RQLGPAYKSCFLSPPHPS--YAFPGQDSGYNLAEFAAS-----PFRMKKDA 561

Query: 363 WLDIPQYRTQTP 328
            ++   +RTQTP
Sbjct: 562 MMEPSSFRTQTP 573



>gb:AB167408_1528748 Lotus corniculatus var. japonicus LjM3Kalpha
           mRNA for mitogen-activated kinase kinase kinase alpha,
           complete cds.
          Length = 627

 Score = 63.5 bits (153), Expect = 5e-09
 Identities = 43/155 (27%), Positives = 71/155 (45%)
 Frame = -1

Query: 774 LKTKTHQKLPHRNVINEVQPRSFDGSCTPPAALELLHPSQRNFASLDGDYAVNHMVNVFR 595
           ++ ++  K+ + ++  +  P   DGS TPP      H ++ +  +LD DYA    +   R
Sbjct: 477 IRDQSATKVANASITRDAFPYMSDGSRTPPVLEP--HSNRSSITTLDVDYATKPALAAVR 534

Query: 594 PMISSRDNAKTITXXXXXXXXXXXLRRHSEEARRSCYLSPPNPSSYHPFATTQFGNNHPD 415
            + + RD+ +TIT             R       S + SPP+PS Y     + + +N+  
Sbjct: 535 TLRNPRDSTRTITSLPVSPSSSPL--RQHRPTHNSPFFSPPHPS-YAMMGQSSYTSNNMH 591

Query: 414 YSSTFAARVNTRNTLDPWLDIPQYRTQTPGRSSTR 310
            +    AR N   TLDPWL+  +Y+  TP   S R
Sbjct: 592 KNP---ARSNATLTLDPWLETSRYKAHTPPGGSPR 623



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 25/38 (65%), Positives = 33/38 (86%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           +AK+FI+ CLQR+P ARPTA  LL+HPFI+DQ+ +KVA
Sbjct: 449 DAKNFIKQCLQRDPLARPTAQSLLNHPFIRDQSATKVA 486



>gb:AF172282_1774428 Oryza sativa adh1-adh2 region.
          Length = 653

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 21/31 (67%), Positives = 30/31 (96%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           EAK+F++ CLQR+P+ARPTA+QL++HPF+KD
Sbjct: 475 EAKNFLKLCLQRDPAARPTAAQLMEHPFVKD 505



>gb:OSJN00024_1693491 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0006B20, complete sequence.
          Length = 709

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 20/40 (50%), Positives = 31/40 (77%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS 740
           E KSF++ CL+R+P++R TA+QL+DHPF++D    + A S
Sbjct: 532 EGKSFLQMCLKRDPASRFTATQLMDHPFVQDHPAVRAAKS 571



>gb:AY357949_1601929 Arabidopsis thaliana ecotype C24 YDA
           (At1g63700) gene, complete cds.
          Length = 883

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 19/31 (61%), Positives = 25/31 (80%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E K F+R CLQR P+ RPTA+QLLDH F+++
Sbjct: 628 EGKDFVRKCLQRNPANRPTAAQLLDHAFVRN 658



>pir|A96662|A96662 hypothetical protein F24D7.11 [imported] -
           Arabidopsis thaliana>gb:AE005173_894034 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011622_1537269 Arabidopsis thaliana
           chromosome 1 BAC F24D7 genomic sequence, complete
           sequence.>gb:AY357947_1601927 Arabidopsis thaliana
           ecotype Columbia YDA (At1g63700) mRNA, complete
           cds.>gb:AY357948_1601928 Arabidopsis thaliana ecotype
           Landsberg erecta YDA (At1g63700) gene, complete cds.
          Length = 883

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 19/31 (61%), Positives = 25/31 (80%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E K F+R CLQR P+ RPTA+QLLDH F+++
Sbjct: 628 EGKDFVRKCLQRNPANRPTAAQLLDHAFVRN 658



>gb:AY093683_1575362 Suaeda maritima subsp. salsa mitogen-activated
           protein kinase kinase mRNA, complete cds.
          Length = 520

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 22/38 (57%), Positives = 26/38 (68%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SE  SF+  CLQ++P ARPTA QLL HPFI     S+V
Sbjct: 310 SEFCSFVDVCLQKDPEARPTAEQLLSHPFITKYKDSQV 347



>gb:AC090713_1734433 Oryza sativa chromosome 3 BAC OSJNBa0002J24
           genomic sequence, complete sequence.
          Length = 847

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 18/33 (54%), Positives = 25/33 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQN 761
           E K F+R C +R P+ RPTAS+LL+HPF+ + N
Sbjct: 688 EGKEFLRCCFRRNPAERPTASKLLEHPFVHNSN 720



>gb:OSJN00087_1694651 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K11, complete sequence.
          Length = 894

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 19/28 (67%), Positives = 23/28 (82%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K FIR CLQR+PS RPTA +LL HPF++
Sbjct: 639 KDFIRKCLQRDPSQRPTAMELLQHPFVQ 666



>pir|T51338|T51338 mitogen-activated protein kinase kinase (EC
           2.7.1.-) 3 [imported] - Arabidopsis
           thaliana>gb:AB006702_1509952 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MPO12.>gb:AB015314_1512460 Arabidopsis thaliana
           ATMKK3 mRNA for MAP kinase kinase 3, complete
           cds.>gb:BT006481_1639368 Arabidopsis thaliana At5g40440
           gene, complete cds.>gb:AK117136_1815183 Arabidopsis
           thaliana At5g40440 mRNA for putative MAP kinase kinase 3
           (ATMKK3), complete cds, clone: RAFL16-67-G17.
          Length = 520

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 20/34 (58%), Positives = 23/34 (67%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SFI  CLQ++P ARPTA QLL HPFI      +V
Sbjct: 314 SFIDACLQKDPDARPTADQLLSHPFITKHEKERV 347



>gb:AP003810_1833696 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1119_A04.>gb:AP004262_1839334 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0022B05.
          Length = 736

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 17/33 (51%), Positives = 26/33 (78%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQN 761
           E K F++ C +R P+ RPTAS+LL+HPFI++ +
Sbjct: 590 EGKDFLQFCFKRNPAERPTASELLEHPFIRNSS 622



>gb:AE016959_1020797 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092553_1735429
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBb0072F04, complete
           sequence.>gb:AC122147_1740294 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OSJNAb0072F04,
           complete sequence.>gb:AE017053_1750616 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 7 of 77
           of the complete sequence.
          Length = 526

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 20/29 (68%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           EAK F+R CLQR    RPTA+QLL HPFI
Sbjct: 240 EAKDFLRGCLQRRAGDRPTAAQLLQHPFI 268



>gb:AX048730_1458082 Sequence 1 from Patent WO0070059.
          Length = 436

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 18/33 (54%), Positives = 25/33 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQN 761
           E K F+R C +R P+ RPTA++LL+HPFI+  N
Sbjct: 287 EGKDFLRCCFKRNPTERPTANKLLEHPFIQTLN 319



>gb:AB000798_1508429 Arabidopsis thaliana mRNA for NPK1-related
           protein kinase 2, partial cds.
          Length = 642

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 18/30 (60%), Positives = 24/30 (80%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S+A  F+  CLQ+EP+ RPTAS+LL HPF+
Sbjct: 292 SDANDFLLKCLQQEPNLRPTASELLKHPFV 321



>gb:DDU87912_1377448 Dictyostelium discoideum MAP kinase kinase
           protein DdMEK1 (mekA) mRNA, complete cds.
          Length = 660

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/30 (63%), Positives = 24/30 (80%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           E +SFI  CLQ+EP+ RPTAS LL+H F+K
Sbjct: 613 EFRSFISECLQKEPTERPTASNLLNHEFVK 642



>sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase
           2 (EC 2.7.1.-) (Arabidospsis NPK1-related protein kinase
           2).>pir|A96591|A96591 NPK1-related protein kinase 2
           [imported] - Arabidopsis thaliana>gb:AE005173_893381
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC064840_1540259 Arabidopsis thaliana
           chromosome I BAC T24C10 genomic sequence, complete
           sequence.
          Length = 651

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 18/30 (60%), Positives = 24/30 (80%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S+A  F+  CLQ+EP+ RPTAS+LL HPF+
Sbjct: 301 SDANDFLLKCLQQEPNLRPTASELLKHPFV 330



>gb:AP004139_1838159 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1486_E07.>gb:AP005108_1847984 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0461B08.
          Length = 894

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 19/31 (61%), Positives = 23/31 (74%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E + FIR CLQR PS+RPTA  LL H FI++
Sbjct: 637 EGRDFIRQCLQRNPSSRPTAVDLLQHSFIRN 667



>gb:AY057533_1563951 Arabidopsis thaliana AT5g66850/MUD21_11 mRNA,
           complete cds.
          Length = 716

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E K F+R C QR P+ RPTAS LL+H F+K+
Sbjct: 579 EGKDFLRLCFQRNPAERPTASMLLEHRFLKN 609



>gb:AY040040_1560539 Arabidopsis thaliana putative MAP protein
           kinase (At5g66850) mRNA, complete
           cds.>gb:AF360242_1791194 Arabidopsis thaliana putative
           MAP protein kinase (At5g66850) mRNA, complete cds.
          Length = 716

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E K F+R C QR P+ RPTAS LL+H F+K+
Sbjct: 579 EGKDFLRLCFQRNPAERPTASMLLEHRFLKN 609



>gb:ATY14316_1557514 Arabidopsis thaliana mRNA for MAP3K gamma
           protein kinase.
          Length = 372

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E K F+R C QR P+ RPTAS LL+H F+K+
Sbjct: 235 EGKDFLRLCFQRNPAERPTASMLLEHRFLKN 265



>gb:ATCRK_1548021 A.thaliana mRNA for CDPK-related protein
           kinase.>gb:AF435446_1799826 Arabidopsis thaliana
           calcium/calmodulin-dependent protein kinase CaMK1 mRNA,
           complete cds.
          Length = 601

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 19/38 (50%), Positives = 27/38 (71%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SEA+ F++  L ++P  R TA+Q L HP+IKD N +KV
Sbjct: 381 SEARDFVKRLLNKDPRKRLTAAQALSHPWIKDSNDAKV 418



>gb:AB010700_1511262 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUD21.
          Length = 376

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E K F+R C QR P+ RPTAS LL+H F+K+
Sbjct: 239 EGKDFLRLCFQRNPAERPTASMLLEHRFLKN 269



>gb:AE016959_1020798 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC092553_1735430
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNBb0072F04, complete
           sequence.>gb:AC122147_1740295 Oryza sativa (japonica
           cultivar-group) chromosome 10 clone OSJNAb0072F04,
           complete sequence.>gb:AE017053_1750617 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 7 of 77
           of the complete sequence.
          Length = 525

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/29 (62%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           EAK F+R C+QR    RPTA+QLL HPF+
Sbjct: 244 EAKDFLRRCMQRRAGDRPTAAQLLQHPFV 272



>pir|T46084|T46084 CDPK-related protein kinase - Arabidopsis
           thaliana>gb:ATT20E23_1554940 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20E23.
          Length = 601

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 19/38 (50%), Positives = 27/38 (71%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SEA+ F++  L ++P  R TA+Q L HP+IKD N +KV
Sbjct: 381 SEARDFVKRLLNKDPRKRLTAAQALSHPWIKDSNDAKV 418



>pir|T52621|T52621 mitogen-activated protein kinase MAP3K [imported]
           - Arabidopsis thaliana (fragment)
          Length = 372

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 18/31 (58%), Positives = 23/31 (74%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E K F+R C QR P+ RPTAS LL+H F+K+
Sbjct: 235 EGKDFLRLCFQRNPAERPTASMLLEHRFLKN 265



>gb:AE017349_1758910 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 362

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 17/39 (43%), Positives = 27/39 (69%)
 Frame = -3

Query: 856 AKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS 740
           A+ F+R CL  +P+ RPT  +LL+HP+++D   SK  P+
Sbjct: 244 ARQFVRDCLTVDPTNRPTVDELLNHPWLRDVEASKDEPA 282



>gb:BX842680_1644227 Neurospora crassa DNA linkage group I cosmid
           contig 90C4.
          Length = 809

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/28 (64%), Positives = 21/28 (75%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K FI  CLQR+P  RPTA +LL HPFI+
Sbjct: 244 KDFIELCLQRDPKERPTARELLKHPFIR 271



>gb:AB000797_1508428 Arabidopsis thaliana mRNA for NPK1-related
           protein kinase 1S, complete cds.
          Length = 376

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S+AK F+  CLQ  P+ RPTAS+LL HPF+
Sbjct: 302 SDAKDFLLKCLQEVPNLRPTASELLKHPFV 331



>gb:AB000796_1508427 Arabidopsis thaliana mRNA for NPK1-related
           protein kinase 1L, partial cds.
          Length = 661

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S+AK F+  CLQ  P+ RPTAS+LL HPF+
Sbjct: 297 SDAKDFLLKCLQEVPNLRPTASELLKHPFV 326



>sp|O22040|M3K1_ARATH Mitogen-activated protein kinase kinase kinase
           1 (EC 2.7.1.-) (Arabidospsis NPK1-related protein kinase
           1).>gb:BT005949_1638871 Arabidopsis thaliana At1g09000
           gene, complete cds.>gb:AK117282_1815323 Arabidopsis
           thaliana At1g09000 mRNA for putative NPK1-related
           protein kinase 1S (ANP1), complete cds, clone:
           RAFL16-83-P07.
          Length = 666

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S+AK F+  CLQ  P+ RPTAS+LL HPF+
Sbjct: 302 SDAKDFLLKCLQEVPNLRPTASELLKHPFV 331



>gb:AP005312_1850405 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0505H05.
          Length = 674

 Score = 42.7 bits (99), Expect = 0.009
 Identities = 18/33 (54%), Positives = 23/33 (69%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQN 761
           EAK F+  CLQ+EP  R TAS LL HPF+  ++
Sbjct: 336 EAKDFLLKCLQKEPELRSTASDLLKHPFVTGES 368



>gb:BC055124_2551212 Danio rerio zgc:63495, mRNA (cDNA clone
           MGC:63495 IMAGE:2639997), complete cds.
          Length = 974

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 16/32 (50%), Positives = 23/32 (71%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           F++  L R P  RPTA+QLL+HPF+   NT++
Sbjct: 271 FLKKALDRHPETRPTAAQLLEHPFVSSVNTNR 302



>gb:AP004017_1836428 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1008_F08.
          Length = 735

 Score = 42.4 bits (98), Expect = 0.012
 Identities = 20/43 (46%), Positives = 28/43 (65%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*CN 731
           E K F+  CL+R+P  RP+A+ LL HPF+ D    + AP+ CN
Sbjct: 508 EGKDFLSLCLKRDPVQRPSAASLLGHPFVHDHQAVR-APT-CN 548



>gb:AF214654_1777853 Arthrobotrys dactyloides calmodulin-binding
           protein kinase mRNA, complete cds.
          Length = 373

 Score = 41.6 bits (96), Expect = 0.020
 Identities = 19/37 (51%), Positives = 23/37 (62%)
 Frame = -3

Query: 856 AKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           AK FIR CL  +P ARPTA   L+HPFI +    + A
Sbjct: 261 AKDFIRRCLTIDPKARPTAHAALEHPFICEDQPEREA 297



>gb:AE016819_1748621 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 691

 Score = 41.6 bits (96), Expect = 0.020
 Identities = 16/31 (51%), Positives = 24/31 (77%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           S+A+ F+R CLQ+ P  RPT + LL+HP++K
Sbjct: 610 SDAQDFVRLCLQKIPERRPTYASLLEHPWLK 640



>gb:CR382128_1661001 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 726

 Score = 41.6 bits (96), Expect = 0.020
 Identities = 16/30 (53%), Positives = 23/30 (76%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           EA+ F+  CLQ++P  RPT  QLL+HP++K
Sbjct: 629 EARDFVAQCLQKKPYQRPTYQQLLEHPWLK 658



>gb:AP005301_1850176 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0077M12.
          Length = 690

 Score = 41.2 bits (95), Expect = 0.026
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           EAK F+  CLQ+EP  R TAS LL HPF+
Sbjct: 362 EAKDFLLKCLQKEPELRSTASDLLLHPFV 390



>gb:AP004738_1844097 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0090D06.
          Length = 314

 Score = 41.2 bits (95), Expect = 0.026
 Identities = 15/29 (51%), Positives = 23/29 (79%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E +SF+  CLQ+ P+ RP+A+QL+ HPF+
Sbjct: 271 EFRSFVGYCLQKNPAKRPSAAQLMQHPFV 299



>gb:AP004738_1844096 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0090D06.
          Length = 342

 Score = 41.2 bits (95), Expect = 0.026
 Identities = 15/29 (51%), Positives = 23/29 (79%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E +SF+  CLQ+ P+ RP+A+QL+ HPF+
Sbjct: 299 EFRSFVGYCLQKNPAKRPSAAQLMQHPFV 327



>gb:AY691331_1622564 Lycopersicon esculentum MAPKK (LeMKK2) mRNA,
           complete cds.
          Length = 359

 Score = 41.2 bits (95), Expect = 0.026
 Identities = 19/34 (55%), Positives = 23/34 (67%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT 758
           E + FI  CLQR+P+ R TA QLL HPFI   +T
Sbjct: 297 EFREFIACCLQRDPARRWTAGQLLRHPFITQNST 330



>pir|T51735|T51735 mitogen-activated protein kinase kinase (EC
           2.7.1.-) 2k-beta [imported] - Arabidopsis
           thaliana>gb:ATH6871_1552942 Arabidopsis thaliana mRNA
           for MAP2k beta kinase.>gb:AF067792_1765620 Arabidopsis
           thaliana MAP kinase kinase 1 (MK1) mRNA, complete cds.
          Length = 363

 Score = 41.2 bits (95), Expect = 0.026
 Identities = 16/37 (43%), Positives = 26/37 (70%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           E  SFI  CLQ+EP++R +A +L++HPF+   + S +
Sbjct: 302 ELSSFISTCLQKEPNSRSSAKELMEHPFLNKYDYSGI 338



>gb:AF100165_2473636 Xenopus laevis polo-like kinase kinase 1
           (xPlkk1) mRNA, complete cds.
          Length = 950

 Score = 40.8 bits (94), Expect = 0.034
 Identities = 16/36 (44%), Positives = 25/36 (69%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E  SF++  L + P  RP+A+QLL+HPF+K  + +K
Sbjct: 266 EFHSFLKTALDKNPETRPSAAQLLEHPFVKKASGNK 301



>gb:AP004738_1844098 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0090D06.
          Length = 306

 Score = 40.8 bits (94), Expect = 0.034
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E +SF+  CLQ  P+ RP+A QL+DHPF+
Sbjct: 270 EFRSFVGCCLQMNPAKRPSAVQLMDHPFV 298



>gb:OSJN00039_1693730 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0032I19, complete sequence.
          Length = 148

 Score = 40.8 bits (94), Expect = 0.034
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           EA+ FI  CL+  P  RP+AS+LLDHPF+
Sbjct: 114 EARDFISQCLRPYPDDRPSASKLLDHPFV 142



>gb:MMU85608_2123692 Mus musculus MEK kinase 4b (MEKK4b) mRNA,
            complete cds.
          Length = 1545

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
            E K+F+  CL+ +P  R TASQLLDH F+K
Sbjct: 1510 EGKAFLSHCLESDPKIRWTASQLLDHAFVK 1539



>gb:BC058719_2103443 Mus musculus mitogen activated protein kinase
            kinase kinase 4, mRNA (cDNA clone MGC:77966
            IMAGE:5705378), complete cds.
          Length = 1597

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
            E K+F+  CL+ +P  R TASQLLDH F+K
Sbjct: 1562 EGKAFLSHCLESDPKIRWTASQLLDHAFVK 1591



>gb:AK122219_2068884 Mus musculus mRNA for mKIAA0213 protein.
          Length = 1502

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
            E K+F+  CL+ +P  R TASQLLDH F+K
Sbjct: 1467 EGKAFLSHCLESDPKIRWTASQLLDHAFVK 1496



>gb:AE017341_1754573 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 609

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 14/29 (48%), Positives = 23/29 (79%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A  F+  CL+++P+ RPT +QLL+HPF+
Sbjct: 541 DANDFVAKCLEKDPNRRPTYAQLLEHPFL 569



>gb:MVA293274_1687747 Medicago sativa subsp. x varia mRNA for MEK
           map kinase kinase (simkk gene).
          Length = 368

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E + F+  CLQR+PS R TAS+LL HPF+
Sbjct: 313 EFRDFVSRCLQRDPSRRWTASRLLSHPFL 341



>gb:CR382123_1655501 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 483

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K FIR CLQ++P+ RPT  QLL H ++K
Sbjct: 250 KDFIRSCLQQDPNQRPTCKQLLQHKWLK 277



>gb:AF485269_1188174 Mus musculus strain C57BL/6J chromosome 17 clone
            210d4, *** SEQUENCING IN PROGRESS ***, 6 ordered pieces.
          Length = 1501

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
            E K+F+  CL+ +P  R TASQLLDH F+K
Sbjct: 1466 EGKAFLSHCLESDPKIRWTASQLLDHAFVK 1495



>sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4
            (EC 2.7.1.-) (MAPK/ERK kinase kinase 4) (MEK kinase 4)
            (MEKK 4).>gb:MMU85607_2123691 Mus musculus MEK kinase 4a
            (MEKK4a) mRNA, complete cds.
          Length = 1597

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
            E K+F+  CL+ +P  R TASQLLDH F+K
Sbjct: 1562 EGKAFLSHCLESDPKIRWTASQLLDHAFVK 1591



>gb:BC073247_2557099 Xenopus laevis hypothetical protein LOC443633,
           mRNA (cDNA clone IMAGE:5505767), partial cds.
          Length = 315

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RPT  QL+ HPFI+DQ
Sbjct: 263 QSFIDSCLVKNHSQRPTTDQLMKHPFIRDQ 292



>gb:BC072290_2556542 Xenopus laevis hypothetical protein LOC432186,
           mRNA (cDNA clone IMAGE:4884639), partial cds.
          Length = 383

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 15/27 (55%), Positives = 21/27 (77%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           FI+ CLQ+ P  RP+A QLL HPF+++
Sbjct: 336 FIKKCLQKNPDWRPSAEQLLSHPFVRN 362



>gb:AY335639_2144857 Synthetic construct Homo sapiens hypothetical
           protein FLJ90524 (FLJ90524) mRNA, partial cds.
          Length = 403

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 2/37 (5%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD--QNTSKVAP 743
           F+  CLQR P ARP+AS LL+H F K   +  S+V P
Sbjct: 326 FVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEVLP 362



>gb:D86968_1995185 Homo sapiens mRNA for KIAA0213 gene, partial cds.
          Length = 1626

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
            E K F+  CL+ +P  R TASQLLDH F+K
Sbjct: 1591 EGKDFLSHCLESDPKMRWTASQLLDHSFVK 1620



>gb:AF308302_1896090 Homo sapiens serologically defined breast
           cancer antigen NY-BR-96 mRNA, complete cds.
          Length = 431

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 2/37 (5%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD--QNTSKVAP 743
           F+  CLQR P ARP+AS LL+H F K   +  SK  P
Sbjct: 355 FVEQCLQRNPDARPSASTLLNHSFFKQIKRRASKALP 391



>gb:AP004057_1837038 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1316_E06.>gb:AP005535_1853668 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0054K20.
          Length = 369

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E KSFI  CLQ+ P+ RP+A+QLL H F+
Sbjct: 322 EFKSFISCCLQKNPARRPSAAQLLQHRFV 350



>gb:AE016819_1749560 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 440

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 16/31 (51%), Positives = 23/31 (74%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           S A+ F+  CL ++PS RPTA++LL H F+K
Sbjct: 245 SHARDFVAQCLIKDPSQRPTAAELLKHRFVK 275



>gb:AF116604_1149868 Homo sapiens PRO0412 mRNA, complete cds.
          Length = 544

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           E K F+  CL+ +P  R TASQLLDH F+K
Sbjct: 509 EGKDFLSHCLESDPKMRWTASQLLDHSFVK 538



>pir|T02550|T02550 NPK1-related protein kinase homolog T26B15.7 -
           Arabidopsis thaliana>gb:AC004681_1532024 Arabidopsis
           thaliana chromosome 2 clone T26B15 map TEn5, complete
           sequence.
          Length = 372

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 17/29 (58%), Positives = 23/29 (79%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           EAK F+  CL+RE + R TA+QLL+HPF+
Sbjct: 231 EAKDFLEKCLKREANERWTATQLLNHPFL 259



>pir|T08542|T08542 mitogen-activated protein kinase kinase (EC
           2.7.1.-) 2 [similarity] - Arabidopsis
           thaliana>gb:AB015313_1512459 Arabidopsis thaliana ATMKK2
           mRNA for MAP kinase kinase 2, complete
           cds.>gb:ATCHRIV71_1546902 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           71.>gb:ATF27B13_1550187 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F27B13 (ESSA
           project).>gb:AY078009_1567978 Arabidopsis thaliana
           AT4g29810/F27B13_50 mRNA, complete
           cds.>gb:AF385688_1794582 Arabidopsis thaliana
           AT4g29810/F27B13_50 mRNA, complete cds.
          Length = 363

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 15/37 (40%), Positives = 26/37 (70%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           E  SFI  CLQ++P++R +A +L++HPF+   + S +
Sbjct: 302 ELSSFISTCLQKDPNSRSSAKELMEHPFLNKYDYSGI 338



>sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4
            (EC 2.7.1.-) (MAPK/ERK kinase kinase 4) (MEK kinase 4)
            (MEKK 4) (MAP three kinase 1).>pir|T03022|T03022 MAP
            kinase kinase kinase - human>gb:AF002715_1875807 Homo
            sapiens MAP kinase kinase kinase (MTK1) mRNA, complete
            cds.
          Length = 1607

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
            E K F+  CL+ +P  R TASQLLDH F+K
Sbjct: 1572 EGKDFLSHCLESDPKMRWTASQLLDHSFVK 1601



>sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase
           3 (EC 2.7.1.-) (Arabidospsis NPK1-related protein kinase
           3).>gb:AB000799_1508430 Arabidopsis thaliana mRNA for
           NPK1-related protein kinase 3, complete
           cds.>gb:AC068073_1540333 Arabidopsis thaliana chromosome
           3 BAC F24F17 genomic sequence, complete
           sequence.>gb:AY069917_1566655 Arabidopsis thaliana
           AT3g06030/F24F17_1 mRNA, complete
           cds.>gb:BT001024_1635279 Arabidopsis thaliana
           At3g06030/F24F17_1 mRNA, complete cds.
          Length = 651

 Score = 40.0 bits (92), Expect = 0.058
 Identities = 16/29 (55%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           EAK F+  CL +EPS R +A++LL HPF+
Sbjct: 302 EAKDFLMKCLHKEPSLRLSATELLQHPFV 330



>gb:AC133334_1741354 Oryza sativa chromosome 3 BAC OSJNBa0004L11
           genomic sequence, complete sequence.
          Length = 654

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A+ FI  C+Q +P  RP+ASQL+ HPF+
Sbjct: 607 DAQDFISQCVQVDPEQRPSASQLMSHPFV 635



>gb:TOBPK_1725493 Tobacco mRNA for protein kinase, complete cds.
          Length = 690

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +E+K F+  CLQ+EP  R +AS LL HPF+
Sbjct: 313 AESKDFLLKCLQKEPHLRHSASNLLQHPFV 342



>gb:AB091780_1525067 Solanum tuberosum StMEK1 mRNA for
           mitogen-activated protein kinase kinase, complete cds.
          Length = 374

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 18/29 (62%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E + FI  CLQR+P+ R TA+QLL HPFI
Sbjct: 310 EFREFIACCLQRDPARRWTAAQLLRHPFI 338



>gb:LME243118_1387682 Leishmania mexicana mkk gene for putative
           mitogen-activated protein (MAP) kinase kinase.
          Length = 372

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 14/28 (50%), Positives = 21/28 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPF 776
           + K F++ CL+R+P ARPT ++LL H F
Sbjct: 291 DVKDFVKQCLERDPDARPTCAELLQHQF 318



>gb:LAM243183_1387092 Leishmania amazonensis mkk gene for putative
           mitogen-activated protein (MAP) kinase kinase.
          Length = 372

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 14/28 (50%), Positives = 21/28 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPF 776
           + K F++ CL+R+P ARPT ++LL H F
Sbjct: 291 DVKDFVKQCLERDPDARPTCAELLQHQF 318



>pir|A48084|A48084 STE11 protein kinase homolog NPK1 - common
           tobacco
          Length = 706

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +E+K F+  CLQ+EP  R +AS LL HPF+
Sbjct: 329 AESKDFLLKCLQKEPHLRHSASNLLQHPFV 358



>pir|T01835|T01835 serine/threonine-specific protein kinase ARA.KIN
           homolog T15F16.3 - Arabidopsis
           thaliana>gb:ATCHRIV23_1544564 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 23.>gb:T15F16_1723493
           Arabidopsis thaliana BAC T15F16.
          Length = 773

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           +A+ FI  CL+  P  RPTA++LL+HPF++
Sbjct: 727 DARHFILKCLKLNPEERPTATELLNHPFVR 756



>pir|T02056|T02056 protein kinase MEK1 (EC 2.7.1.-) -
           maize>gb:ZMU83625_1732240 Zea mays protein kinase ZmMEK1
           mRNA, complete cds.
          Length = 355

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 15/27 (55%), Positives = 23/27 (85%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIK 770
           SFI  C+Q++P+ R +AS+LL+HPF+K
Sbjct: 305 SFISSCIQKDPAQRMSASELLNHPFLK 331



>sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase
           type I (EC 2.7.1.123) (CaMK-I).>pir|T50290|T50290
           calmodulin kinase i homolog. [imported] - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPACUNK12_1718542 S.pombe
           chromosome I cosmid Unknown (NOT c25D11).
          Length = 335

 Score = 39.7 bits (91), Expect = 0.075
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 2/41 (4%)
 Frame = -3

Query: 856 AKSFIRXCLQREPSARPTASQLLDHPFIKDQN--TSKVAPS 740
           AK FI+ CL+ +PS R TA+  L HPF+ ++   TS + P+
Sbjct: 264 AKDFIKKCLENDPSKRLTAADALKHPFLSEKRPATSNLLPN 304



>gb:AY335751_2144969 Synthetic construct Homo sapiens
           serine/threonine kinase 24 (STK24) mRNA, partial cds.
          Length = 432

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 248 KEFVEACLDKEPSFRPTAKELLKHKFI 274



>gb:BC004650_2089673 Mus musculus serine/threonine kinase 24 (STE20
           homolog, yeast), mRNA (cDNA clone MGC:6330
           IMAGE:3482980), complete cds.
          Length = 431

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 248 KEFVEACLNKEPSFRPTAKELLKHKFI 274



>gb:CR542227_1994452 Homo sapiens full open reading frame cDNA clone
           RZPDo834E0225D for gene STK24, serine/threonine kinase
           24 (STE20 homolog, yeast); complete cds, without
           stopcodon.
          Length = 431

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 248 KEFVEACLNKEPSFRPTAKELLKHKFI 274



>gb:BC065378_1986832 Homo sapiens serine/threonine kinase 24 (STE20
           homolog, yeast), mRNA (cDNA clone MGC:71165
           IMAGE:6598075), complete cds.
          Length = 431

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 248 KEFVEACLNKEPSFRPTAKELLKHKFI 274



>gb:AL137249_1919567 Human DNA sequence from clone RP11-111L24 on
           chromosome 13q31.3-32.3 Contains the 3' end of the FARP1
           gene for (chondrocyte-derived) FERM, RhoGEF (ARHGEF) and
           pleckstrin domain protein 1, a novel gene and the 3' end
           of the STK24 gene for serine/threonine kinase 24,
           complete sequence.>gb:AL356423_1924526 Human DNA
           sequence from clone RP11-295B17 on chromosome 13
           Contains the 5' end of the STK24 gene for
           serine/threonine kinase 24, a novel gene, a novel
           pseudogene, a cytochrome c pseudogene, a calmodulin 2
           (CALM2) pseudogene and a CpG island, complete sequence.
          Length = 368

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 165 KEFVEACLNKEPSFRPTAKELLKHKFI 191



>gb:AL137249_1919566 Human DNA sequence from clone RP11-111L24 on
           chromosome 13q31.3-32.3 Contains the 3' end of the FARP1
           gene for (chondrocyte-derived) FERM, RhoGEF (ARHGEF) and
           pleckstrin domain protein 1, a novel gene and the 3' end
           of the STK24 gene for serine/threonine kinase 24,
           complete sequence.
          Length = 209

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 49  KEFVEACLNKEPSFRPTAKELLKHKFI 75



>gb:AL137249_1919565 Human DNA sequence from clone RP11-111L24 on
           chromosome 13q31.3-32.3 Contains the 3' end of the FARP1
           gene for (chondrocyte-derived) FERM, RhoGEF (ARHGEF) and
           pleckstrin domain protein 1, a novel gene and the 3' end
           of the STK24 gene for serine/threonine kinase 24,
           complete sequence.>gb:AL356423_1924524 Human DNA
           sequence from clone RP11-295B17 on chromosome 13
           Contains the 5' end of the STK24 gene for
           serine/threonine kinase 24, a novel gene, a novel
           pseudogene, a cytochrome c pseudogene, a calmodulin 2
           (CALM2) pseudogene and a CpG island, complete
           sequence.>gb:BC035578_1981601 Homo sapiens
           serine/threonine kinase 24 (STE20 homolog, yeast), mRNA
           (cDNA clone MGC:45338 IMAGE:5539375), complete
           cds.>gb:BT019619_1991152 Homo sapiens serine/threonine
           kinase 24 (STE20 homolog, yeast) mRNA, complete cds.
          Length = 431

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 248 KEFVEACLNKEPSFRPTAKELLKHKFI 274



>gb:AF024636_1877194 Homo sapiens STE20-like kinase 3 (mst-3) mRNA,
           complete cds.
          Length = 431

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 248 KEFVEACLNKEPSFRPTAKELLKHKFI 274



>gb:AP004890_1846683 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0688H12.>gb:AP005612_1854921 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0073A18.
          Length = 453

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/30 (53%), Positives = 22/30 (73%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +E K F+  CL R+P+ R TA QLL+HPF+
Sbjct: 237 AEGKDFLARCLIRDPAKRWTAEQLLEHPFV 266



>gb:AF216314_1778078 Oryza sativa MAP kinase kinase 1 mRNA, complete
           cds.>gb:AP003077_1824669 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0520B06.>gb:AP003435_1829348 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0455H03.
          Length = 355

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 15/27 (55%), Positives = 23/27 (85%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIK 770
           +FI  C+Q++P+ R +AS+LL+HPFIK
Sbjct: 305 AFISSCIQKDPAERMSASELLNHPFIK 331



>gb:AF073893_1765941 Schizosaccharomyces pombe calmodulin kinase I
           homolog (cmk1) mRNA, complete cds.
          Length = 335

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 2/41 (4%)
 Frame = -3

Query: 856 AKSFIRXCLQREPSARPTASQLLDHPFIKDQN--TSKVAPS 740
           AK FI+ CL+ +PS R TA+  L HPF+ +    TS + P+
Sbjct: 264 AKDFIKKCLENDPSKRLTAADALKHPFLSENGPATSNLLPN 304



>gb:AE017347_1757925 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 517

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           + F+  CLQR+P  RPTA +LL H FIK
Sbjct: 244 RDFVSLCLQRDPRNRPTAKELLKHKFIK 271



>gb:MSA575100_1687043 Medicago sativa mRNA for putative
           mitogen-activated protein kinase 1 (mekk1 gene).
          Length = 592

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 3/42 (7%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK---DQNTSKVAP 743
           +A+ FI  CL+  P  RPTA+QLLDH F++    Q++   +P
Sbjct: 545 DARDFILQCLKVNPDDRPTAAQLLDHKFVQRSFSQSSGSASP 586



>gb:BNA010093_1633260 Brassica napus mRNA for MAP3K beta 1 protein
           kinase.
          Length = 575

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 14/30 (46%), Positives = 23/30 (76%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           + + FI  CL+ +P  RPTA++LL+HPF++
Sbjct: 525 DGRDFITECLKVDPEERPTAAELLNHPFVR 554



>gb:CR382398_1374882 Plasmodium falciparum chromosome 6, complete
           sequence; segment 1/5.
          Length = 353

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/36 (44%), Positives = 21/36 (58%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E K F+  CL + P  RPTA  L+ HPFI   N ++
Sbjct: 279 EFKDFLNLCLDKNPKKRPTAESLIQHPFIFIHNKNR 314



>gb:CEY59A8B_1370753 Caenorhabditis elegans YAC Y59A8B, complete
           sequence.
          Length = 545

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           K+ IR CLQ++P+ RPTAS+LL + F K     K
Sbjct: 309 KTLIRDCLQKDPAKRPTASELLKYSFFKKGKDKK 342



>gb:BT001630_1356403 Drosophila melanogaster RE38276 full insert
           cDNA.
          Length = 642

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K F+  CL ++P  RPTA +LL +PFIK
Sbjct: 237 KDFVEACLNKDPENRPTAKELLKYPFIK 264



>gb:AY741200_1349106 Caenorhabditis elegans STE20-like
           serine/threonine kinase (gck-3) mRNA, complete cds.
          Length = 596

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           K+ IR CLQ++P+ RPTAS+LL + F K     K
Sbjct: 360 KTLIRDCLQKDPAKRPTASELLKYSFFKKGKDKK 393



>gb:AF093689_1240446 Dictyostelium discoideum MEK kinase alpha
           (mkkA) mRNA, complete cds.
          Length = 942

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS 740
           EA  F+  C +R+P  RP A+QLL HPFI + + +   P+
Sbjct: 401 EAFDFLNLCFKRDPKERPDANQLLKHPFIMNLDDNIQLPT 440



>gb:AF006640_1231359 Drosophila melanogaster Ste20-like protein
           kinase mRNA, complete cds.
          Length = 552

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           +  I  CLQ+EPS RPTAS+LL H F K     K
Sbjct: 286 RKMIVECLQKEPSKRPTASELLKHAFFKKAKDRK 319



>gb:AE014297_1140216 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1140217 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003722_1222209
           Drosophila melanogaster chromosome 3R, section 60 of 118
           of the complete sequence.>gb:AE003722_1222210 Drosophila
           melanogaster chromosome 3R, section 60 of 118 of the
           complete sequence.>gb:BT003198_1356709 Drosophila
           melanogaster RE53265 full insert cDNA.
          Length = 552

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 18/34 (52%), Positives = 21/34 (61%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           +  I  CLQ+EPS RPTAS+LL H F K     K
Sbjct: 286 RKMIVECLQKEPSKRPTASELLKHAFFKKAKDRK 319



>gb:AE014297_1139989 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003716_1221982 Drosophila melanogaster
           chromosome 3R, section 54 of 118 of the complete
           sequence.
          Length = 642

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K F+  CL ++P  RPTA +LL +PFIK
Sbjct: 237 KDFVEACLNKDPENRPTAKELLKYPFIK 264



>gb:AE005172_890799 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC013354_1537902 Genomic sequence
           for Arabidopsis thaliana BAC F15H18 from chromosome I,
           complete sequence.
          Length = 307

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 17/31 (54%), Positives = 24/31 (77%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E +SF+  CL++E S R TASQLL HPF+++
Sbjct: 275 EFRSFVDCCLRKESSERWTASQLLGHPFLRE 305



>pir|T51339|T51339 mitogen-activated protein kinase kinase (EC
           2.7.1.-) 4 [validated] - Arabidopsis
           thaliana>gb:AE005173_893080 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AB015315_1512461 Arabidopsis thaliana
           ATMKK4 mRNA for MAP kinase kinase 4, complete
           cds.>gb:AC025294_1539397 Arabidopsis thaliana chromosome
           1 BAC F19C24 genomic sequence, complete
           sequence.>gb:AY129469_1581120 Arabidopsis thaliana
           At1g51660/F19C24_26 mRNA, complete
           cds.>gb:AF324667_1786379 Arabidopsis thaliana At1g51660
           (At1g51660/F19C24_26) mRNA, complete
           cds.>gb:AF326878_1786738 Arabidopsis thaliana putative
           MAP kinase kinase 4 (At1g51660) mRNA, complete
           cds.>gb:AF349517_1790204 Arabidopsis thaliana putative
           MAP kinase kinase 4 (ATMKK4) (At1g51660) mRNA, complete
           cds.>gb:AF375398_1792903 Arabidopsis thaliana
           At1g51660/F19C24_26 mRNA, complete cds.
          Length = 366

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 18/29 (62%), Positives = 20/29 (68%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E + FI  CLQREP  R +A QLL HPFI
Sbjct: 306 EFRHFISCCLQREPGKRRSAMQLLQHPFI 334



>sp|Q9SZ67|WR19_ARATH Probable WRKY transcription factor 19 (WRKY
            DNA-binding protein 19).>pir|T06609|T06609 disease
            resistance protein homolog F16J13.90 - Arabidopsis
            thaliana>gb:ATCHRIV33_1544967 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 33.>gb:ATF16J13_1548802
            Arabidopsis thaliana DNA chromosome 4, BAC clone F16J13
            (ESSA project).
          Length = 1895

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPFI 773
            +A+ FI  CL+  P  RPTA++LL+HPF+
Sbjct: 1849 DARDFILTCLKVNPEERPTAAELLNHPFV 1877



>sp|Q9Y6E0|ST24_HUMAN Serine/threonine-protein kinase 24 (EC
           2.7.1.37) (STE20-like kinase MST3) (MST-3) (Mammalian
           STE20-like protein kinase 3).>gb:AF083420_1881626 Homo
           sapiens brain-specific STE20-like protein kinase 3
           (STK3) mRNA, complete cds.>gb:AL137249_1919564 Human DNA
           sequence from clone RP11-111L24 on chromosome
           13q31.3-32.3 Contains the 3' end of the FARP1 gene for
           (chondrocyte-derived) FERM, RhoGEF (ARHGEF) and
           pleckstrin domain protein 1, a novel gene and the 3' end
           of the STK24 gene for serine/threonine kinase 24,
           complete sequence.>gb:AL356423_1924525 Human DNA
           sequence from clone RP11-295B17 on chromosome 13
           Contains the 5' end of the STK24 gene for
           serine/threonine kinase 24, a novel gene, a novel
           pseudogene, a cytochrome c pseudogene, a calmodulin 2
           (CALM2) pseudogene and a CpG island, complete sequence.
          Length = 443

 Score = 39.3 bits (90), Expect = 0.098
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H FI
Sbjct: 260 KEFVEACLNKEPSFRPTAKELLKHKFI 286



>gb:BC072113_2556376 Xenopus laevis hypothetical protein MGC79096,
           mRNA (cDNA clone MGC:79096 IMAGE:5048023), complete cds.
          Length = 493

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/31 (51%), Positives = 21/31 (67%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E   F++ CL + P  R TA+QLL HPFIK+
Sbjct: 249 EFTDFVKKCLVKNPEQRATATQLLQHPFIKN 279



>gb:BC081911_2108156 Rattus norvegicus protein kinase LYK5, mRNA
           (cDNA clone MGC:93856 IMAGE:7111907), complete cds.
          Length = 373

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIK 770
           +F+  CLQR P ARP AS LL+H F K
Sbjct: 296 NFVEQCLQRNPDARPNASTLLNHSFFK 322



>gb:AY327409_2083606 Rattus norvegicus protein kinase LYK5 (Lyk5)
           mRNA, complete cds.
          Length = 393

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIK 770
           +F+  CLQR P ARP AS LL+H F K
Sbjct: 316 NFVEQCLQRNPDARPNASTLLNHSFFK 342



>gb:AF172271_1887686 Homo sapiens Traf2 and NCK interacting kinase,
           splice variant 8 (TNIK) mRNA, complete cds.
          Length = 1268

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AF172270_1887685 Homo sapiens Traf2 and NCK interacting kinase,
           splice variant 7 (TNIK) mRNA, complete cds.
          Length = 1297

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AF172269_1887684 Homo sapiens Traf2 and NCK interacting kinase,
           splice variant 6 (TNIK) mRNA, complete cds.
          Length = 1323

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AF172268_1887683 Homo sapiens Traf2 and NCK interacting kinase,
           splice variant 5 (TNIK) mRNA, complete cds.
          Length = 1276

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AF172267_1887682 Homo sapiens Traf2 and NCK interacting kinase,
           splice variant 4 (TNIK) mRNA, complete cds.
          Length = 1352

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AF172266_1887681 Homo sapiens Traf2 and NCK interacting kinase,
           splice variant 3 (TNIK) mRNA, complete cds.
          Length = 1305

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AF172265_1887680 Homo sapiens Traf2 and NCK interacting kinase,
           splice variant 2 (TNIK) mRNA, complete cds.
          Length = 1331

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AB011123_1864283 Homo sapiens mRNA for KIAA0551 protein, partial
           cds.
          Length = 1385

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 288 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 317



>gb:AF391808_1795300 Zea mays chromosome 9S bz genomic region strain
           McC.
          Length = 406

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           E + FI  CLQ+ P+ R TA+QLL HPF+   +   +A
Sbjct: 364 EFRGFIACCLQKNPAKRLTAAQLLQHPFVAGPHPQPLA 401



>gb:AY062459_1565115 Arabidopsis thaliana Unknown protein
           (At4g08500; T15F16.5) mRNA, complete
           cds.>gb:BT000116_1634394 Arabidopsis thaliana Unknown
           protein (At4g08500) mRNA, complete cds.
          Length = 608

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           +A+ FI  CL+  P  RPTA++LL+HPF++
Sbjct: 559 DARLFILKCLKVNPEERPTAAELLNHPFVR 588



>gb:ATHATMEKK1_1553029 Arabidopsis thaliana mRNA for
           mitogen-activated protein kinase, complete cds.
          Length = 608

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           +A+ FI  CL+  P  RPTA++LL+HPF++
Sbjct: 559 DARLFILKCLKVNPEERPTAAELLNHPFVR 588



>gb:ATHARAK_1553012 Arabidopsis thaliana serine/threonine kinase
           (ARA.KIN) gene, 3' end of cds.
          Length = 497

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           +A+ FI  CL+  P  RPTA++LL+HPF++
Sbjct: 448 DARLFILKCLKVNPEERPTAAELLNHPFVR 477



>gb:CQ782708_1452108 Sequence 2848 from Patent
           EP1396543.>gb:AK074771_1912683 Homo sapiens cDNA
           FLJ90290 fis, clone NT2RP1001020, weakly similar to
           SERINE/THREONINE-PROTEIN KINASE PAK-BETA (EC 2.7.1.-).
          Length = 394

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIK 770
           F+  CLQR P ARP+AS LL+H F K
Sbjct: 318 FVEQCLQRNPDARPSASTLLNHSFFK 343



>gb:HSM803715_1187012 Homo sapiens mRNA; cDNA DKFZp667F1913 (from
           clone DKFZp667F1913).
          Length = 373

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIK 770
           F+  CLQR P ARP+AS LL+H F K
Sbjct: 297 FVEQCLQRNPDARPSASTLLNHSFFK 322



>gb:CR858650_1182809 Pongo pygmaeus mRNA; cDNA DKFZp459D2043 (from
           clone DKFZp459D2043).
          Length = 431

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIK 770
           F+  CLQR P ARP+AS LL+H F K
Sbjct: 355 FVEQCLQRNPDARPSASTLLNHSFFK 380



>gb:AK041777_1166106 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630036K03
           product:unclassifiable, full insert sequence.
          Length = 307

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AK039113_1165286 Mus musculus adult male hypothalamus cDNA,
           RIKEN full-length enriched library, clone:A230097O12
           product:unclassifiable, full insert sequence.
          Length = 327

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AK011451_1156409 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610019A05
           product:SEROLOGICALLY DEFINED BREAST CANCER ANTIGEN
           NY-BR-96 homolog [Homo sapiens], full insert
           sequence.>gb:AY341872_2083909 Mus musculus protein
           kinase LYK5 splice variant 1 mRNA, complete cds;
           alternatively spliced.>gb:BC058517_2103291 Mus musculus
           RIKEN cDNA 2610019A05 gene, mRNA (cDNA clone MGC:66772
           IMAGE:5717255), complete cds.
          Length = 394

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIK 770
           +F+  CLQR P ARP AS LL+H F K
Sbjct: 317 NFVEQCLQRNPDARPNASTLLNHSFFK 343



>pir|T01833|T01833 serine/threonine-specific protein kinase ARA.KIN
           (EC 2.7.1.-) - Arabidopsis thaliana>gb:ATCHRIV23_1544566
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 23.>gb:T15F16_1723491 Arabidopsis thaliana BAC
           T15F16.
          Length = 608

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           +A+ FI  CL+  P  RPTA++LL+HPF++
Sbjct: 559 DARLFILKCLKVNPEERPTAAELLNHPFVR 588



>pir|C86185|C86185 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889533 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY064039_1565977 Arabidopsis thaliana
           putative NPK1-related MAP kinase (At1g05100) mRNA,
           complete cds.>gb:AY091011_1574242 Arabidopsis thaliana
           putative NPK1-related MAP kinase (At1g05100) mRNA,
           complete cds.>gb:BT004419_1637491 Arabidopsis thaliana
           clone U18652 putative NPK1-related MAP kinase
           (At1g05100) mRNA, complete cds.>gb:T7A14_1724118
           Arabidopsis thaliana chromosome 1 BAC T7A14 sequence,
           complete sequence.
          Length = 339

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 1/54 (1%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*CNQ-*STTSEL*W 701
           +AK F+  CL++E + R TASQLL+HPF+ ++    V     N   S T ++ W
Sbjct: 235 QAKDFLGKCLKKEATERWTASQLLNHPFLVNKEPELVTGLVTNSPTSVTDQMFW 288



>sp|P83510|TNIK_MOUSE Traf2 and NCK interacting kinase (EC 2.7.1.37)
           (Fragments).
          Length = 916

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK interacting kinase (EC
           2.7.1.37).>gb:AF172264_1887679 Homo sapiens Traf2 and
           NCK interacting kinase, splice variant 1 (TNIK) mRNA,
           complete cds.
          Length = 1360

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           +SFI  CL +  S RP   QL+ HPFI+DQ
Sbjct: 263 QSFIESCLVKNHSQRPATEQLMKHPFIRDQ 292



>gb:AY335689_2144907 Synthetic construct Homo sapiens
           serine/threonine kinase 10 (STK10) mRNA, partial cds.
          Length = 969

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E + F++  L + P  RP+A+QLL+HPF+    ++K
Sbjct: 266 EFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNK 301



>gb:BC070077_1988417 Homo sapiens serine/threonine kinase 10, mRNA
           (cDNA clone MGC:87394 IMAGE:5267449), complete cds.
          Length = 968

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E + F++  L + P  RP+A+QLL+HPF+    ++K
Sbjct: 266 EFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNK 301



>gb:AL670729_1932114 Human DNA sequence from clone RP11-245P10 on
           chromosome 1 Contains the 3' end of the OBSCN gene for
           obscurin cytoskeletal calmodulin and titin-interacting
           RhoGEF protein, a novel protein, the TRIM11 gene for
           tripartite motif-containing 11 protein, the 5' end of a
           novel transcript, the 3' end of the TRIM17 gene for
           tripartite motif-containing 17 protein and three CpG
           islands, complete sequence.
          Length = 1318

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPF 776
           +AK FI+  LQR P ARP+A+Q L HP+
Sbjct: 45  DAKDFIKATLQRAPQARPSAAQCLSHPW 72



>gb:AB046859_1867498 Homo sapiens mRNA for KIAA1639 protein, partial
           cds.
          Length = 1319

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPF 776
           +AK FI+  LQR P ARP+A+Q L HP+
Sbjct: 46  DAKDFIKATLQRAPQARPSAAQCLSHPW 73



>gb:AF325168_1786568 Nicotiana tabacum mitogen-activated protein
           kinase 2 (MEK2) mRNA, complete cds.
          Length = 372

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 18/29 (62%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E + FI  CLQR+P+ R TA QLL HPFI
Sbjct: 308 EFRDFIACCLQRDPARRWTAVQLLRHPFI 336



>gb:YLI7565_1728017 Yarrowia lipolytica SSL2 gene.
          Length = 396

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           +AK FI+ CL  +P+ RPT+++LL H +I    T  +
Sbjct: 253 DAKDFIKSCLALDPALRPTSAELLKHEWITGDTTKSI 289



>gb:CR382131_1664595 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 396

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           +AK FI+ CL  +P+ RPT+++LL H +I    T  +
Sbjct: 253 DAKDFIKSCLALDPALRPTSAELLKHEWITGDTTKSI 289



>gb:CR380956_1652146 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 467

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 16/35 (45%), Positives = 24/35 (68%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           KSFI  CL++E  ARP+  Q++ HP+I+ Q   +V
Sbjct: 421 KSFIEYCLRKEARARPSPRQMIQHPWIQGQMKKQV 455



>gb:AY533302_1612157 Petroselinum crispum mitogen-activated protein
           kinase kinase 5 (MKK5) mRNA, complete cds.
          Length = 356

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 17/31 (54%), Positives = 21/31 (67%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQN 761
           + FI  CLQR+P  R TA+QLL HPF+   N
Sbjct: 295 REFISCCLQRDPHRRWTANQLLRHPFVVQTN 325



>gb:AX039412_1457707 Sequence 5 from Patent WO0063381.
          Length = 2596

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = -3

Query: 859  EAKSFIRXCLQREPSARPTASQLLDHPF 776
            +AK FI+  LQR P ARP+A+Q L HP+
Sbjct: 1321 DAKDFIKATLQRAPQARPSAAQCLSHPW 1348



>gb:AX039410_1457706 Sequence 3 from Patent WO0063381.
          Length = 1610

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPF 776
           +AK FI+  LQR P ARP+A+Q L HP+
Sbjct: 335 DAKDFIKATLQRAPQARPSAAQCLSHPW 362



>gb:AX039409_1457705 Sequence 2 from Patent WO0063381.
          Length = 1351

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 16/28 (57%), Positives = 21/28 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPF 776
           +AK FI+  LQR P ARP+A+Q L HP+
Sbjct: 76  DAKDFIKATLQRAPQARPSAAQCLSHPW 103



>gb:LMA243188_1387637 Leishmania major mkk gene for putative
           mitogen-activated protein (MAP) kinase kinase.
          Length = 372

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT 758
           + K F++ CL+R+P  RPT ++LL H F     T
Sbjct: 291 DVKDFVKQCLERDPDTRPTCAELLQHQFFDGVTT 324



>gb:LAE243186_1387083 Leishmania aethiopica mkk gene for putative
           mitogen-activated protein (MAP) kinase
           kinase.>gb:LTR243187_1389249 Leishmania tropica mkk gene
           for putative mitogen-activated protein (MAP) kinase
           kinase.
          Length = 372

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT 758
           + K F++ CL+R+P  RPT ++LL H F     T
Sbjct: 291 DVKDFVKQCLERDPDTRPTCAELLQHQFFDGVTT 324



>sp|O94804|STKA_HUMAN Serine/threonine-protein kinase 10 (EC
           2.7.1.37) (Lymphocyte-oriented
           kinase).>gb:AB015718_1864748 Homo sapiens lok mRNA for
           protein kinase, complete cds.
          Length = 968

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E + F++  L + P  RP+A+QLL+HPF+    ++K
Sbjct: 266 EFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNK 301



>gb:AL732544_2504427 Zebrafish DNA sequence from clone BUSM1-6I1 in
           linkage group 7 Contains the nitr6b_1 gene for novel
           immune-type receptor 6b, allele 1, the rtn3 gene for
           reticulon 3, the men1 gene for multiple endocrine
           neoplasia type 1, the nitr6c_1 gene for novel
           immune-type receptor 6c, allele 1 and the map4k2l gene
           for mitogen-activated protein kinase kinase kinase
           kinase 2-like, complete sequence.
          Length = 811

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SF++ CL + P  RPTA  LL HPF+    T K+
Sbjct: 247 SFVKMCLIKSPRKRPTAETLLQHPFVTQLLTRKL 280



>gb:AL691521_2504380 Zebrafish DNA sequence from clone BUSM1-186K12
           in linkage group 7 Contains then men1 gene for multiple
           endocrine neoplasia type 1 (menin 1), a gene for a novel
           protein kinase, three gene for novel immune-type
           receptors and a CpG island, complete sequence.
          Length = 675

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SF++ CL + P  RPTA  LL HPF+    T K+
Sbjct: 231 SFVKMCLIKSPRKRPTAETLLQHPFVTQLLTRKL 264



>gb:AL592105_2504065 Zebrafish DNA sequence from clone BUSM1-150L22
           in linkage group 7 Contains the 3' part of the men1 gene
           (multiple endocrine neoplasia type 1 (menin 1)), a gene
           for a novel protein kinase, three genes for novel
           immune-type receptor, a novel immune-type receptor
           pseudogene, the nitr4.2, nitr5.3 and nitr1.23 genes
           (novel immune-type receptor 4.2, 5.3 and 1.23), a novel
           gene and a CpG island, complete sequence.
          Length = 632

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 16/34 (47%), Positives = 21/34 (61%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SF++ CL + P  RPTA  LL HPF+    T K+
Sbjct: 231 SFVKMCLIKSPRKRPTAETLLQHPFVTQLLTRKL 264



>gb:AY335708_2144926 Synthetic construct Homo sapiens
           serine/threonine kinase 3 (STK3) mRNA, partial
           cds.>gb:BT019338_2151299 Synthetic construct Homo
           sapiens serine/threonine kinase 3 (STE20 homolog, yeast)
           mRNA, partial cds.>gb:BT019339_2151300 Synthetic
           construct Homo sapiens serine/threonine kinase 3 (STE20
           homolog, yeast) mRNA, partial cds.
          Length = 492

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 254 FVKKCLVKNPEQRATATQLLQHPFIKN 280



>gb:AY335620_2144838 Synthetic construct Homo sapiens nuclear
           receptor binding protein (NRBP) mRNA, partial cds.
          Length = 536

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CLQ EP+ RPTA +LL HP + +  + K+  + C
Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC 340



>gb:RNMST2KIN_2135279 Rattus norvegicus mRNA for MST2 kinase.
          Length = 491

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 254 FVKKCLVKSPEQRATATQLLQHPFIKN 280



>gb:MMU28726_2120226 Mus musculus protein kinase homolog (mess1)
           mRNA, complete cds.
          Length = 445

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 254 FVKKCLVKSPEQRATATQLLQHPFIKN 280



>gb:BC037440_2098045 Mus musculus serine/threonine kinase 3 (Ste20,
           yeast homolog), mRNA (cDNA clone MGC:46845
           IMAGE:3585312), complete cds.
          Length = 427

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 184 FVKKCLVKSPEQRATATQLLQHPFIKN 210



>gb:AF302138_2062087 Mus musculus HLS7-interacting protein kinase
           mRNA, complete cds.>gb:AF302139_2062088 Mus musculus
           HLS7-interacting protein kinase gene, promoter and
           complete cds.>gb:BC004756_2089765 Mus musculus nuclear
           receptor binding protein, mRNA (cDNA clone MGC:6961
           IMAGE:3154089), complete cds.>gb:BC018463_2092726 Mus
           musculus nuclear receptor binding protein, mRNA (cDNA
           clone MGC:27995 IMAGE:3598438), complete cds.
          Length = 535

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CLQ EP+ RPTA +LL HP + +  + K+  + C
Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC 340



>gb:HSU26424_2023032 Human Ste20-like kinase (MST2) mRNA, complete
           cds.
          Length = 491

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 254 FVKKCLVKNPEQRATATQLLQHPFIKN 280



>gb:AF435452_1799832 Nicotiana tabacum calcium/calmodulin-dependent
           protein kinase CaMK3 mRNA, complete cds.
          Length = 602

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQN 761
           SEAK F++  L ++P  R TA+Q L HP+IK+ +
Sbjct: 381 SEAKDFVKRLLNKDPRKRMTAAQALGHPWIKNSH 414



>gb:CR382125_1657903 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 724

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 14/31 (45%), Positives = 24/31 (77%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           ++A++F+  CLQ+ P  RPT + LL+HP++K
Sbjct: 651 ADAQNFVSMCLQKIPERRPTYAALLEHPWLK 681



>gb:BT004308_1637384 Arabidopsis thaliana clone RAFL15-49-N24
           (R50075) putative mitogen-activated protein kinase
           (At4g08470) mRNA, complete cds.
          Length = 560

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A+ FI  CL+  P  RPTA++LL HPF+
Sbjct: 529 DARHFILTCLKVNPEERPTAAELLHHPFV 557



>gb:AY533301_1612156 Petroselinum crispum mitogen-activated protein
           kinase kinase 2 (MKK2) mRNA, complete cds.
          Length = 354

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 14/26 (53%), Positives = 21/26 (80%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFI 773
           SF+  C+Q++P  RP+A++LL HPFI
Sbjct: 305 SFVSACVQKDPRKRPSANELLRHPFI 330



>gb:AY074935_1567732 Zea mays NPK1-related protein kinase-like
           protein (mapkkk1) mRNA, partial cds.
          Length = 190

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 16/30 (53%), Positives = 21/30 (70%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +EAK F+  C  R P  R TA+QLL+HPF+
Sbjct: 100 AEAKDFLARCFARNPRDRWTAAQLLEHPFL 129



>gb:ATH010092_1551888 Arabidopsis thaliana mRNA for MAP3K beta 3
           protein kinase, partial.
          Length = 535

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A+ FI  CL+  P  RPTA++LL HPF+
Sbjct: 504 DARHFILTCLKVNPEERPTAAELLHHPFV 532



>gb:AX876616_1476614 Sequence 11521 from Patent
           EP1074617.>gb:AK027538_1911046 Homo sapiens cDNA
           FLJ14632 fis, clone NT2RP2000668, weakly similar to
           SERINE/THREONINE PROTEIN KINASE PKPA (EC 2.7.1.-).
          Length = 535

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CLQ EP+ RPTA +LL HP + +  + K+  + C
Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC 340



>gb:U16029_1401910 Leishmania donovani protein kinase (lpk) mRNA,
           complete cds.
          Length = 372

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT 758
           + K F++ CL+R+P  RPT ++LL H F     T
Sbjct: 291 DVKDFVKQCLERDPDTRPTCAELLQHRFFDGVTT 324



>gb:LIN243184_1387551 Leishmania infantum mkk gene for putative
           mitogen-activated protein (MAP) kinase kinase.
          Length = 372

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT 758
           + K F++ CL+R+P  RPT ++LL H F     T
Sbjct: 291 DVKDFVKQCLERDPDTRPTCAELLQHRFFDGVTT 324



>gb:LDO243185_1387278 Leishmania donovani mkk gene for putative
           mitogen-activated protein (MAP) kinase kinase.
          Length = 372

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNT 758
           + K F++ CL+R+P  RPT ++LL H F     T
Sbjct: 291 DVKDFVKQCLERDPDTRPTCAELLQHRFFDGVTT 324



>gb:AF238312_1253810 Dictyostelium discoideum putative
           serine-threonine protein kinase MkcB (mkcB) gene,
           complete cds.
          Length = 714

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/28 (53%), Positives = 21/28 (75%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K F+  CL+++P+ R TA +LL HPFIK
Sbjct: 661 KDFLSLCLKQDPAERATAEELLKHPFIK 688



>gb:HSM801650_1186336 Homo sapiens mRNA; cDNA DKFZp564D1878 (from
           clone DKFZp564D1878).>gb:AX877871_1477196 Sequence 12776
           from Patent EP1074617.>gb:AF113249_1884432 Homo sapiens
           multiple domain putative nuclear protein (BCON3) mRNA,
           complete cds.>gb:AK001946_1908739 Homo sapiens cDNA
           FLJ11084 fis, clone PLACE1005243, weakly similar to
           SERINE/THREONINE PROTEIN KINASE PKPA (EC
           2.7.1.-).>gb:BC001221_1967395 Homo sapiens nuclear
           receptor binding protein, mRNA (cDNA clone MGC:902
           IMAGE:3534543), complete cds.
          Length = 535

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CLQ EP+ RPTA +LL HP + +  + K+  + C
Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC 340



>gb:CR858945_1183088 Pongo pygmaeus mRNA; cDNA DKFZp469L2223 (from
           clone DKFZp469L2223).
          Length = 380

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 254 FVKKCLVKNPEQRATATQLLQHPFIKN 280



>gb:CR858669_1182826 Pongo pygmaeus mRNA; cDNA DKFZp459G2032 (from
           clone DKFZp459G2032).
          Length = 535

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CLQ EP+ RPTA +LL HP + +  + K+  + C
Sbjct: 301 REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC 340



>gb:AK046142_1167659 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230344L17 product:SIMILAR TO NUCLEAR RECEPTOR
           BINDING PROTEIN (HLS7-INTERACTING PROTEIN KINASE)
           homolog [Mus musculus], full insert sequence.
          Length = 547

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CLQ EP+ RPTA +LL HP + +  + K+  + C
Sbjct: 309 REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC 348



>gb:AK002914_1151536 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610042I06
           product:serine/threonine kinase 3 (Ste20, yeast
           homolog), full insert sequence.
          Length = 321

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 78  FVKKCLVKSPEQRATATQLLQHPFIKN 104



>pir|D85084|D85084 probable mitogen-activated protein kinase
           [imported] - Arabidopsis thaliana>gb:ATCHRIV23_1544563
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 23.
          Length = 560

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A+ FI  CL+  P  RPTA++LL HPF+
Sbjct: 529 DARHFILTCLKVNPEERPTAAELLHHPFV 557



>pir|T01836|T01836 serine/threonine-specific protein kinase ARA.KIN
           homolog T15F16.2 - Arabidopsis
           thaliana>gb:T15F16_1723494 Arabidopsis thaliana BAC
           T15F16.
          Length = 572

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A+ FI  CL+  P  RPTA++LL HPF+
Sbjct: 541 DARHFILTCLKVNPEERPTAAELLHHPFV 569



>pir|T51736|T51736 mitogen-activated protein kinase MAP3K beta
           [imported] - Arabidopsis thaliana (fragment)
          Length = 535

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/29 (51%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A+ FI  CL+  P  RPTA++LL HPF+
Sbjct: 504 DARHFILTCLKVNPEERPTAAELLHHPFV 532



>sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 (EC
           2.7.1.37) (STE20-like kinase MST2) (MST-2) (Mammalian
           STE20-like protein kinase 2).>gb:AF271361_2061092 Mus
           musculus STE20-like kinase MST2 mRNA, complete
           cds.>gb:AY058922_2074723 Mus musculus STE20-like kinase
           MST2 mRNA, complete cds.>gb:BC049123_2099937 Mus
           musculus serine/threonine kinase 3 (Ste20, yeast
           homolog), mRNA (cDNA clone MGC:61363 IMAGE:6813956),
           complete cds.
          Length = 497

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 254 FVKKCLVKSPEQRATATQLLQHPFIKN 280



>sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 (EC
           2.7.1.37) (STE20-like kinase MST2) (MST-2) (Mammalian
           STE20-like protein kinase 2) (Serine/threonine-protein
           kinase Krs-1).>gb:BC010640_1972731 Homo sapiens
           serine/threonine kinase 3 (STE20 homolog, yeast), mRNA
           (cDNA clone MGC:17710 IMAGE:3868822), complete
           cds.>gb:HSU60206_2025222 Homo sapiens serine/threonine
           protein kinase Krs-1 mRNA, complete cds.
          Length = 491

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKD 767
           F++ CL + P  R TA+QLL HPFIK+
Sbjct: 254 FVKKCLVKNPEQRATATQLLQHPFIKN 280



>gb:BC073258_2557110 Xenopus laevis MGC80614 protein, mRNA (cDNA
           clone MGC:80614 IMAGE:5506115), complete cds.
          Length = 424

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RP+A +LL H FI
Sbjct: 248 KEFVEACLNKEPSFRPSAKELLKHKFI 274



>gb:AJ720237_2502424 Gallus gallus mRNA for hypothetical protein,
           clone 13d22.
          Length = 389

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIK 770
           +F+  CLQR P  RP+A  LL+HPF K
Sbjct: 296 NFVGQCLQRNPDFRPSAGALLNHPFFK 322



>gb:AK000556_1907998 Homo sapiens cDNA FLJ20549 fis, clone KAT11561.
          Length = 293

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K FI  CL ++PS RPTA +LL H FI
Sbjct: 125 KEFIDACLNKDPSFRPTAKELLKHKFI 151



>gb:AB040057_1866763 Homo sapiens mRNA for serine/threonine protein
           kinase MASK, complete cds.>gb:AF231012_1891710 Homo
           sapiens STE20-like kinase MST4 (MST4) mRNA, complete
           cds.>gb:AF344882_1897712 Homo sapiens serine/threonine
           protein kinase MST4 (MST4) mRNA, complete cds,
           alternatively spliced.>gb:BT020099_1991388 Homo sapiens
           Mst3 and SOK1-related kinase mRNA, complete
           cds.>gb:HSA213H19_2000506 Human DNA sequence from clone
           RP6-213H19 on chromosome Xq25-26.3 Contains the gene for
           Mst3 and SOK1-related kinase (MST4), LOC90167 gene and a
           CpG island, complete sequence.
          Length = 416

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K FI  CL ++PS RPTA +LL H FI
Sbjct: 248 KEFIDACLNKDPSFRPTAKELLKHKFI 274



>gb:AX647521_1472388 Sequence 1713 from Patent EP1270724.
          Length = 752

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CLQ EP+ RPTA +LL HP + +  + K+  + C
Sbjct: 208 EEFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHC 247



>gb:CQ783222_1452359 Sequence 3362 from Patent
           EP1396543.>gb:AK075150_1912921 Homo sapiens cDNA
           FLJ90669 fis, clone PLACE1005519, moderately similar to
           Homo sapiens STE20-like kinase 3 (mst-3) mRNA.
          Length = 392

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K FI  CL ++PS RPTA +LL H FI
Sbjct: 248 KEFIDACLNKDPSFRPTAKELLKHKFI 274



>gb:CQ783144_1452321 Sequence 3284 from Patent
           EP1396543.>gb:AK075107_1912892 Homo sapiens cDNA
           FLJ90626 fis, clone PLACE1003135, weakly similar to
           SPORULATION-SPECIFIC PROTEIN 1 (EC 2.7.1.-).
          Length = 339

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K FI  CL ++PS RPTA +LL H FI
Sbjct: 171 KEFIDACLNKDPSFRPTAKELLKHKFI 197



>gb:CQ782788_1452148 Sequence 2928 from Patent
           EP1396543.>gb:AX880014_1478089 Sequence 14919 from
           Patent EP1074617.>gb:AK027589_1911076 Homo sapiens cDNA
           FLJ14683 fis, clone NT2RP2004768, weakly similar to
           SERINE/THREONINE-PROTEIN KINASE NRK1 (EC
           2.7.1.-).>gb:AK074837_1912722 Homo sapiens cDNA FLJ90356
           fis, clone NT2RP2003545, weakly similar to Homo sapiens
           STE20-like kinase 3 (mst-3) mRNA.
          Length = 231

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K FI  CL ++PS RPTA +LL H FI
Sbjct: 63  KEFIDACLNKDPSFRPTAKELLKHKFI 89



>gb:AC115605_1205884 Dictyostelium discoideum chromosome 2 map
           5817431-5836155 strain AX4, complete sequence.
          Length = 652

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           E + F+  CLQ +PS R T+SQLL HPF+
Sbjct: 598 EFRDFLTNCLQFDPSKRLTSSQLLQHPFL 626



>gb:AK034609_1163813 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430014J09
           product:SERINE/THREONINE PROTEIN KINASE MASK
           (SERINE/THREONINE PROTEIN KINASE MST4) (STE20-LIKE
           KINASE MST4) homolog [Homo sapiens], full insert
           sequence.>gb:BC005708_2090101 Mus musculus RIKEN cDNA
           2610018G03 gene, mRNA (cDNA clone MGC:6448
           IMAGE:2598933), complete cds.
          Length = 416

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/27 (59%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K FI  CL ++PS RPTA +LL H FI
Sbjct: 248 KEFIDACLNKDPSFRPTAKELLKHKFI 274



>pir|C84831|C84831 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC002336_1530434 Arabidopsis thaliana
           chromosome 2 clone T2P4 map CIC10A06, complete
           sequence.>gb:BT014977_1641947 Arabidopsis thaliana
           At2g40580 gene, complete cds.
          Length = 311

 Score = 37.7 bits (86), Expect = 0.29
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           EA  F+R CL   PS R T  +LLDHPF  ++
Sbjct: 242 EATDFVRRCLAWRPSNRATVDELLDHPFAAEK 273



>gb:BC083536_2563336 Danio rerio zgc:92836, mRNA (cDNA clone
           MGC:92836 IMAGE:7116228), complete cds.
          Length = 297

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EP  RPTA +LL H FI
Sbjct: 244 KDFVEACLNKEPRFRPTAKELLKHKFI 270



>gb:AY603754_2086808 Mus musculus obscurin-MLCK mRNA, complete cds.
          Length = 1579

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/28 (57%), Positives = 20/28 (71%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPF 776
           +AK FI+  LQR P ARP+ SQ L HP+
Sbjct: 334 DAKDFIKATLQRTPQARPSTSQCLAHPW 361



>gb:AL669844_2072492 Mouse DNA sequence from clone RP23-395O6 on
           chromosome 11 Contains the 3' end of a novel gene, a
           novel gene, the Stk10 gene for serine/threonine kinase
           10, the 5' end of the Fbxw1b gene for F-box and WD-40
           domain protein 1B and two CpG islands, complete
           sequence.
          Length = 167

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E + F++  L + P  RP+A+QLL HPF+    ++K
Sbjct: 68  EFRDFLKIALDKNPETRPSAAQLLQHPFVSRVTSNK 103



>gb:AL669844_2072491 Mouse DNA sequence from clone RP23-395O6 on
           chromosome 11 Contains the 3' end of a novel gene, a
           novel gene, the Stk10 gene for serine/threonine kinase
           10, the 5' end of the Fbxw1b gene for F-box and WD-40
           domain protein 1B and two CpG islands, complete
           sequence.
          Length = 966

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E + F++  L + P  RP+A+QLL HPF+    ++K
Sbjct: 266 EFRDFLKIALDKNPETRPSAAQLLQHPFVSRVTSNK 301



>gb:AK122218_2068883 Mus musculus mRNA for mKIAA0204 protein.
          Length = 1307

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S  K F+R CL++   AR T SQLL HPF+
Sbjct: 368 SNFKDFLRKCLEKNVDARWTTSQLLQHPFV 397



>gb:AF112855_2054940 Mus musculus Ste20-related kinase SMAK (SMAK)
           mRNA, complete cds.
          Length = 1202

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S  K F+R CL++   AR T SQLL HPF+
Sbjct: 263 SNFKDFLRKCLEKNVDARWTTSQLLQHPFV 292



>gb:SPWIS4GEN_1722341 S.pombe wis4+ gene.
          Length = 1275

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -3

Query: 862  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
            S A+ FI  C +R+P  RP A  LL HP+I D
Sbjct: 1151 SLARDFIEQCFERDPEQRPRAVDLLTHPWITD 1182



>gb:SPWAK1_1722337 S.pombe wak1 gene.
          Length = 1306

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -3

Query: 862  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
            S A+ FI  C +R+P  RP A  LL HP+I D
Sbjct: 1182 SLARDFIEQCFERDPEQRPRAVDLLTHPWITD 1213



>gb:AY247756_1592604 Glycine max seed calcium dependent protein
           kinase c mRNA, complete cds.
          Length = 537

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = -3

Query: 856 AKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           AK  +R  L ++P  R T++Q+L+HP+IKD N S
Sbjct: 314 AKDLVRKMLIQDPKKRITSAQVLEHPWIKDGNAS 347



>gb:BT020904_1436262 Bos taurus serine/threonine kinase 4 (STK4),
           mRNA, complete cds.
          Length = 487

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIK 770
           F++ CL + P  R TA+QLL HPF+K
Sbjct: 257 FVKQCLVKSPEQRATATQLLQHPFVK 282



>gb:AY071688_1295772 Drosophila melanogaster RH10407 full insert
           cDNA.
          Length = 947

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           +FI+  L + P  RPTA +LL HPF++ + + +VA
Sbjct: 258 NFIKTALTKNPKKRPTAERLLQHPFVQCEMSLRVA 292



>gb:AF061281_1237277 Dictyostelium discoideum kinase responsive to
           stress 1-like kinase mRNA, complete cds.
          Length = 461

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI-KDQNTSKVAP 743
           E   F+  CL R+P  RP+A +LL HPFI K ++ S + P
Sbjct: 245 EFNDFLAKCLTRKPELRPSAEELLKHPFITKAKSHSLLVP 284



>gb:AK029491_1161517 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4921503G23
           product:serine/threonine kinase 2, full insert sequence.
          Length = 784

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S  K F+R CL++   AR T SQLL HPF+
Sbjct: 263 SNFKDFLRKCLEKNVDARWTTSQLLQHPFV 292



>gb:AK028838_1161190 Mus musculus 10 days neonate skin cDNA, RIKEN
           full-length enriched library, clone:4732460I11
           product:serine/threonine kinase 4, full insert
           sequence.>gb:AF271360_2061091 Mus musculus STE20-like
           kinase MST1 mRNA, complete cds.>gb:BC054521_2101731 Mus
           musculus serine/threonine kinase 4, mRNA (cDNA clone
           MGC:62184 IMAGE:6409342), complete cds.
          Length = 487

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIK 770
           F++ CL + P  R TA+QLL HPF+K
Sbjct: 257 FVKQCLVKSPEQRATATQLLQHPFVK 282



>gb:AE013599_1132765 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003796_1224876 Drosophila melanogaster
           chromosome 2R, section 54 of 74 of the complete
           sequence.
          Length = 947

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           +FI+  L + P  RPTA +LL HPF++ + + +VA
Sbjct: 258 NFIKTALTKNPKKRPTAERLLQHPFVQCEMSLRVA 292



>gb:AE013599_1132764 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003796_1224875 Drosophila melanogaster
           chromosome 2R, section 54 of 74 of the complete
           sequence.
          Length = 1218

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVA 746
           +FI+  L + P  RPTA +LL HPF++ + + +VA
Sbjct: 258 NFIKTALTKNPKKRPTAERLLQHPFVQCEMSLRVA 292



>pir|S53804|S53804 protein kinase NPK2 (EC 2.7.1.-) - common
           tobacco>gb:TOBNPK2_1725455 Tobacco mRNA for protein
           kinase (NPK2), complete cds.
          Length = 518

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 18/34 (52%), Positives = 20/34 (58%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           SFI  CL++ P  R TA QLL HPFI     S V
Sbjct: 314 SFIDACLKKNPDDRLTAEQLLSHPFITKYTDSAV 347



>pir|T14157|T14157 serine/threonine protein kinase -
           mouse>gb:AF039574_2051914 Mus musculus serine/threonine
           protein kinase mRNA, complete cds.
          Length = 1233

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/30 (53%), Positives = 20/30 (66%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           S  K F+R CL++   AR T SQLL HPF+
Sbjct: 263 SNFKDFLRKCLEKNVDARWTTSQLLQHPFV 292



>pir|T08874|T08874 calcium-dependent protein kinase (EC 2.7.1.-)
           gamma - soybean>gb:GMU69174_1680736 Glycine max
           calmodulin-like domain protein kinase isoenzyme gamma
           mRNA, complete cds.
          Length = 538

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = -3

Query: 856 AKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           AK  +R  L ++P  R T++Q+L+HP+IKD N S
Sbjct: 315 AKDLVRKMLIQDPKKRITSAQVLEHPWIKDGNAS 348



>sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 (EC 2.7.1.-) (MAP
            kinase kinase kinase wak1) (MAP kinase kinase kinase
            wik1).>pir|T39225|T39225 MAP kinase kinase kinase -
            fission yeast  (Schizosaccharomyces
            pombe)>gb:SPAC9G1_1718526 S.pombe chromosome I cosmid
            c9G1.
          Length = 1401

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = -3

Query: 862  SEAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
            S A+ FI  C +R+P  RP A  LL HP+I D
Sbjct: 1277 SLARDFIEQCFERDPEQRPRAVDLLTHPWITD 1308



>sp|O55098|STKA_MOUSE Serine/threonine-protein kinase 10 (EC
           2.7.1.37) (Lymphocyte-oriented
           kinase).>gb:D89728_2112706 Mus musculus mRNA for LOK,
           complete cds.
          Length = 966

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSK 752
           E + F++  L + P  RP+A+QLL HPF+    ++K
Sbjct: 266 EFRDFLKIALDKNPETRPSAAQLLQHPFVSRVTSNK 301



>gb:BC074684_2558178 Xenopus tropicalis nuclear receptor binding
           protein, mRNA (cDNA clone MGC:69507 IMAGE:5336424),
           complete cds.
          Length = 526

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/40 (40%), Positives = 26/40 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*C 734
           + FI+ CL+ +PS RPTA +LL HP + +  + K+  + C
Sbjct: 295 REFIQKCLETDPSKRPTARELLFHPALFEVPSLKLLAAHC 334



>gb:BC070834_2555803 Xenopus laevis hypothetical protein LOC431827,
           mRNA (cDNA clone IMAGE:6861900), partial cds.
          Length = 791

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 14/30 (46%), Positives = 20/30 (66%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           E   F++  L + P  RP+A QLL+HPF+K
Sbjct: 266 EFHDFLKTALDKHPETRPSAVQLLEHPFVK 295



>gb:BC054651_2551060 Danio rerio zgc:66137, mRNA (cDNA clone
           MGC:66137 IMAGE:3817670), complete cds.
          Length = 420

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL +EPS RPTA +LL H  I
Sbjct: 236 KEFVEACLNKEPSFRPTAKELLKHKLI 262



>gb:AY242842_2521697 Squalus acanthias STE20-like kinase (MST1/2)
           mRNA, complete cds.
          Length = 491

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/31 (48%), Positives = 20/31 (64%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD 767
           E   F++ CL + P  R  A+QLL HPFIK+
Sbjct: 255 EFTDFVKQCLVKNPEQRAAATQLLQHPFIKN 285



>gb:BC056650_2102456 Mus musculus cDNA clone MGC:68239
           IMAGE:5036478, complete cds.
          Length = 418

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 264 SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 292



>gb:AK129191_2069422 Mus musculus mRNA for mKIAA0687 protein.
          Length = 1255

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 190 SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 218



>gb:AY212247_1939418 Homo sapiens Ste20 group protein kinase HGK
           mRNA, complete cds, alternatively spliced.
          Length = 1239

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 264 SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 292



>gb:AF096300_1882786 Homo sapiens HPK/GCK-like kinase HGK mRNA,
           complete cds.
          Length = 1165

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 264 SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 292



>gb:AB014587_1864616 Homo sapiens mRNA for KIAA0687 protein, partial
           cds.
          Length = 1175

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 227 SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 255



>gb:AE017348_1758139 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 727

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKD-QNTSKVAP 743
           E + FI  CLQ++P  R TA QLL H FI+  + T+ + P
Sbjct: 241 EFQDFIEKCLQKDPRDRATAKQLLQHRFIRSAKKTTDLIP 280



>gb:MSCDPK_1687079 M.sativa mRNA for protein kinase.
          Length = 542

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 17/34 (50%), Positives = 23/34 (67%)
 Frame = -3

Query: 856 AKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           AK  +R  L +EP  R TA+Q+L+HP+IK  N S
Sbjct: 319 AKDLVRKMLIQEPKKRITAAQVLEHPWIKGGNAS 352



>gb:AY427829_1605796 Solanum chacoense fertilization-related kinase
           2 mRNA, complete cds.
          Length = 304

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQN 761
           +A+ F+  C+ R+P +R TA  LL+HPF+   N
Sbjct: 232 QAEDFLNKCVDRDPHSRWTADLLLNHPFLSSDN 264



>gb:ATH505745_1552820 Arabidopsis thaliana mRNA for map 4 kinase
           alpha2 (map4kalpha2 gene).>gb:BT000928_1635183
           Arabidopsis thaliana clone C105131 putative MAP kinase
           (At3g15220) mRNA, complete cds.>gb:AP000413_1820065
           Arabidopsis thaliana genomic DNA, chromosome 3, TAC
           clone: K7L4.
          Length = 690

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 14/35 (40%), Positives = 23/35 (65%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           + K F+  CL++ P+ RP+A +L+ H FIK+   S
Sbjct: 239 QVKEFVSLCLKKAPAERPSAKELIKHRFIKNARKS 273



>gb:AB013392_1512094 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MIK19.>gb:AB104460_1526470 Arabidopsis thaliana
           ANQ1/AtMKK6 mRNA for MAP kinase kinase, complete cds.
          Length = 356

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIK 770
           SF+  C+Q++P AR ++  LL HPFIK
Sbjct: 306 SFVSACIQKDPPARASSLDLLSHPFIK 332



>gb:CQ782869_1452188 Sequence 3009 from Patent EP1396543.
          Length = 367

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 70  SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 98



>gb:BT020921_1436279 Bos taurus protein kinase LYK5 (LYK5), mRNA,
           complete cds.
          Length = 373

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/26 (57%), Positives = 18/26 (69%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIK 770
           F+  CLQR P  RP+AS LL+H F K
Sbjct: 297 FVEQCLQRNPDMRPSASTLLNHSFFK 322



>gb:U53153_1404868 Caenorhabditis elegans cosmid T19A5, complete
           sequence.
          Length = 638

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K F+  CL ++P  RP+AS LL H FIK
Sbjct: 244 KEFVEMCLNKDPENRPSASTLLKHQFIK 271



>gb:U53153_1404867 Caenorhabditis elegans cosmid T19A5, complete
           sequence.
          Length = 651

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K F+  CL ++P  RP+AS LL H FIK
Sbjct: 257 KEFVEMCLNKDPENRPSASTLLKHQFIK 284



>gb:U53153_1404866 Caenorhabditis elegans cosmid T19A5, complete
           sequence.
          Length = 650

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K F+  CL ++P  RP+AS LL H FIK
Sbjct: 256 KEFVEMCLNKDPENRPSASTLLKHQFIK 283



>gb:LMFL7171_1388356 Leishmania major Friedlin chromosome 21 cosmid
           L7171.
          Length = 499

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFI 773
           F+R CL  + + RP+A+QLLDHPF+
Sbjct: 469 FVRLCLTLDAALRPSAAQLLDHPFL 493



>gb:HSM802392_1186694 Homo sapiens mRNA; cDNA DKFZp434A025 (from
           clone DKFZp434A025).
          Length = 1059

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 3   SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 31



>pir|T34356|T34356 hypothetical protein T19A5.2 - Caenorhabditis
           elegans>gb:U53153_1404865 Caenorhabditis elegans cosmid
           T19A5, complete sequence.
          Length = 653

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/28 (53%), Positives = 19/28 (67%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIK 770
           K F+  CL ++P  RP+AS LL H FIK
Sbjct: 259 KEFVEMCLNKDPENRPSASTLLKHQFIK 286



>pir|T47507|T47507 probable protein kinase - Arabidopsis
           thaliana>gb:ATF9K21_1551425 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F9K21.
          Length = 379

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +EA+ F+  CL +EP +R T  +L+DHPF+
Sbjct: 336 AEAQDFLMRCLVKEPGSRWTIGELVDHPFL 365



>pir|T46481|T46481 hypothetical protein DKFZp434A025.1 - human
           (fragment)
          Length = 1027

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 3   SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 31



>sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase
           kinase 4 (EC 2.7.1.37) (MAPK/ERK kinase kinase kinase 4)
           (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase
           HGK) (Nck interacting kinase).>pir|T30989|T30989
           serine/threonine protein kinase NIK -
           mouse>gb:MMU88984_2123856 Mus musculus NIK mRNA,
           complete cds.
          Length = 1233

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 263 SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 291



>sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase
           kinase 4 (EC 2.7.1.37) (MAPK/ERK kinase kinase kinase 4)
           (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase
           HGK) (Nck interacting kinase).
          Length = 1239

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 16/29 (55%), Positives = 19/29 (65%)
 Frame = -3

Query: 850 SFIRXCLQREPSARPTASQLLDHPFIKDQ 764
           SFI  CL +    RP+  QLL HPFI+DQ
Sbjct: 264 SFIEGCLVKNYMQRPSTEQLLKHPFIRDQ 292



>sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase
           (EC 2.7.1.123) (CMPK).>pir|JN0323|JN0323
           Ca2+/calmodulin-dependent protein kinase (EC 2.7.1.123)
           - Emericella nidulans>gb:EMECMKA_1676606 Emericella
           nidulans calmodulin-dependent protein kinase (cmkA)
           mRNA, complete cds.>gb:AF054580_1764551 Emericella
           nidulans calmodulin-dependent protein kinase (cmkA)
           gene, complete cds.
          Length = 414

 Score = 37.0 bits (84), Expect = 0.49
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           +AK FI   LQ +P+ RPT+ + L HP++K ++ S
Sbjct: 250 DAKDFILSLLQVDPAQRPTSEEALKHPWLKGESAS 284



>gb:BC089072_2566038 Xenopus tropicalis cDNA clone MGC:107743
           IMAGE:7000064, complete cds.
          Length = 400

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K F+  CL ++P +RPTA +LL H FI
Sbjct: 231 KDFVEACLNKDPRSRPTARELLKHRFI 257



>gb:AY247742_2521837 Gallus gallus TRB2 protein mRNA, complete cds.
          Length = 343

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 19/36 (52%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHP-FIKDQNTS 755
           +AK  IR  L+REPS R T+ ++LDHP F  D N S
Sbjct: 280 KAKCLIRSILRREPSERLTSQEILDHPWFSTDFNVS 315



>gb:AJ720430_2502617 Gallus gallus mRNA for hypothetical protein,
           clone 17i1.
          Length = 486

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 14/33 (42%), Positives = 20/33 (60%)
 Frame = -3

Query: 847 FIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           F++ CL + P  R TA QLL HPF+K    + +
Sbjct: 256 FVKQCLVKSPEQRATAIQLLQHPFVKSAKGASI 288



>gb:AJ719477_2501664 Gallus gallus mRNA for hypothetical protein,
           clone 2k24.
          Length = 416

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFI 773
           K FI  CL ++P+ RPTA +LL H FI
Sbjct: 248 KEFIDACLNKDPTFRPTAKELLKHKFI 274



>gb:AE017341_1754586 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 747

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 13/30 (43%), Positives = 22/30 (73%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIK 770
           + K F+  CL ++P  RPT++QLL+H ++K
Sbjct: 377 QMKEFVDACLVKDPDGRPTSAQLLEHHWLK 406



>gb:AE016816_1746807 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 524

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKV 749
           KSFI  CL++E   RP+  Q+L HP+I+ Q   +V
Sbjct: 477 KSFISYCLKKESRERPSPRQMLRHPWIQGQMKKRV 511



>gb:AC135206_1742024 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1041F02, complete sequence.
          Length = 660

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 13/29 (44%), Positives = 22/29 (75%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFI 773
           +A+ FI  C++  P  RP+A++LL+HPF+
Sbjct: 544 DARDFISQCVKPNPQDRPSAAKLLEHPFV 572



>gb:CR382137_1670218 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 463

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKD 767
           K F+R CL ++P  RP++S LL H F+K+
Sbjct: 234 KDFVRYCLIKDPKKRPSSSTLLHHKFLKN 262



>gb:BNA9608_1633372 Brassica napus mRNA for MAP4K alpha 1 protein.
          Length = 684

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           K F+  CL++ P+ RP+A +LL H FIK    S
Sbjct: 241 KEFVSFCLKKAPAERPSAKELLKHRFIKSARKS 273



>gb:AY188756_1588362 Zea mays GCK-like kinase MIK mRNA, complete
           cds.
          Length = 688

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKD 767
           K F+  CL++ P+ RP+A +LL H FIK+
Sbjct: 241 KEFVSLCLKKNPAERPSAKELLKHRFIKN 269



>gb:AY080818_1568515 Arabidopsis thaliana unknown protein
           (At4g26890) mRNA, partial cds.
          Length = 394

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 17/49 (34%), Positives = 28/49 (57%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*CNQ*STTS 713
           +AK F++ CL+ +   R T  +LL HPF+ D   S+ +    N+ S+ S
Sbjct: 225 KAKDFLKNCLKEDQKQRWTVEELLKHPFLDDDEESQTSDCLKNKTSSPS 273



>gb:ATH505744_1552819 Arabidopsis thaliana mRNA for map 4 kinase
           alpha1 (map4kalpha1 gene).
          Length = 679

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           K F+  CL++ P+ RP A +LL H FIK+   S
Sbjct: 240 KEFVSFCLKKAPAERPNAKELLKHRFIKNARKS 272



>pir|T04812|T04812 NPK1-related protein kinase homolog F10M23.230 -
           Arabidopsis thaliana>gb:ATCHRIV66_1546570 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           66.>gb:ATF10M23_1548170 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F10M23 (ESSA project).
          Length = 444

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 17/49 (34%), Positives = 28/49 (57%)
 Frame = -3

Query: 859 EAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAPS*CNQ*STTS 713
           +AK F++ CL+ +   R T  +LL HPF+ D   S+ +    N+ S+ S
Sbjct: 225 KAKDFLKNCLKEDQKQRWTVEELLKHPFLDDDEESQTSDCLKNKTSSPS 273



>pir|D96532|D96532 probable CDPK-related protein kinase [imported] -
           Arabidopsis thaliana>gb:AE005173_892891 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011807_1537461 Arabidopsis thaliana
           chromosome I BAC F14J22 genomic sequence, complete
           sequence.>gb:BT010597_1640543 Arabidopsis thaliana
           At1g49580 gene, complete cds.
          Length = 606

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 17/40 (42%), Positives = 25/40 (62%)
 Frame = -3

Query: 862 SEAKSFIRXCLQREPSARPTASQLLDHPFIKDQNTSKVAP 743
           S+AK F++  L ++P  R +ASQ L HP+I+  NT    P
Sbjct: 383 SDAKDFVKRLLFKDPRRRMSASQALMHPWIRAYNTDMNIP 422



>pir|C96572|C96572 protein F12M16.4 [imported] - Arabidopsis
           thaliana>gb:AE005173_893217 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC008007_1536398 Genomic sequence for
           Arabidopsis thaliana BAC F12M16 from chromosome I,
           complete sequence.
          Length = 690

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -3

Query: 853 KSFIRXCLQREPSARPTASQLLDHPFIKDQNTS 755
           K F+  CL++ P+ RP A +LL H FIK+   S
Sbjct: 251 KEFVSFCLKKAPAERPNAKELLKHRFIKNARKS 283


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 893,961,147
Number of Sequences: 1806583
Number of extensions: 17901671
Number of successful extensions: 50088
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 48434
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50063
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 58992155624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)