BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13210
         (824 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T51353|T51353 NAD ADP-ribosyltransferase (EC 2.4.2.30) [impo...   354   1e-96   Arabidopsis thaliana [mouse-ear cress]
pir|C84719|C84719 probable poly (ADP-ribose) polymerase [importe...   354   1e-96   Arabidopsis thaliana [mouse-ear cress]
gb:AF093627_1767676 Zea mays poly(ADP)-ribose polymerase (PARP1)...   342   4e-93   
pir|T03657|T03657 NAD ADP-ribosyltransferase (EC 2.4.2.30) 2 - m...   342   4e-93   Zea mays [maize]
gb:AP005247_1849489 Oryza sativa (japonica cultivar-group) genom...   339   3e-92   
gb:RNPARP2_2136168 R.norvegicus mRNA for poly(ADP-ribose) polyme...   257   2e-67   
gb:BC085765_2109334 Rattus norvegicus ADP-ribosyltransferase 1, ...   257   2e-67   
pir|S26057|S26057 NAD ADP-ribosyltransferase (EC 2.4.2.30) - rat...   257   2e-67   Rattus norvegicus [brown rat]
sp|P27008|PPOL_RAT|PPOL_RAT Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30) ...   257   2e-67   Rattus norvegicus [brown rat]
gb:HUMRISDAD_2036297 Human poly(ADP-ribose) synthetase mRNA, com...   256   4e-67   
gb:HUMPOLP_2035772 Human poly(ADP-ribose) polymerase mRNA, compl...   256   4e-67   
gb:HUMADPPO_2029031 Human placental poly(ADP-ribose) polymerase ...   256   4e-67   
gb:BC037545_1982208 Homo sapiens poly (ADP-ribose) polymerase fa...   256   4e-67   
gb:A52134_1449749 Sequence 1 from Patent WO9618737.                   256   4e-67   
pir|A29725|A29725 NAD ADP-ribosyltransferase (EC 2.4.2.30), nucl...   256   4e-67   Homo sapiens [man]
sp|P09874|PPOL_HUMAN|PPOL_HUMAN Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30...   256   4e-67   Homo sapiens [man]
gb:AF168781_2057604 Cricetulus griseus poly ADP-ribose polymeras...   256   5e-67   
pir|S04200|S04200 NAD ADP-ribosyltransferase (EC 2.4.2.30) - mou...   256   5e-67   Mus musculus [mouse]
sp|P11103|PPOL_MOUSE|PPOL_MOUSE Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30...   256   5e-67   Mus musculus [mouse]
sp|Q9R152|PPOL_CRIGR|PPOL_CRIGR Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30...   256   5e-67   Cricetulus griseus [Chinese hamsters]
gb:AK030889_1162216 Mus musculus adult male thymus cDNA, RIKEN f...   255   6e-67   
gb:AF126717_2055497 Mus musculus msPARP mRNA, complete cds.           254   1e-66   
pir|JS0428|JS0428 NAD ADP-ribosyltransferase (EC 2.4.2.30) - bov...   251   9e-66   Bos taurus [bovine]
sp|P18493|PPOL_BOVIN|PPOL_BOVIN Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30...   251   9e-66   Bos taurus [bovine]
gb:BX470188_2567423 Zebrafish DNA sequence from clone DKEY-206F1...   251   1e-65   
pir|S31735|S31735 NAD ADP-ribosyltransferase (EC 2.4.2.30) - Afr...   251   1e-65   Xenopus laevis [clawed frog]
sp|P31669|PPOL_XENLA|PPOL_XENLA Poly [ADP-ribose] polymerase (EC 2.4.2.30) ...   251   1e-65   Xenopus laevis [clawed frog]
sp|P26446|PPOL_CHICK|PPOL_CHICK Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30...   250   2e-65   Gallus gallus [bantam]
gb:AX058340_1458411 Sequence 24 from Patent WO0077179.>gb:AX0622...   249   3e-65   
pir|JH0581|JH0581 NAD ADP-ribosyltransferase (EC 2.4.2.30) - chi...   248   8e-65   Gallus gallus [bantam]
sp|Q11208|PPOL_SARPE|PPOL_SARPE Poly [ADP-ribose] polymerase (EC 2.4.2.30) ...   246   3e-64   Sarcophaga peregrina
gb:AY118947_1300669 Drosophila melanogaster LD31274 full insert ...   239   6e-62   
sp|P35875|PPOL_DROME|PPOL_DROME Poly [ADP-ribose] polymerase (EC 2.4.2.30) ...   239   6e-62   Drosophila melanogaster
pir|T01311|T01311 NAD ADP-ribosyltransferase (EC 2.4.2.30) - Ara...   236   4e-61   Arabidopsis thaliana [mouse-ear cress]
sp|Q11207|PPOL_ARATH|PPOL_ARATH Poly [ADP-ribose] polymerase (EC 2.4.2.30) ...   236   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb:AP003258_1826504 Oryza sativa (japonica cultivar-group) genom...   219   6e-56   
pir|T03656|T03656 probable NAD ADP-ribosyltransferase (EC 2.4.2....   216   3e-55   Zea mays [maize]
gb:BC076765_2559510 Xenopus laevis ADP-ribosyltransferase (NAD+,...   214   2e-54   
gb:AF072521_2053371 Mus musculus poly-(ADPribosyl)-transferase h...   206   4e-52   
sp|O88554|PPO2_MOUSE|PPO2_MOUSE Poly [ADP-ribose] polymerase-2 (EC 2.4.2.30...   206   4e-52   Mus musculus [mouse]
gb:AF191547_2058518 Mus musculus poly (ADP-ribose) polymerase 2 ...   206   6e-52   
gb:AF479321_1904595 Homo sapiens ADP-ribosyltransferase (NAD+; p...   204   2e-51   
gb:AX008892_1456293 Sequence 1 from Patent WO9964572.>gb:HSA2369...   204   2e-51   
sp|Q9UGN5|PPO2_HUMAN|PPO2_HUMAN Poly [ADP-ribose] polymerase-2 (EC 2.4.2.30...   204   2e-51   Homo sapiens [man]
gb:AF085734_1881773 Homo sapiens NAD+ ADP-ribosyltransferase 2 (...   200   2e-50   
gb:DDI534950_1376972 Dictyostelium discoideum mRNA for NAD(+) AD...   182   7e-45   
gb:AX877938_1477226 Sequence 12843 from Patent EP1074617.>gb:AK0...   181   1e-44   
gb:DDI534948_1376970 Dictyostelium discoideum mRNA for NAD(+) AD...   179   4e-44   
gb:NC5E6_1688584 Neurospora crassa DNA linkage group V Cosmid co...   166   4e-40   
gb:AY347573_1601392 Emericella nidulans poly(ADP)-ribose polymer...   166   5e-40   
gb:AY349148_1601431 Emericella nidulans poly(ADP)-ribose polymer...   164   2e-39   
gb:DDI520099_1376969 Dictyostelium discoideum mRNA for (ADP-ribo...   164   2e-39   
gb:AF499444_1277239 Caenorhabditis elegans poly ADP-ribose metab...   162   7e-39   
gb:AC024200_1204229 Caenorhabditis elegans cosmid Y71F9AL, compl...   162   7e-39   
gb:CEAC8_1359603 Caenorhabditis elegans cosmid AC8, complete seq...   162   9e-39   
pir|T18600|T18600 hypothetical protein AC8.1 - Caenorhabditis el...   162   9e-39   Caenorhabditis elegans [roundworm]
gb:AK118123_1816118 Arabidopsis thaliana At5g22470 mRNA for unkn...   142   6e-33   
gb:AB012244_1511750 Arabidopsis thaliana genomic DNA, chromosome...   142   6e-33   
gb:AP004790_1845138 Oryza sativa (japonica cultivar-group) genom...   130   4e-29   
gb:AF169023_1774199 Glycine max seed maturation protein PM38 (PM...   127   3e-28   
gb:DDI534949_1376971 Dictyostelium discoideum mRNA for NAD(+) AD...   125   1e-27   
gb:BTARS1B_1436886 Bovine mRNA for poly(ADP-ribose) synthetase f...   110   4e-23   
pir|PN0494|PN0494 NAD ADP-ribosyltransferase (EC 2.4.2.30) - che...   110   4e-23   Oncorhynchus masou [Japanese salmon]
sp|Q08824|PPOL_ONCMA|PPOL_ONCMA Poly [ADP-ribose] polymerase (EC 2.4.2.30) ...   110   4e-23   Oncorhynchus masou [Japanese salmon]
gb:BC085863_2109422 Rattus norvegicus ADP-ribosyltransferase (NA...   107   4e-22   
gb:XELADPRP_2581739 Xenopus laevis mRNA for poly(ADP-ribose) pol...   105   1e-21   
gb:AF083068_1881588 Homo sapiens NAD+ ADP-ribosyltransferase 3 (...   103   3e-21   
gb:AX008896_1456295 Sequence 5 from Patent WO9964572.>gb:AY12634...   103   3e-21   
sp|Q9Y6F1|PPO3_HUMAN|PPO3_HUMAN Poly [ADP-ribose] polymerase-3 (EC 2.4.2.30...   103   3e-21   Homo sapiens [man]
gb:BC087453_2565294 Xenopus laevis hypothetical LOC496154, mRNA ...   103   4e-21   
gb:BC045935_2549449 Danio rerio zgc:66157, mRNA (cDNA clone MGC:...   102   7e-21   
gb:HSM800368_2017135 Homo sapiens mRNA; cDNA DKFZp566G0224 (from...   102   9e-21   
pir|T08713|T08713 NAD+ ADP-ribosyltransferase homolog DKFZp566G0...   102   9e-21   Homo sapiens [man]
gb:AF368233_2064279 Mus musculus NAD+ ADP-ribosyltransferase 3 P...   100   3e-20   
gb:BC014870_2092069 Mus musculus poly (ADP-ribose) polymerase fa...   100   6e-20   
gb:AX008900_1456297 Sequence 9 from Patent WO9964572.                 100   6e-20   
gb:AK044223_1166872 Mus musculus adult retina cDNA, RIKEN full-l...   100   6e-20   
gb:ONHADPRP_2577198 Oncorhynchus masou mRNA for poly(ADP-ribose)...    97   5e-19   
sp|Q09525|PME2_CAEEL|PME2_CAEEL Poly(ADP-ribose) polymerase 2 (EC 2.4.2.30)...    77   3e-13   Caenorhabditis elegans [roundworm]
gb:AF047664_1236523 Caenorhabditis elegans cosmid ZK1005, comple...    74   3e-12   
gb:AF047664_1236522 Caenorhabditis elegans cosmid ZK1005, comple...    74   3e-12   
gb:CR382129_1662006 Yarrowia lipolytica chromosome C of strain C...    73   6e-12   
gb:CR859406_1183523 Pongo pygmaeus mRNA; cDNA DKFZp469B246 (from...    72   1e-11   
gb:AK172907_2069841 Mus musculus mRNA for mKIAA0177 protein.           72   1e-11   
gb:D79999_1994909 Homo sapiens mRNA for KIAA0177 protein, partia...    71   2e-11   
gb:AL359763_1925788 Human DNA sequence from clone RP11-169O17 on...    71   2e-11   
gb:AF158255_1886774 Homo sapiens vault protein mRNA, complete cds.     71   2e-11   
gb:AF057160_1879605 Homo sapiens putative poly(ADP-ribosyl) tran...    71   2e-11   
sp|Q9UKK3|PPOV_HUMAN|PPOV_HUMAN Vault poly(ADP-ribose) polymerase (EC 2.4.2...    71   2e-11   Homo sapiens [man]
gb:DDI534951_1376973 Dictyostelium discoideum mRNA for NAD(+) AD...    68   2e-10   
gb:AC116956_1206532 Dictyostelium discoideum chromosome 2 map 14...    49   9e-05   
gb:AF132196_1243608 Drosophila melanogaster clone LD22548 unknow...    43   0.006   
gb:AE014297_1141439 Drosophila melanogaster chromosome 3R, compl...    43   0.006   
pir|T03058|T03058 NAD+ ADP-ribosyltransferase homolog 034L - Chi...    42   0.014   Invertebrate iridescent virus 6
gb:BC022679_2093858 Mus musculus poly (ADP-ribose) polymerase fa...    39   0.091   
gb:BC021315_2093365 Mus musculus poly (ADP-ribose) polymerase fa...    39   0.091   
gb:BC075801_1989606 Homo sapiens poly (ADP-ribose) polymerase fa...    39   0.091   
gb:AK024961_1910200 Homo sapiens cDNA: FLJ21308 fis, clone COL02...    39   0.091   
gb:HSM805580_1187603 Homo sapiens mRNA; cDNA DKFZp762K2011 (from...    39   0.091   
gb:CR858576_1182743 Pongo pygmaeus mRNA; cDNA DKFZp469M058 (from...    39   0.091   
gb:AK013206_1157387 Mus musculus 10, 11 days embryo whole body c...    39   0.091   
gb:BC063101_2105163 Mus musculus RIKEN cDNA 5430432P15 gene, mRN...    38   0.20    
gb:AF305081_1895930 Homo sapiens tankyrase-related protein mRNA,...    38   0.20    
gb:AX076214_1460641 Sequence 4 from Patent WO0104326.                  38   0.20    
gb:AX062318_1458746 Sequence 177 from Patent WO0100849.                38   0.20    
gb:AX062273_1458739 Sequence 132 from Patent WO0100849.                38   0.20    
gb:AX062247_1458735 Sequence 106 from Patent WO0100849.                38   0.20    
gb:AX062231_1458731 Sequence 90 from Patent WO0100849.                 38   0.20    
gb:AX062229_1458730 Sequence 88 from Patent WO0100849.                 38   0.20    
gb:AX062142_1458725 Sequence 1 from Patent WO0100849.>gb:AX06224...    38   0.20    
sp|Q9H2K2|TNK2_HUMAN|TNK2_HUMAN Tankyrase 2 (EC 2.4.2.30) (TANK2) (Tankyras...    38   0.20    Homo sapiens [man]
gb:BC084432_2563808 Xenopus laevis hypothetical LOC495279, mRNA ...    38   0.26    
gb:AY142108_2514903 Gallus gallus tankyrase 1 mRNA, complete cds.      38   0.26    
gb:AY142107_2514902 Gallus gallus tankyrase 2 mRNA, complete cds.      38   0.26    
gb:BC057370_2102739 Mus musculus tankyrase, TRF1-interacting ank...    38   0.26    
gb:AF082557_1881569 Homo sapiens TRF1-interacting ankyrin-relate...    38   0.26    
gb:AK048860_1168523 Mus musculus 0 day neonate cerebellum cDNA, ...    38   0.26    
sp|O95271|TNK1_HUMAN|TNK1_HUMAN Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyras...    38   0.26    Homo sapiens [man]
gb:AX880827_1478432 Sequence 15732 from Patent EP1074617.>gb:AK0...    37   0.34    
gb:AX062186_1458729 Sequence 45 from Patent WO0100849.                 37   0.34    
gb:CR380950_1649836 Candida glabrata strain CBS138 chromosome D ...    35   2.2     
gb:AX062182_1458727 Sequence 41 from Patent WO0100849.>gb:AX0621...    35   2.2     
gb:AX880408_1478265 Sequence 15313 from Patent EP1074617.>gb:AK0...    33   5.0     
gb:HSM806627_2018379 Homo sapiens mRNA; cDNA DKFZp686H1869 (from...    33   6.5     
gb:BC027462_1978897 Homo sapiens zinc finger CCCH type, antivira...    33   6.5     
gb:CR858482_1182655 Pongo pygmaeus mRNA; cDNA DKFZp469D094 (from...    33   6.5     
sp|Q7Z2W4|ZCC2_HUMAN|ZCC2_HUMAN Zinc finger CCCH type antiviral protein 1 (...    33   6.5     Homo sapiens [man]


>pir|T51353|T51353 NAD ADP-ribosyltransferase (EC 2.4.2.30) [imported]
            - Arabidopsis thaliana>gb:ATH131705_1551993 Arabidopsis
            thaliana mRNA for poly(ADP-ribose)
            polymerase.>gb:AY091061_1574289 Arabidopsis thaliana
            putative poly (ADP-ribose) polymerase (At2g31320) mRNA,
            complete cds.>gb:AY150460_1585025 Arabidopsis thaliana
            putative poly(ADP-ribose) polymerase (At2g31320) mRNA,
            complete cds.
          Length = 983

 Score =  354 bits (908), Expect = 1e-96
 Identities = 163/206 (79%), Positives = 190/206 (92%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHGSR
Sbjct: 777  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHGSR 836

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct: 837  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA 896

Query: 457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL 278
            LG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct: 897  LGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVSSKVKASEL 956

Query: 277  LYNEYIVYDIAQVKLQFLVKVRFQYK 200
            +YNEYIVYD AQVKLQFL+KVRF++K
Sbjct: 957  MYNEYIVYDTAQVKLQFLLKVRFKHK 982



>pir|C84719|C84719 probable poly (ADP-ribose) polymerase [imported] -
            Arabidopsis thaliana>gb:AC006593_1534597 Arabidopsis
            thaliana chromosome 2 clone F16D14 map nga361, complete
            sequence.
          Length = 1009

 Score =  354 bits (908), Expect = 1e-96
 Identities = 163/206 (79%), Positives = 190/206 (92%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            DSED+RL+EKYL  THAPTH EW+LE+E+VF+LER+GE DK+AP R+KL N+MLLWHGSR
Sbjct: 803  DSEDYRLIEKYLNTTHAPTHTEWSLELEEVFALEREGEFDKYAPHREKLGNKMLLWHGSR 862

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            LTNFVGIL+QGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+T +KNPVG MLLSEVA
Sbjct: 863  LTNFVGILNQGLRIAPPEAPATGYMFGKGIYFADLVSKSAQYCYTCKKNPVGLMLLSEVA 922

Query: 457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL 278
            LG++HEL KA+YMDKPP+GKHSTKGLGK VPQ+S++ KWR +V VPCGKPV SKVKASEL
Sbjct: 923  LGEIHELTKAKYMDKPPRGKHSTKGLGKKVPQDSEFAKWRGDVTVPCGKPVSSKVKASEL 982

Query: 277  LYNEYIVYDIAQVKLQFLVKVRFQYK 200
            +YNEYIVYD AQVKLQFL+KVRF++K
Sbjct: 983  MYNEYIVYDTAQVKLQFLLKVRFKHK 1008



>gb:AF093627_1767676 Zea mays poly(ADP)-ribose polymerase (PARP1)
            mRNA, complete cds.
          Length = 980

 Score =  342 bits (878), Expect = 4e-93
 Identities = 156/206 (75%), Positives = 189/206 (91%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            DSED++L+E+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHGSR
Sbjct: 774  DSEDYKLIEQYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSR 833

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +R NPVG MLLSEVA
Sbjct: 834  LTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPVGLMLLSEVA 893

Query: 457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL 278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS +++SEL
Sbjct: 894  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSSEL 953

Query: 277  LYNEYIVYDIAQVKLQFLVKVRFQYK 200
            +YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct: 954  MYNEYIVYNTSQVKMQFLLKVRFHHK 979



>pir|T03657|T03657 NAD ADP-ribosyltransferase (EC 2.4.2.30) 2 -
            maize>gb:ZMPARP2_1731947 Zea mays mRNA for
            poly(ADP-ribose) polymerase (3211bp).
          Length = 969

 Score =  342 bits (878), Expect = 4e-93
 Identities = 156/206 (75%), Positives = 189/206 (91%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            DSED++L+E+YL  THAPTHK+W+LE+E+VFSL+R GEL+K++ ++  L N+MLLWHGSR
Sbjct: 763  DSEDYKLIEQYLLNTHAPTHKDWSLELEEVFSLDRDGELNKYSRYKNNLHNKMLLWHGSR 822

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            LTNFVGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +R NPVG MLLSEVA
Sbjct: 823  LTNFVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRNNPVGLMLLSEVA 882

Query: 457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL 278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++VKWRD+VVVPCGKPVPS +++SEL
Sbjct: 883  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFVKWRDDVVVPCGKPVPSSIRSSEL 942

Query: 277  LYNEYIVYDIAQVKLQFLVKVRFQYK 200
            +YNEYIVY+ +QVK+QFL+KVRF +K
Sbjct: 943  MYNEYIVYNTSQVKMQFLLKVRFHHK 968



>gb:AP005247_1849489 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OSJNBa0077F02.
          Length = 977

 Score =  339 bits (870), Expect = 3e-92
 Identities = 155/206 (75%), Positives = 185/206 (89%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            D ED++LVEKYL  THAPTHKEW+LE+E+VFSL+R GE  K++ ++  L N+MLLWHGSR
Sbjct: 771  DCEDYKLVEKYLLNTHAPTHKEWSLELEEVFSLDRDGEFSKYSRYKNNLHNKMLLWHGSR 830

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            LTN+VGILSQGLRIAPPEAP TGYMFGKG+YFAD+VSKSAQYC+ +RKNPVG MLLSEVA
Sbjct: 831  LTNYVGILSQGLRIAPPEAPVTGYMFGKGLYFADLVSKSAQYCYVDRKNPVGLMLLSEVA 890

Query: 457  LGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL 278
            LGDM+ELKKA  MDKPP+GKHSTKGLGKTVP ES++ KWRD+VVVPCGKPVP+ +K SEL
Sbjct: 891  LGDMYELKKATSMDKPPRGKHSTKGLGKTVPLESEFAKWRDDVVVPCGKPVPASIKTSEL 950

Query: 277  LYNEYIVYDIAQVKLQFLVKVRFQYK 200
            +YNEYIVY+ +QVK+Q+L+KVRF +K
Sbjct: 951  MYNEYIVYNTSQVKMQYLLKVRFHHK 976



>gb:RNPARP2_2136168 R.norvegicus mRNA for poly(ADP-ribose)
           polymerase (clone pRATC).
          Length = 492

 Score =  257 bits (656), Expect = 2e-67
 Identities = 127/207 (61%), Positives = 158/207 (76%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 284 RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 342

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
           R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 343 RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 402

Query: 460 ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct: 403 ALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSASIT-LDGVEVPLGTGIPSGVNDTC 461

Query: 280 LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
           LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 462 LLYNEYIVYDIAQVNLKYLLKLKFNFK 488



>gb:BC085765_2109334 Rattus norvegicus ADP-ribosyltransferase 1, mRNA
            (cDNA clone MGC:93658 IMAGE:7107130), complete
            cds.>gb:RNU94340_2137944 Rattus norvegicus
            poly(ADP-ribose) polymerase mRNA, complete cds.
          Length = 1014

 Score =  257 bits (656), Expect = 2e-67
 Identities = 127/207 (61%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 806  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 864

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 865  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 924

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct: 925  ALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSASIT-LDGVEVPLGTGIPSGVNDTC 983

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 984  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1010



>pir|S26057|S26057 NAD ADP-ribosyltransferase (EC 2.4.2.30) - rat
           (fragment)
          Length = 500

 Score =  257 bits (656), Expect = 2e-67
 Identities = 127/207 (61%), Positives = 158/207 (76%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 292 RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 350

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
           R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 351 RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 410

Query: 460 ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct: 411 ALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSASIT-LDGVEVPLGTGIPSGVNDTC 469

Query: 280 LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
           LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 470 LLYNEYIVYDIAQVNLKYLLKLKFNFK 496



>sp|P27008|PPOL_RAT Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1)
            (Poly[ADP-ribose] synthetase-1).
          Length = 1013

 Score =  257 bits (656), Expect = 2e-67
 Identities = 127/207 (61%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 805  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 863

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 864  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 923

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  +PS V  + 
Sbjct: 924  ALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSASIT-LDGVEVPLGTGIPSGVNDTC 982

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 983  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1009



>gb:HUMRISDAD_2036297 Human poly(ADP-ribose) synthetase mRNA, complete
            cds.
          Length = 1014

 Score =  256 bits (654), Expect = 4e-67
 Identities = 126/207 (60%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 806  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 864

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 865  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 924

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 925  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVNDTS 983

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 984  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1010



>gb:HUMPOLP_2035772 Human poly(ADP-ribose) polymerase mRNA, complete
            cds.
          Length = 1014

 Score =  256 bits (654), Expect = 4e-67
 Identities = 126/207 (60%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 806  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 864

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 865  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 924

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 925  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVNDTS 983

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 984  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1010



>gb:HUMADPPO_2029031 Human placental poly(ADP-ribose) polymerase
           mRNA, partial cds.
          Length = 574

 Score =  256 bits (654), Expect = 4e-67
 Identities = 126/207 (60%), Positives = 157/207 (75%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 366 RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 424

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
           R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 425 RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 484

Query: 460 ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 485 ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVNDTS 543

Query: 280 LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
           LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 544 LLYNEYIVYDIAQVNLKYLLKLKFNFK 570



>gb:BC037545_1982208 Homo sapiens poly (ADP-ribose) polymerase family,
            member 1, mRNA (cDNA clone MGC:40266 IMAGE:5193735),
            complete cds.
          Length = 1014

 Score =  256 bits (654), Expect = 4e-67
 Identities = 126/207 (60%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 806  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 864

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 865  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 924

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 925  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVNDTS 983

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 984  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1010



>gb:A52134_1449749 Sequence 1 from Patent WO9618737.
          Length = 1013

 Score =  256 bits (654), Expect = 4e-67
 Identities = 126/207 (60%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 805  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 863

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 864  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 923

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 924  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVNDTS 982

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 983  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1009



>pir|A29725|A29725 NAD ADP-ribosyltransferase (EC 2.4.2.30), nuclear -
            human>gb:AF524947_1905970 Homo sapiens
            ADP-ribosyltransferase (NAD+; poly (ADP-ribose)
            polymerase) (ADPRT) gene, complete
            cds.>gb:AL359704_1925663 Human DNA sequence from clone
            RP11-118H4 on chromosome 1 Contains the 5' end of the
            ADPRT gene for ADP-ribosyltransferase (NAD+; poly
            (ADP-ribose) polymerase), a ribosomal protein S3A (RPS3A)
            pseudogene, a novel pseudogene, the 5' end of a novel
            gene (DKFZp761P211) and a CpG island, complete
            sequence.>gb:AL359742_1925736 Human DNA sequence from
            clone RP11-125A15 on chromosome 1 Contains the 5' end of
            the gene for TUDOR gene similar (TGS), a pseudogene
            similar to part of nuclease sensitive element binding
            protein 1 (NSEP1), the 3' end of the ADPRT gene for
            ADP-ribosyltransferase (NAD+; poly (ADP-ribose)
            polymerase) and a CpG island, complete
            sequence.>gb:HUMADPRT23_2029039 Human NAD+
            ADP-ribosyltransferase (ADPRT) gene, exon 23.
          Length = 1014

 Score =  256 bits (654), Expect = 4e-67
 Identities = 126/207 (60%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 806  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 864

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 865  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 924

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 925  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVNDTS 983

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 984  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1010



>sp|P09874|PPOL_HUMAN Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1)
            (Poly[ADP-ribose] synthetase-1).
          Length = 1013

 Score =  256 bits (654), Expect = 4e-67
 Identities = 126/207 (60%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 805  RDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 863

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 864  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 923

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 924  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVNDTS 982

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 983  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1009



>gb:AF168781_2057604 Cricetulus griseus poly ADP-ribose polymerase
            (PARP) mRNA, complete cds.
          Length = 1013

 Score =  256 bits (653), Expect = 5e-67
 Identities = 126/207 (60%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 805  RDSEEAEVIRKYVKNTHATTHNAYDLEVMDIFKIEREGESQRYKPF-KQLHNRRLLWHGS 863

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 864  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 923

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct: 924  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-LEGVEVPLGTGIPSGVNDTC 982

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 983  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1009



>pir|S04200|S04200 NAD ADP-ribosyltransferase (EC 2.4.2.30) -
            mouse>gb:MMADPRP_2113902 Mouse mRNA for poly (ADP-ribose)
            polymerase (EC 2.4.2.30).
          Length = 1013

 Score =  256 bits (653), Expect = 5e-67
 Identities = 125/207 (60%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 805  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 863

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct: 864  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEV 923

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct: 924  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-LEGVEVPLGTGIPSGVNDTA 982

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 983  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1009



>sp|P11103|PPOL_MOUSE Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1)
            (Poly[ADP-ribose] synthetase-1) (msPARP).
          Length = 1012

 Score =  256 bits (653), Expect = 5e-67
 Identities = 125/207 (60%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 804  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 862

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct: 863  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEV 922

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct: 923  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-LEGVEVPLGTGIPSGVNDTA 981

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 982  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1008



>sp|Q9R152|PPOL_CRIGR Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1)
            (Poly[ADP-ribose] synthetase-1).
          Length = 1012

 Score =  256 bits (653), Expect = 5e-67
 Identities = 126/207 (60%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 804  RDSEEAEVIRKYVKNTHATTHNAYDLEVMDIFKIEREGESQRYKPF-KQLHNRRLLWHGS 862

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 863  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 922

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct: 923  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-LEGVEVPLGTGIPSGVNDTC 981

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 982  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1008



>gb:AK030889_1162216 Mus musculus adult male thymus cDNA, RIKEN
            full-length enriched library, clone:5830444G22
            product:POLY [ADP-RIBOSE] POLYMERASE-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-RIBOSYLTRANSFERASE-1)
            (POLY[ADP-RIBOSE] SYNTHETASE-1) homolog [Rattus
            norvegicus], full insert sequence.>gb:AK088679_1175551
            Mus musculus 2 days neonate thymus thymic cells cDNA,
            RIKEN full-length enriched library, clone:E430023G15
            product:POLY [ADP-RIBOSE] POLYMERASE-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-RIBOSYLTRANSFERASE-1)
            (POLY[ADP-RIBOSE] SYNTHETASE-1) homolog [Rattus
            norvegicus], full insert sequence.>gb:BC012041_2091473
            Mus musculus poly (ADP-ribose) polymerase family, member
            1, mRNA (cDNA clone MGC:6498 IMAGE:2648390), complete
            cds.
          Length = 1014

 Score =  255 bits (652), Expect = 6e-67
 Identities = 126/207 (60%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 806  RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 864

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 865  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEV 924

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct: 925  ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-LEGVEVPLGTGIPSGVNDTC 983

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 984  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1010



>gb:AF126717_2055497 Mus musculus msPARP mRNA, complete cds.
          Length = 492

 Score =  254 bits (650), Expect = 1e-66
 Identities = 125/207 (60%), Positives = 158/207 (76%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PFR+ L NR LLWHGS
Sbjct: 284 RDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIEREGESQRYKPFRQ-LHNRRLLWHGS 342

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
           R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G ++L EV
Sbjct: 343 RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLIMLGEV 402

Query: 460 ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           ALG+M+ELK A ++ K PKGKHS KGLGKT P  S  +   + V VP G  +PS V  + 
Sbjct: 403 ALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSASIT-LEGVEVPLGTGIPSGVNDTC 461

Query: 280 LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
           LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 462 LLYNEYIVYDIAQVNLKYLLKLKFNFK 488



>pir|JS0428|JS0428 NAD ADP-ribosyltransferase (EC 2.4.2.30) -
            bovine>gb:BOVPAS_1435716 Bos taurus mRNA for
            poly(ADP-ribose) synthetase, complete cds.
          Length = 1016

 Score =  251 bits (642), Expect = 9e-66
 Identities = 124/207 (59%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 808  KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS 866

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL E 
Sbjct: 867  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEA 926

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A+++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 927  ALGNMYELKHARHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC 985

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 986  LLYNEYIVYDIAQVHLKYLLKLKFNFK 1012



>sp|P18493|PPOL_BOVIN Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1)
            (Poly[ADP-ribose] synthetase-1).
          Length = 1015

 Score =  251 bits (642), Expect = 9e-66
 Identities = 124/207 (59%), Positives = 157/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            +DSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 807  KDSEEAEIIRKYVKNTHATTHNAYDLEVVDIFKIEREGESQRYKPF-KQLHNRRLLWHGS 865

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL E 
Sbjct: 866  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILLGEA 925

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A+++ K PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 926  ALGNMYELKHARHISKLPKGKHSVKGLGKTTPDPSASIT-VDGVEVPLGTGISSGVNDTC 984

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 985  LLYNEYIVYDIAQVHLKYLLKLKFNFK 1011



>gb:BX470188_2567423 Zebrafish DNA sequence from clone DKEY-206F10 in
            linkage group 20 Contains the gene for a novel protein
            similar to vertebrate adenylate cyclase 8 (ADCY8), the
            gene for a novel protein similar to vertebrate
            ADP-ribosyltransferase (NAD+; poly (ADP-ribose)
            polymerase) (ADPRT), the gene for a novel protein similar
            to vertebrate adenosine A3 receptor (ADORA3), the gene
            for a novel protein containing a DIRP domain and a CpG
            island, complete sequence.
          Length = 1013

 Score =  251 bits (641), Expect = 1e-65
 Identities = 120/207 (57%), Positives = 159/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            + S + +L+ +Y++ THA TH  + L+VE++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 805  KSSHEAQLILQYVKNTHAATHNTYTLDVEEIFKIEREGEYQRYRPF-KELPNRQLLWHGS 863

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADMVSKSA YC T++ +PVG +LL EV
Sbjct: 864  RTTNYAGILSQGLRIAPPEAPVTGYMFGKGVYFADMVSKSANYCHTSQADPVGLILLGEV 923

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+MHELKKA ++ K PKGKHS KGLG++ P     V   + V +P GK + + +  + 
Sbjct: 924  ALGNMHELKKASHITKLPKGKHSVKGLGRSAPDPRATVS-LNGVDIPLGKGMNTNIDDTS 982

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYD++QV L++L+K+RF Y+
Sbjct: 983  LLYNEYIVYDVSQVNLKYLLKIRFNYQ 1009



>pir|S31735|S31735 NAD ADP-ribosyltransferase (EC 2.4.2.30) - African
            clawed frog (fragment)
          Length = 998

 Score =  251 bits (641), Expect = 1e-65
 Identities = 124/207 (59%), Positives = 155/207 (74%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            +DSE+ R++  Y++ THA TH  + LEV ++F ++R+GE  ++ PF K+L NR LLWHGS
Sbjct: 789  KDSEESRIICDYVKNTHADTHNAYDLEVLEIFKIDREGEYQRYKPF-KQLHNRQLLWHGS 847

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC     +P+G +LL EV
Sbjct: 848  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHAMPGSPIGLILLGEV 907

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+MHELK A  + K PKGKHS KGLG+T P  S  V+  D V VP GK   + +  + 
Sbjct: 908  ALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSATVQ-LDGVDVPLGKGTSANISDTS 966

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F YK
Sbjct: 967  LLYNEYIVYDIAQVNLKYLLKLKFNYK 993



>sp|P31669|PPOL_XENLA Poly [ADP-ribose] polymerase (EC 2.4.2.30)
            (PARP) (ADPRT) (NAD(+) ADP- ribosyltransferase)
            (Poly[ADP-ribose] synthetase)
            (Fragment).>gb:XLPARPG_2583041 X.laevis PARP gene
            encoding poly(ADP-ribose) polymerase.
          Length = 998

 Score =  251 bits (641), Expect = 1e-65
 Identities = 124/207 (59%), Positives = 155/207 (74%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            +DSE+ R++  Y++ THA TH  + LEV ++F ++R+GE  ++ PF K+L NR LLWHGS
Sbjct: 789  KDSEESRIICDYVKNTHADTHNAYDLEVLEIFKIDREGEYQRYKPF-KQLHNRQLLWHGS 847

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC     +P+G +LL EV
Sbjct: 848  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHAMPGSPIGLILLGEV 907

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+MHELK A  + K PKGKHS KGLG+T P  S  V+  D V VP GK   + +  + 
Sbjct: 908  ALGNMHELKAASQITKLPKGKHSVKGLGRTAPDPSATVQ-LDGVDVPLGKGTSANISDTS 966

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F YK
Sbjct: 967  LLYNEYIVYDIAQVNLKYLLKLKFNYK 993



>sp|P26446|PPOL_CHICK Poly [ADP-ribose] polymerase-1 (EC 2.4.2.30)
            (PARP-1) (ADPRT) (NAD(+) ADP-ribosyltransferase-1)
            (Poly[ADP-ribose] synthetase-1).
          Length = 1011

 Score =  250 bits (639), Expect = 2e-65
 Identities = 120/207 (57%), Positives = 159/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            +DSE+ +++++Y++ THA TH  + L+V ++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 803  KDSEEAKIIKQYVKNTHAATHNAYDLKVVEIFRIEREGESQRYKPF-KQLHNRQLLWHGS 861

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T++ +P+G +LL EV
Sbjct: 862  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQADPIGLILLGEV 921

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P +       D V VP G  + + +  + 
Sbjct: 922  ALGNMYELKNASHITKLPKGKHSVKGLGKTAP-DPTATTTLDGVEVPLGNGISTGINDTC 980

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct: 981  LLYNEYIVYDVAQVNLKYLLKLKFNYK 1007



>gb:AX058340_1458411 Sequence 24 from Patent
            WO0077179.>gb:AX062277_1458741 Sequence 136 from Patent
            WO0100849.>gb:HUMPPOL_2035831 Human poly(ADP-ribose)
            polymerase mRNA, complete cds.
          Length = 1014

 Score =  249 bits (637), Expect = 3e-65
 Identities = 124/207 (59%), Positives = 156/207 (75%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDSE+  ++ KY++ THA TH  + LEV  +F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 806  RDSEEAEIIRKYVKNTHATTHSAYDLEVIDIFKIEREGECQRYKPF-KQLHNRRLLWHGS 864

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YFADMVSKSA Y  T++ +P+G +LL EV
Sbjct: 865  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYYHTSQGDPIGLILLGEV 924

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ + PKGKHS KGLGKT P  S  +   D V VP G  + S V  + 
Sbjct: 925  ALGNMYELKHASHISRLPKGKHSVKGLGKTTPDPSANIS-LDGVDVPLGTGISSGVIDTS 983

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYDIAQV L++L+K++F +K
Sbjct: 984  LLYNEYIVYDIAQVNLKYLLKLKFNFK 1010



>pir|JH0581|JH0581 NAD ADP-ribosyltransferase (EC 2.4.2.30) -
            chicken>gb:GGPADPRP_2573351 Chicken mRNA for
            poly(ADP-ribose) polymerase (EC 2.4.2.30).
          Length = 1011

 Score =  248 bits (634), Expect = 8e-65
 Identities = 119/207 (57%), Positives = 158/207 (76%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            +DSE+ +++++Y++ THA TH  + L+V ++F +ER+GE  ++ PF K+L NR LLWHGS
Sbjct: 803  KDSEEAKIIKQYVKNTHAATHNAYDLKVVEIFRIEREGESQRYKPF-KQLHNRQLLWHGS 861

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R TNF GILSQGLRIAPPEAP TGYMFGKG+YF DMVSKSA YC T++ +P+G +LL EV
Sbjct: 862  RTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFRDMVSKSANYCHTSQADPIGLILLGEV 921

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG+M+ELK A ++ K PKGKHS KGLGKT P +       D V VP G  + + +  + 
Sbjct: 922  ALGNMYELKNASHITKLPKGKHSVKGLGKTAP-DPTATTTLDGVEVPLGNGISTGINDTC 980

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVYD+AQV L++L+K++F YK
Sbjct: 981  LLYNEYIVYDVAQVNLKYLLKLKFNYK 1007



>sp|Q11208|PPOL_SARPE Poly [ADP-ribose] polymerase (EC 2.4.2.30)
            (PARP) (ADPRT) (NAD(+) ADP- ribosyltransferase)
            (Poly[ADP-ribose] synthetase).>pir|S42208|S42208 NAD
            ADP-ribosyltransferase (EC 2.4.2.30) - flesh fly
            (Sarcophaga peregrina)>gb:SPEPADPRP_1397938 Sarcophaga
            peregrina mRNA for poly(ADP-ribose) polymerase, complete
            cds.
          Length = 996

 Score =  246 bits (629), Expect = 3e-64
 Identities = 119/207 (57%), Positives = 154/207 (74%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            ++SE++ L++KY++ THA THK + LEV  +F + R+GE  ++ PF KKL NR LLWHGS
Sbjct: 791  KNSEEYILLQKYVKNTHAETHKLYDLEVVDIFKVARQGEARRYKPF-KKLHNRRLLWHGS 849

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            RLTNF GILS GL+IAPPEAP TGYMFGKG+YFADMVSKSA YC T+  N  G MLLSEV
Sbjct: 850  RLTNFAGILSHGLKIAPPEAPVTGYMFGKGIYFADMVSKSANYCCTSHHNSTGLMLLSEV 909

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALGDM E   A+Y+ K P  KHS  G G+T+P  S+ +   D V +P GKP+ +    S 
Sbjct: 910  ALGDMMECTAAKYVTKLPNDKHSCFGRGRTMPNPSESIIREDGVEIPLGKPITNDSLKSS 969

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNE+I+YDIAQV +Q+++++ F+YK
Sbjct: 970  LLYNEFIIYDIAQVNIQYMLRMNFKYK 996



>gb:AY118947_1300669 Drosophila melanogaster LD31274 full insert
           cDNA.
          Length = 557

 Score =  239 bits (609), Expect = 6e-62
 Identities = 117/206 (56%), Positives = 151/206 (73%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           ++SE+F ++ +Y++ THA THK + L++  VF + R+GE  +F PF KKL NR LLWHGS
Sbjct: 351 KNSEEFSILSQYVKNTHASTHKSYDLKIVDVFKVSRQGEARRFKPF-KKLHNRKLLWHGS 409

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
           RLTNFVGILS GLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+++N  G MLLSEV
Sbjct: 410 RLTNFVGILSHGLRIAPPEAPPTGYMFGKGIYFADMVSKSANYCCTSQQNSTGLMLLSEV 469

Query: 460 ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           ALGDM E   A+Y++K    KHS  G G+T+P  +      D V +P G+ +  +   S 
Sbjct: 470 ALGDMMECTSAKYINKLSNNKHSCFGRGRTMPDPTKSYIRSDGVEIPYGETITDEHLKSS 529

Query: 280 LLYNEYIVYDIAQVKLQFLVKVRFQY 203
           LLYNEYIVYD+AQV +Q+L ++ F+Y
Sbjct: 530 LLYNEYIVYDVAQVNIQYLFRMEFKY 555



>sp|P35875|PPOL_DROME Poly [ADP-ribose] polymerase (EC 2.4.2.30)
            (PARP) (ADPRT) (NAD(+) ADP- ribosyltransferase)
            (Poly[ADP-ribose] synthetase).>pir|A47474|A47474 NAD
            ADP-ribosyltransferase (EC 2.4.2.30) - fruit fly
            (Drosophila melanogaster)>gb:BT015238_1358315 Drosophila
            melanogaster RE04933 full insert cDNA.>gb:DMPARP5_1379939
            Drosophila melanogaster poly(ADP-ribose) polymerase
            (PARP) gene, exon 6 and complete
            cds.>gb:DROADPRPA_1381658 Drosophila melanogaster mRNA
            for poly(ADP-ribose) polymerase, complete cds.
          Length = 994

 Score =  239 bits (609), Expect = 6e-62
 Identities = 117/206 (56%), Positives = 151/206 (73%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            ++SE+F ++ +Y++ THA THK + L++  VF + R+GE  +F PF KKL NR LLWHGS
Sbjct: 788  KNSEEFSILSQYVKNTHASTHKSYDLKIVDVFKVSRQGEARRFKPF-KKLHNRKLLWHGS 846

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            RLTNFVGILS GLRIAPPEAP TGYMFGKG+YFADMVSKSA YC T+++N  G MLLSEV
Sbjct: 847  RLTNFVGILSHGLRIAPPEAPPTGYMFGKGIYFADMVSKSANYCCTSQQNSTGLMLLSEV 906

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALGDM E   A+Y++K    KHS  G G+T+P  +      D V +P G+ +  +   S 
Sbjct: 907  ALGDMMECTSAKYINKLSNNKHSCFGRGRTMPDPTKSYIRSDGVEIPYGETITDEHLKSS 966

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQY 203
            LLYNEYIVYD+AQV +Q+L ++ F+Y
Sbjct: 967  LLYNEYIVYDVAQVNIQYLFRMEFKY 992



>pir|T01311|T01311 NAD ADP-ribosyltransferase (EC 2.4.2.30) -
            Arabidopsis thaliana>gb:ATCHRIV6_1546227 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            6.>gb:T14P8_1723444 Arabidopsis thaliana BAC T14P8.
          Length = 635

 Score =  236 bits (602), Expect = 4e-61
 Identities = 119/207 (57%), Positives = 145/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            DSE+F +V  Y++ THA TH  + +E+ Q+F   R  E D+F  F    KNRMLLWHGSR
Sbjct: 429  DSEEFSMVANYMENTHAKTHSGYTVEIAQLFRASRAVEADRFQQFSSS-KNRMLLWHGSR 487

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            LTN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM SKSA YC+ N     G +LL EVA
Sbjct: 488  LTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYANTGANDGVLLLCEVA 547

Query: 457  LGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            LGDM+EL  + Y  D  P GK STKG+GKT P  S+     D VVVP GKPV        
Sbjct: 548  LGDMNELLYSDYNADNLPPGKLSTKGVGKTAPNPSEAQTLEDGVVVPLGKPVERSCSKGM 607

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVY++ Q+K++++++V+F YK
Sbjct: 608  LLYNEYIVYNVEQIKMRYVIQVKFNYK 634



>sp|Q11207|PPOL_ARATH Poly [ADP-ribose] polymerase (EC 2.4.2.30)
            (PARP) (ADPRT) (NAD(+) ADP- ribosyltransferase)
            (Poly[ADP-ribose] synthetase).>gb:ATPARP_1553826
            A.thaliana PARP mRNA for PARP protein.
          Length = 637

 Score =  236 bits (602), Expect = 4e-61
 Identities = 119/207 (57%), Positives = 145/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            DSE+F +V  Y++ THA TH  + +E+ Q+F   R  E D+F  F    KNRMLLWHGSR
Sbjct: 431  DSEEFSMVANYMENTHAKTHSGYTVEIAQLFRASRAVEADRFQQFSSS-KNRMLLWHGSR 489

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            LTN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM SKSA YC+ N     G +LL EVA
Sbjct: 490  LTNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYANTGANDGVLLLCEVA 549

Query: 457  LGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            LGDM+EL  + Y  D  P GK STKG+GKT P  S+     D VVVP GKPV        
Sbjct: 550  LGDMNELLYSDYNADNLPPGKLSTKGVGKTAPNPSEAQTLEDGVVVPLGKPVERSCSKGM 609

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVY++ Q+K++++++V+F YK
Sbjct: 610  LLYNEYIVYNVEQIKMRYVIQVKFNYK 636



>gb:AP003258_1826504 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0463A02.>gb:AP003764_1833164 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:B1051E10.
          Length = 633

 Score =  219 bits (557), Expect = 6e-56
 Identities = 109/206 (52%), Positives = 144/206 (69%), Gaps = 1/206 (0%)
 Frame = -2

Query: 814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL 635
            SE++ +++ YL  TH  TH  + ++V Q+F + R GE+++F  F     NRMLLWHGSRL
Sbjct: 427  SEEYSMIKTYLANTHGKTHTSYTVDVVQIFKVSRHGEMERFQKFATA-GNRMLLWHGSRL 485

Query: 634  TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL 455
            TN+ GILSQGLRIAPPEAP TGYMFGKGVYFADM SKSA YC+ +     G +LL EVAL
Sbjct: 486  TNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYASEACRSGVLLLCEVAL 545

Query: 454  GDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASEL 278
            G+M+EL  A Y  +  PKGK STKG+G+T P  ++     D VVVP GKP     K   L
Sbjct: 546  GEMNELLNADYDANNLPKGKLSTKGVGQTEPNTAESKITDDGVVVPLGKPKAEPSKRGSL 605

Query: 277  LYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LYNE+IVY++ Q+++++++ V F +K
Sbjct: 606  LYNEFIVYNVDQIRMRYVLHVSFNFK 631



>pir|T03656|T03656 probable NAD ADP-ribosyltransferase (EC 2.4.2.30) -
            maize>gb:ZMPARP1_1731946 Zea mays mRNA for
            poly(ADP-ribose) polymerase (2295bp).
          Length = 653

 Score =  216 bits (551), Expect = 3e-55
 Identities = 106/207 (51%), Positives = 144/207 (69%), Gaps = 1/207 (0%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            DS+++ +++ YL+ TH  TH  + +++ Q+F + R GE ++F  F    +NRMLLWHGSR
Sbjct: 446  DSDEYSMIKSYLRNTHGKTHSGYTVDIVQIFKVSRHGETERFQKFAST-RNRMLLWHGSR 504

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
            L+N+ GILSQGLRIAPPEAP TGYMFGKGVYFADM SKSA YC+ +     G +LL EVA
Sbjct: 505  LSNWAGILSQGLRIAPPEAPVTGYMFGKGVYFADMFSKSANYCYASEACRSGVLLLCEVA 564

Query: 457  LGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            LGDM+EL  A Y  +  PKGK  +KG+G+T P   +     D VVVP G+P     K   
Sbjct: 565  LGDMNELLNADYDANNLPKGKLRSKGVGQTAPNMVESKVADDGVVVPLGEPKQEPSKRGG 624

Query: 280  LLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            LLYNEYIVY++ Q+++++++ V F +K
Sbjct: 625  LLYNEYIVYNVDQIRMRYVLHVNFNFK 651



>gb:BC076765_2559510 Xenopus laevis ADP-ribosyltransferase (NAD+,
           poly(ADP-ribose) polymerase)-like 2, mRNA (cDNA clone
           MGC:83159 IMAGE:6630870), complete cds.
          Length = 558

 Score =  214 bits (544), Expect = 2e-54
 Identities = 114/208 (54%), Positives = 147/208 (70%), Gaps = 4/208 (1%)
 Frame = -2

Query: 814 SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL 635
           S  F+L+E YLQ+THAPTH ++ + + +VF L+R GE      FR+ L NRMLLWHGSRL
Sbjct: 351 SSTFQLIEGYLQSTHAPTHNDYTMTLLRVFELQRVGEE---CNFREDLPNRMLLWHGSRL 407

Query: 634 TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL 455
           TN+VGILSQGLR+APPEAP TGYMFGKG+YFAD+ SKSA YCF++R   VG +LLSEVAL
Sbjct: 408 TNWVGILSQGLRVAPPEAPVTGYMFGKGIYFADVSSKSANYCFSSRDKNVGVLLLSEVAL 467

Query: 454 GDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVK---A 287
           G+ +EL  A     K  K KHSTKGLG+++P     +   +  VVP G  + + +     
Sbjct: 468 GECNELLAADCDAQKKIKSKHSTKGLGRSIPDPKKSI-IHEGAVVPLGPLMDTGLTNDGG 526

Query: 286 SELLYNEYIVYDIAQVKLQFLVKVRFQY 203
             L YNEYIVYD  QV++++L++VRF Y
Sbjct: 527 YTLNYNEYIVYDPHQVRMKYLLQVRFNY 554



>gb:AF072521_2053371 Mus musculus poly-(ADPribosyl)-transferase
           homolog PARP mRNA, complete cds.
          Length = 522

 Score =  206 bits (524), Expect = 4e-52
 Identities = 105/209 (50%), Positives = 146/209 (69%), Gaps = 4/209 (1%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTHK++ + +  VF +E++GE + F   R+ L NRMLLWHGSR
Sbjct: 314 ESNEFKVISQYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAF---REDLPNRMLLWHGSR 370

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           L+N+VGILS GLR+APPEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 371 LSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVA 430

Query: 457 LGDMHELKKAQYMDKP-PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           LG  +EL +A    +   +GKHSTKG+GK  P  + ++       VP G    + +   E
Sbjct: 431 LGQCNELLEANPKAQGLLRGKHSTKGMGKMAPSPAHFITLNGS-TVPLGPASDTGILNPE 489

Query: 280 ---LLYNEYIVYDIAQVKLQFLVKVRFQY 203
              L YNE+IVY   QV++++L+K++F +
Sbjct: 490 GYTLNYNEFIVYSPNQVRMRYLLKIQFNF 518



>sp|O88554|PPO2_MOUSE Poly [ADP-ribose] polymerase-2 (EC 2.4.2.30)
           (PARP-2) (NAD(+) ADP- ribosyltransferase-2)
           (Poly[ADP-ribose] synthetase-2) (pADPRT-2)
           (mPARP-2).>gb:AX058338_1458410 Sequence 22 from Patent
           WO0077179.>gb:BC062150_2104903 Mus musculus poly
           (ADP-ribose) polymerase family, member 2, mRNA (cDNA
           clone MGC:70033 IMAGE:6333875), complete
           cds.>gb:MMU7780_2123472 Mus musculus mRNA for
           poly(ADP-ribose) polymerase-2.
          Length = 559

 Score =  206 bits (524), Expect = 4e-52
 Identities = 105/209 (50%), Positives = 146/209 (69%), Gaps = 4/209 (1%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTHK++ + +  VF +E++GE + F   R+ L NRMLLWHGSR
Sbjct: 351 ESNEFKVISQYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAF---REDLPNRMLLWHGSR 407

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           L+N+VGILS GLR+APPEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 408 LSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVA 467

Query: 457 LGDMHELKKAQYMDKP-PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           LG  +EL +A    +   +GKHSTKG+GK  P  + ++       VP G    + +   E
Sbjct: 468 LGQCNELLEANPKAQGLLRGKHSTKGMGKMAPSPAHFITLNGS-TVPLGPASDTGILNPE 526

Query: 280 ---LLYNEYIVYDIAQVKLQFLVKVRFQY 203
              L YNE+IVY   QV++++L+K++F +
Sbjct: 527 GYTLNYNEFIVYSPNQVRMRYLLKIQFNF 555



>gb:AF191547_2058518 Mus musculus poly (ADP-ribose) polymerase 2
           (Parp2) gene, complete cds.
          Length = 559

 Score =  206 bits (523), Expect = 6e-52
 Identities = 105/209 (50%), Positives = 146/209 (69%), Gaps = 4/209 (1%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTHK++ + +  VF +E++GE + F   R+ L NRMLLWHGSR
Sbjct: 351 ESNEFKVISQYLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAF---REDLPNRMLLWHGSR 407

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           L+N+VGILS GLR+APPEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 408 LSNWVGILSHGLRVAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVA 467

Query: 457 LGDMHELKKAQYMDKP-PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           LG  +EL +A    +   +GKHSTKG+GK  P  + ++       VP G    + +   E
Sbjct: 468 LGQCNELLEANPKAQGLLQGKHSTKGMGKMAPSPAHFITLNGS-TVPLGPASDTGILNPE 526

Query: 280 ---LLYNEYIVYDIAQVKLQFLVKVRFQY 203
              L YNE+IVY   QV++++L+K++F +
Sbjct: 527 GYTLNYNEFIVYSPNQVRMRYLLKIQFNF 555



>gb:AF479321_1904595 Homo sapiens ADP-ribosyltransferase (NAD+;
           poly(ADP-ribose) polymerase)-like 2 (ADPRTL2) gene,
           complete cds.>gb:HSA236876_2000657 Homo sapiens mRNA for
           poly(ADP-ribose) polymerase-2.
          Length = 534

 Score =  204 bits (518), Expect = 2e-51
 Identities = 106/209 (50%), Positives = 145/209 (69%), Gaps = 4/209 (1%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTH ++ + +  +F +E+ GE + F   R+ L NRMLLWHGSR
Sbjct: 326 ESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAF---REDLHNRMLLWHGSR 382

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           ++N+VGILS GLRIAPPEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 383 MSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVA 442

Query: 457 LGDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           LG  +EL +A    +   +GKHSTKGLGK  P  + +V       VP G    + +   +
Sbjct: 443 LGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGS-TVPLGPASDTGILNPD 501

Query: 280 ---LLYNEYIVYDIAQVKLQFLVKVRFQY 203
              L YNEYIVY+  QV++++L+KV+F +
Sbjct: 502 GYTLNYNEYIVYNPNQVRMRYLLKVQFNF 530



>gb:AX008892_1456293 Sequence 1 from Patent
           WO9964572.>gb:HSA236912_2000660 Homo sapiens mRNA for
           poly-(ADP-ribose) polymerase II.
          Length = 570

 Score =  204 bits (518), Expect = 2e-51
 Identities = 106/209 (50%), Positives = 145/209 (69%), Gaps = 4/209 (1%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTH ++ + +  +F +E+ GE + F   R+ L NRMLLWHGSR
Sbjct: 362 ESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAF---REDLHNRMLLWHGSR 418

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           ++N+VGILS GLRIAPPEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 419 MSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVA 478

Query: 457 LGDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           LG  +EL +A    +   +GKHSTKGLGK  P  + +V       VP G    + +   +
Sbjct: 479 LGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGS-TVPLGPASDTGILNPD 537

Query: 280 ---LLYNEYIVYDIAQVKLQFLVKVRFQY 203
              L YNEYIVY+  QV++++L+KV+F +
Sbjct: 538 GYTLNYNEYIVYNPNQVRMRYLLKVQFNF 566



>sp|Q9UGN5|PPO2_HUMAN Poly [ADP-ribose] polymerase-2 (EC 2.4.2.30)
           (PARP-2) (NAD(+) ADP- ribosyltransferase-2)
           (Poly[ADP-ribose] synthetase-2) (pADPRT-2)
           (hPARP-2).>gb:AX058317_1458409 Sequence 1 from Patent
           WO0077179.
          Length = 583

 Score =  204 bits (518), Expect = 2e-51
 Identities = 106/209 (50%), Positives = 145/209 (69%), Gaps = 4/209 (1%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTH ++ + +  +F +E+ GE + F   R+ L NRMLLWHGSR
Sbjct: 375 ESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAF---REDLHNRMLLWHGSR 431

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           ++N+VGILS GLRIAPPEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 432 MSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVA 491

Query: 457 LGDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           LG  +EL +A    +   +GKHSTKGLGK  P  + +V       VP G    + +   +
Sbjct: 492 LGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGS-TVPLGPASDTGILNPD 550

Query: 280 ---LLYNEYIVYDIAQVKLQFLVKVRFQY 203
              L YNEYIVY+  QV++++L+KV+F +
Sbjct: 551 GYTLNYNEYIVYNPNQVRMRYLLKVQFNF 579



>gb:AF085734_1881773 Homo sapiens NAD+ ADP-ribosyltransferase 2
           (ADPRT2) mRNA, complete cds.
          Length = 534

 Score =  200 bits (509), Expect = 2e-50
 Identities = 105/209 (50%), Positives = 144/209 (68%), Gaps = 4/209 (1%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTH ++ + +  +F +E+ GE + F   R+ L NRMLLWHGSR
Sbjct: 326 ESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAF---REDLHNRMLLWHGSR 382

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           ++N+VGILS GLRIA PEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 383 MSNWVGILSHGLRIAHPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVA 442

Query: 457 LGDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
           LG  +EL +A    +   +GKHSTKGLGK  P  + +V       VP G    + +   +
Sbjct: 443 LGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGS-TVPLGPASDTGILNPD 501

Query: 280 ---LLYNEYIVYDIAQVKLQFLVKVRFQY 203
              L YNEYIVY+  QV++++L+KV+F +
Sbjct: 502 GYTLNYNEYIVYNPNQVRMRYLLKVQFNF 530



>gb:DDI534950_1376972 Dictyostelium discoideum mRNA for NAD(+)
            ADP-ribosyltransferase-3 (adprt-3 gene).
          Length = 2536

 Score =  182 bits (462), Expect = 7e-45
 Identities = 96/204 (47%), Positives = 133/204 (65%), Gaps = 3/204 (1%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            +S +F +++KY + T          ++  +F L+RKGE+++F    K LKN  LLWHGS 
Sbjct: 2338 NSPEFGILKKYSENTGCTK------KIVNIFKLQRKGEVERFQA-HKNLKNHFLLWHGSL 2390

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFT-NRKNPVGFMLLSEV 461
             TN++ ILSQGL+IAPPEAP TGYMFGKG+YF+DM  KS  YC + +  +   F+LLSEV
Sbjct: 2391 TTNYLSILSQGLKIAPPEAPVTGYMFGKGIYFSDMFRKSINYCGSWDSSSANSFLLLSEV 2450

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASE 281
            ALG M E K A YM+ P  G +STKG+GKT P   D +   + V +P   P   K   S+
Sbjct: 2451 ALGTMKEFKSAHYMESPETGTNSTKGVGKTGPNFDDSIILNNGVAIPLSPPEQVKGDTSD 2510

Query: 280  --LLYNEYIVYDIAQVKLQFLVKV 215
              L  NEYIVYD++Q+++++LV+V
Sbjct: 2511 YHLEMNEYIVYDVSQIRMRYLVEV 2534



>gb:AX877938_1477226 Sequence 12843 from Patent
           EP1074617.>gb:AK001980_1908763 Homo sapiens cDNA
           FLJ11118 fis, clone PLACE1006011, highly similar to Homo
           sapiens mRNA for poly(ADP-ribose) polymerase-2.
          Length = 531

 Score =  181 bits (460), Expect = 1e-44
 Identities = 89/158 (56%), Positives = 117/158 (74%), Gaps = 1/158 (0%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
           +S +F+++ +YLQ+THAPTH ++ + +  +F +E+ GE + F   R+ L NRMLLWHGSR
Sbjct: 375 ESYEFKVISQYLQSTHAPTHSDYTMTLLDLFEVEKDGEKEAF---REDLHNRMLLWHGSR 431

Query: 637 LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
           ++N+VGILS GLRIAPPEAP TGYMFGKG+YFADM SKSA YCF +R    G +LLSEVA
Sbjct: 432 MSNWVGILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKHTGLLLLSEVA 491

Query: 457 LGDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQESDYV 347
           LG  +EL +A    +   +GKHSTKGLGK  P  + +V
Sbjct: 492 LGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFV 529



>gb:DDI534948_1376970 Dictyostelium discoideum mRNA for NAD(+)
            ADP-ribosyltransferase-1A (adprt-1A gene).
          Length = 938

 Score =  179 bits (455), Expect = 4e-44
 Identities = 92/177 (51%), Positives = 123/177 (69%), Gaps = 2/177 (1%)
 Frame = -2

Query: 739  VEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMF 560
            V+ + SLER+ E ++F P+ K  KNR+LLWHGSRLTNFV I+SQGLRIAPP AP TGY F
Sbjct: 760  VQDILSLERENESERFTPWAKD-KNRLLLWHGSRLTNFVSIVSQGLRIAPPSAPKTGYRF 818

Query: 559  GKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGL 380
            GKG+YFAD +SKS  YCFT+   P   MLL EV+LGDM+ELK   YM++ P   HSTK L
Sbjct: 819  GKGIYFADCISKSFSYCFTSSDCPTALMLLCEVSLGDMNELKHDTYMEEAPHPFHSTKAL 878

Query: 379  GKTVPQE--SDYVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKV 215
            G   P +  +  +   D +VVP GK +     ++   +NE+IVY I QV+++++++V
Sbjct: 879  GMAAPHKDGNHPLSDSDGLVVPLGK-ISKTGLSTSCTHNEFIVYKIEQVRVKYILRV 934



>gb:NC5E6_1688584 Neurospora crassa DNA linkage group V Cosmid contig
            5E6.
          Length = 661

 Score =  166 bits (421), Expect = 4e-40
 Identities = 107/224 (47%), Positives = 130/224 (58%), Gaps = 21/224 (9%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKF-----APFRKKLK-NRM 659
            R S +F  +  YL  T   TH     +VE++F +ER+GE D+F     A  + KLK NR 
Sbjct: 442  RASTEFAQLADYLVETRGNTHG-LNYQVEEIFRIERQGEFDRFDQSDYADGKMKLKKNRK 500

Query: 658  LLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            LLWHGSR TNF GILSQGLRIAPPEAP  GYMFGKGVY ADM SKSA YC     N    
Sbjct: 501  LLWHGSRSTNFGGILSQGLRIAPPEAPVNGYMFGKGVYLADMSSKSAGYCCAYMSNGTAL 560

Query: 478  MLLSEVALGD-MHELKKAQY---MDKPPKGKHSTKGLGKTVPQESDYVKWRDE------- 332
            +LL E  LGD + EL  A Y        KG  ST G G T P     +KW+D        
Sbjct: 561  LLLCEAELGDPIQELTGADYNAGEHAKQKGMLSTWGKGGTGP-----LKWKDAGAVNPAL 615

Query: 331  --VVVP--CGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVR 212
              V++P    KP  + V    LLYNEYI YD+AQ++L++L +V+
Sbjct: 616  QGVMMPDTSVKPGNTNVPGCSLLYNEYIAYDVAQIRLRYLFRVK 659



>gb:AY347573_1601392 Emericella nidulans poly(ADP)-ribose polymerase
            mRNA, complete cds.
          Length = 675

 Score =  166 bits (420), Expect = 5e-40
 Identities = 100/215 (46%), Positives = 131/215 (60%), Gaps = 18/215 (8%)
 Frame = -2

Query: 814  SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRK---KLKNRMLLWHG 644
            SE+FR +EKYL  T   TH     +V  +F +ER+GE D+F        K  NR LLWHG
Sbjct: 461  SEEFRELEKYLSGTRGSTHGV-KYKVIDIFRIERQGEHDRFKSSSYAGLKNSNRRLLWHG 519

Query: 643  SRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSE 464
            SR TN+ GILSQGLRIAPPEAP +GYMFGKGVYFADM SKSA YC+++  +    +LL +
Sbjct: 520  SRSTNYGGILSQGLRIAPPEAPVSGYMFGKGVYFADMSSKSANYCWSHNSDHKALLLLGD 579

Query: 463  VALGD-MHELKKAQY---MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVP---CGKPV 305
            V LGD ++EL  + Y    +   +GK +T G G+++P       W+D   +     G  V
Sbjct: 580  VELGDPIYELYDSDYNAGENAKKEGKIATLGKGRSIP-----AGWKDAGCIHPHLKGIQV 634

Query: 304  PS--------KVKASELLYNEYIVYDIAQVKLQFL 224
            P         K     LLYNEYIVYD+AQ++L++L
Sbjct: 635  PDADSGTTDHKTDQGYLLYNEYIVYDVAQIRLRYL 669



>gb:AY349148_1601431 Emericella nidulans poly(ADP)-ribose polymerase
            (Parp) gene, complete cds.
          Length = 674

 Score =  164 bits (414), Expect = 2e-39
 Identities = 99/216 (45%), Positives = 133/216 (61%), Gaps = 19/216 (8%)
 Frame = -2

Query: 814  SEDFRLVEKYLQATHAPTHK-EWALEVEQVFSLERKGELDKFAPFRK---KLKNRMLLWH 647
            SE+FR +EKYL  T   TH  ++ +++   F +ER+GE D+F        K  NR LLWH
Sbjct: 461  SEEFRELEKYLSGTRGSTHGVKYKIDI---FRIERQGEHDRFKSSSYAGLKNSNRRLLWH 517

Query: 646  GSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLS 467
            GSR TN+ GILSQGLRIAPPEAP +GYMFGKGVYFADM SKSA YC+++  +    +LL 
Sbjct: 518  GSRSTNYGGILSQGLRIAPPEAPVSGYMFGKGVYFADMSSKSANYCWSHNSDHKALLLLG 577

Query: 466  EVALGD-MHELKKAQY---MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVP---CGKP 308
            +V LGD ++EL  + Y    +   +GK +T G G+++P       W+D   +     G  
Sbjct: 578  DVELGDPIYELYDSDYNAGENAKKEGKIATLGKGRSIP-----AGWKDAGCIHPHLKGIQ 632

Query: 307  VPS--------KVKASELLYNEYIVYDIAQVKLQFL 224
            VP         K     LLYNEYIVYD+AQ++L++L
Sbjct: 633  VPDADSGTTDHKTDQGYLLYNEYIVYDVAQIRLRYL 668



>gb:DDI520099_1376969 Dictyostelium discoideum mRNA for
            (ADP-ribosyl)transferase (adprt2 gene).
          Length = 700

 Score =  164 bits (414), Expect = 2e-39
 Identities = 83/176 (47%), Positives = 114/176 (64%)
 Frame = -2

Query: 739  VEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMF 560
            +  +F ++R GE D++   +K L NR LLWHGSRLTN+  I+SQGLRIAPPEAP +GY F
Sbjct: 526  IVNIFKIDRDGEADRYKT-KKHLGNRKLLWHGSRLTNYASIISQGLRIAPPEAPVSGYRF 584

Query: 559  GKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGL 380
            GKGVYFAD +S SA YC T   N    MLL +VALG   +L +  YM+KP    HST  L
Sbjct: 585  GKGVYFADCMSLSANYCRTVGSNDF-CMLLGDVALGKTADLARDTYMEKPQPNSHSTWAL 643

Query: 379  GKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVR 212
            G   P    + +  +  + P G+ +PS+ K      ++Y+VYD+AQV L++L+++R
Sbjct: 644  GTVEPDPKVFFQDTEGCITPYGQMIPSQHKGVSCYEHQYVVYDVAQVHLKYLLQLR 699



>gb:AF499444_1277239 Caenorhabditis elegans poly ADP-ribose metabolism
            enzyme-1 (pme-1) mRNA, complete cds.
          Length = 945

 Score =  162 bits (410), Expect = 7e-39
 Identities = 90/209 (43%), Positives = 128/209 (61%), Gaps = 6/209 (2%)
 Frame = -2

Query: 811  EDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLT 632
            +D+ ++ +YL+ TH  TH +  +E+  +  L R  E  KF   ++ + NR LLWHGS   
Sbjct: 738  DDWNMIHQYLKNTHGATH-DLKVELIDILKLNRDNESSKF---KRHIGNRRLLWHGSGKM 793

Query: 631  NFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALG 452
            NF GIL QGLRIAPPEAP +GYMFGKGVYFADM SKS  YC  N K    ++LL +VALG
Sbjct: 794  NFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCRANAKEE-AYLLLCDVALG 852

Query: 451  DMHELKKAQYMDKP--PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCG---KPVPSKVKA 287
            ++ +L  ++ + +   P G  S +GLG+  P+E       D   +P G     +  K   
Sbjct: 853  NVQQLMASKNVSRQTLPAGFQSVQGLGRQCPREIGSYNHPDGYTIPLGLTYMQLQGKQDV 912

Query: 286  S-ELLYNEYIVYDIAQVKLQFLVKVRFQY 203
               LLYNE+IVYD+ Q++L++LV+V+  +
Sbjct: 913  DYHLLYNEFIVYDVDQIQLKYLVRVKMHH 941



>gb:AC024200_1204229 Caenorhabditis elegans cosmid Y71F9AL, complete
            sequence.
          Length = 945

 Score =  162 bits (410), Expect = 7e-39
 Identities = 90/209 (43%), Positives = 128/209 (61%), Gaps = 6/209 (2%)
 Frame = -2

Query: 811  EDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLT 632
            +D+ ++ +YL+ TH  TH +  +E+  +  L R  E  KF   ++ + NR LLWHGS   
Sbjct: 738  DDWNMIHQYLKNTHGATH-DLKVELIDILKLNRDNESSKF---KRHIGNRRLLWHGSGKM 793

Query: 631  NFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALG 452
            NF GIL QGLRIAPPEAP +GYMFGKGVYFADM SKS  YC  N K    ++LL +VALG
Sbjct: 794  NFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCRANAKEE-AYLLLCDVALG 852

Query: 451  DMHELKKAQYMDKP--PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCG---KPVPSKVKA 287
            ++ +L  ++ + +   P G  S +GLG+  P+E       D   +P G     +  K   
Sbjct: 853  NVQQLMASKNVSRQTLPAGFQSVQGLGRQCPREIGSYNHPDGYTIPLGLTYMQLQGKQDV 912

Query: 286  S-ELLYNEYIVYDIAQVKLQFLVKVRFQY 203
               LLYNE+IVYD+ Q++L++LV+V+  +
Sbjct: 913  DYHLLYNEFIVYDVDQIQLKYLVRVKMHH 941



>gb:CEAC8_1359603 Caenorhabditis elegans cosmid AC8, complete
            sequence.
          Length = 737

 Score =  162 bits (409), Expect = 9e-39
 Identities = 90/209 (43%), Positives = 129/209 (61%), Gaps = 6/209 (2%)
 Frame = -2

Query: 811  EDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLT 632
            +D+ ++ +YL+ TH  TH +  +E+  +  + R  E  KF   ++ + NR LLWHGS   
Sbjct: 530  DDWNMIHQYLKNTHGATH-DLKVELIDILKVNRDNESSKF---KRHIGNRRLLWHGSGKM 585

Query: 631  NFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALG 452
            NF GIL QGLRIAPPEAP +GYMFGKGVYFADM SKS  YC  N K    ++LL +VALG
Sbjct: 586  NFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCRANAKEE-AYLLLCDVALG 644

Query: 451  DMHELKKAQYMDKP--PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCG---KPVPSKVKA 287
            ++ +L  ++ + +   P G  S +G+G+  P+E    K  D   VP G     +  K   
Sbjct: 645  NVQQLMASKNVSRQTLPAGFQSVQGVGRQCPREIGSYKNPDGYTVPLGLTYMQLQGKQNV 704

Query: 286  S-ELLYNEYIVYDIAQVKLQFLVKVRFQY 203
               LLYNE+IVYD+ Q++L++LV+V+  +
Sbjct: 705  DYHLLYNEFIVYDVDQIQLKYLVRVKMHH 733



>pir|T18600|T18600 hypothetical protein AC8.1 - Caenorhabditis elegans
          Length = 727

 Score =  162 bits (409), Expect = 9e-39
 Identities = 90/209 (43%), Positives = 129/209 (61%), Gaps = 6/209 (2%)
 Frame = -2

Query: 811  EDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLT 632
            +D+ ++ +YL+ TH  TH +  +E+  +  + R  E  KF   ++ + NR LLWHGS   
Sbjct: 520  DDWNMIHQYLKNTHGATH-DLKVELIDILKVNRDNESSKF---KRHIGNRRLLWHGSGKM 575

Query: 631  NFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALG 452
            NF GIL QGLRIAPPEAP +GYMFGKGVYFADM SKS  YC  N K    ++LL +VALG
Sbjct: 576  NFAGILGQGLRIAPPEAPVSGYMFGKGVYFADMFSKSFFYCRANAKEE-AYLLLCDVALG 634

Query: 451  DMHELKKAQYMDKP--PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCG---KPVPSKVKA 287
            ++ +L  ++ + +   P G  S +G+G+  P+E    K  D   VP G     +  K   
Sbjct: 635  NVQQLMASKNVSRQTLPAGFQSVQGVGRQCPREIGSYKNPDGYTVPLGLTYMQLQGKQNV 694

Query: 286  S-ELLYNEYIVYDIAQVKLQFLVKVRFQY 203
               LLYNE+IVYD+ Q++L++LV+V+  +
Sbjct: 695  DYHLLYNEFIVYDVDQIQLKYLVRVKMHH 723



>gb:AK118123_1816118 Arabidopsis thaliana At5g22470 mRNA for unknown
           protein, complete cds, clone: RAFL19-41-A06.
          Length = 388

 Score =  142 bits (359), Expect = 6e-33
 Identities = 81/219 (36%), Positives = 128/219 (58%), Gaps = 12/219 (5%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAP---THKEWALEVEQVFSLERKG--ELDKFAPFRKKLKNRML 656
           ++SED+++V KYL+ T+ P   +  E+ + V+ VF++E      LD      KKL N++L
Sbjct: 169 KESEDYKMVVKYLETTYEPVKVSDVEYGVSVQNVFAVESDAIPSLDDI----KKLPNKVL 224

Query: 655 LWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFM 476
           LW GSR +N +  + +G   A    P  GYMFG+ +  +D  +++A+Y FT    P GF+
Sbjct: 225 LWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDRPEGFL 284

Query: 475 LLSEVALGDMHELKKAQYMDKPPKG-------KHSTKGLGKTVPQESDYVKWRDEVVVPC 317
           +L+  +LG+     +      PP+        K   KGLG+   +ES++  WRD++ VPC
Sbjct: 285 VLAVASLGE-----EVTEFTSPPEDTKTLEDKKIGVKGLGRKKTEESEHFMWRDDIKVPC 339

Query: 316 GKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK 200
           G+ VPS+ K S L YNEY VYD  Q  ++FLV+V+++ K
Sbjct: 340 GRLVPSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEK 378



>gb:AB012244_1511750 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MQJ16.
          Length = 815

 Score =  142 bits (359), Expect = 6e-33
 Identities = 81/219 (36%), Positives = 128/219 (58%), Gaps = 12/219 (5%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAP---THKEWALEVEQVFSLERKG--ELDKFAPFRKKLKNRML 656
            ++SED+++V KYL+ T+ P   +  E+ + V+ VF++E      LD      KKL N++L
Sbjct: 596  KESEDYKMVVKYLETTYEPVKVSDVEYGVSVQNVFAVESDAIPSLDDI----KKLPNKVL 651

Query: 655  LWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFM 476
            LW GSR +N +  + +G   A    P  GYMFG+ +  +D  +++A+Y FT    P GF+
Sbjct: 652  LWCGSRSSNLLRHIYKGFLPAVCSLPVPGYMFGRAIVCSDAAAEAARYGFTAVDRPEGFL 711

Query: 475  LLSEVALGDMHELKKAQYMDKPPKG-------KHSTKGLGKTVPQESDYVKWRDEVVVPC 317
            +L+  +LG+     +      PP+        K   KGLG+   +ES++  WRD++ VPC
Sbjct: 712  VLAVASLGE-----EVTEFTSPPEDTKTLEDKKIGVKGLGRKKTEESEHFMWRDDIKVPC 766

Query: 316  GKPVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK 200
            G+ VPS+ K S L YNEY VYD  Q  ++FLV+V+++ K
Sbjct: 767  GRLVPSEHKDSPLEYNEYAVYDPKQTSIRFLVEVKYEEK 805



>gb:AP004790_1845138 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0476H10.
          Length = 737

 Score =  130 bits (326), Expect = 4e-29
 Identities = 76/211 (36%), Positives = 121/211 (57%), Gaps = 7/211 (3%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKE---WALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWH 647
            DSED++++ KYL+ T+ P       ++  VE+++++E    L  +    KKL N++LLW 
Sbjct: 519  DSEDYKMILKYLEKTYEPVKVGDVVYSATVERIYAVESSA-LPSYDEI-KKLPNKVLLWC 576

Query: 646  GSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLS 467
            G+R +N +  L  G   A    P  GYMFGK +  +D  +++A Y FT    P G+++L+
Sbjct: 577  GTRSSNLLRHLRDGFVPAVCHIPVPGYMFGKAIVCSDAAAEAALYGFTAVDRPEGYLVLA 636

Query: 466  EVALG-DMHELKK---AQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPS 299
              +LG ++ E+     ++ + +  + K   KG+G+     S++  WRD V VPCGK VPS
Sbjct: 637  VASLGKEIQEITGTPGSEDVKRMEEKKMGVKGVGRKTTDPSEHFTWRDGVTVPCGKLVPS 696

Query: 298  KVKASELLYNEYIVYDIAQVKLQFLVKVRFQ 206
              K   L YNEY VYD  QV + FLV V+++
Sbjct: 697  TNKDGPLEYNEYAVYDPKQVSIAFLVGVKYE 727



>gb:AF169023_1774199 Glycine max seed maturation protein PM38 (PM38)
            mRNA, complete cds.
          Length = 815

 Score =  127 bits (318), Expect = 3e-28
 Identities = 76/215 (35%), Positives = 122/215 (56%), Gaps = 8/215 (3%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHK---EWALEVEQVFSLERKGELDKFAPFRK---KLKNRM 659
            + S+D+ ++ KYL+ T+ P      E+ + VE +F+++  G      P  +   KL N++
Sbjct: 595  KSSDDYEMIVKYLEKTYEPVKVGDIEYGVSVENIFAVQTGG-----CPSYEDIIKLPNKV 649

Query: 658  LLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            LLW GSR +N +  L +G   A    P  GYMFGK +  +D  +++A+Y FT    P GF
Sbjct: 650  LLWCGSRSSNLLRHLQKGFLPAICSLPIPGYMFGKAIVCSDAAAEAARYGFTAVDRPEGF 709

Query: 478  MLLSEVALG-DMHELK-KAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPV 305
            ++L+  +LG ++ ELK   +      + K   KG GK    ES++  W+D++ VPCGK V
Sbjct: 710  LVLAIASLGNEITELKTPPEDASSLEEKKVGVKGPGKKKTDESEHFVWKDDIKVPCGKLV 769

Query: 304  PSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQYK 200
             S  + S L YNEY VYD  + ++ +LV V+++ K
Sbjct: 770  ASDHQDSPLEYNEYAVYDKKRARISYLVGVKYEEK 804



>gb:DDI534949_1376971 Dictyostelium discoideum mRNA for NAD(+)
            ADP-ribosyltransferase-1B (adprt-1B gene).
          Length = 804

 Score =  125 bits (313), Expect = 1e-27
 Identities = 75/213 (35%), Positives = 124/213 (58%), Gaps = 7/213 (3%)
 Frame = -2

Query: 820  RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
            RDS  FR +E++  +T  P+   ++++V  VF ++R G+ D+F+ +     NRMLL+HGS
Sbjct: 594  RDSFLFRNIEEFALSTVDPS-LGYSIDVLDVFKVDRIGD-DQFSQWESN-HNRMLLFHGS 650

Query: 640  RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            R+ ++  IL  GL+IA P +P +GY  GKGVY AD +S S  Y    ++NP   + + +V
Sbjct: 651  RIQSWCSILPNGLKIASPLSPKSGYRLGKGVYLADCISLSGLYTGATKENPTAIIAICDV 710

Query: 460  ALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKW----RDEVV---VPCGKPVP 302
            ALG+   L    YM++P  G  STK LGK  P   D +      +DE +   V  G  + 
Sbjct: 711  ALGNSAALYHDTYMEEPQLGYLSTKALGKRQPALYDQLNGCYQDKDEFIPSSVLKGPIIE 770

Query: 301  SKVKASELLYNEYIVYDIAQVKLQFLVKVRFQY 203
            +    +   +NEY++Y+ +Q ++++L+K+R  +
Sbjct: 771  TGSIVTSFTHNEYVIYNNSQCRIKYLLKLRLNF 803



>gb:BTARS1B_1436886 Bovine mRNA for poly(ADP-ribose) synthetase
           fragment 2 (C-term.).
          Length = 67

 Score =  110 bits (274), Expect = 4e-23
 Identities = 51/68 (75%), Positives = 58/68 (85%)
 Frame = -2

Query: 730 VFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKG 551
           +F +ER+GE  ++ PF K+L NR LLWHGSR TNF GILSQGLRIAPPEAP TGYMFGKG
Sbjct: 1   IFKIEREGESQRYKPF-KQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKG 59

Query: 550 VYFADMVS 527
           +YFADMVS
Sbjct: 60  IYFADMVS 67



>pir|PN0494|PN0494 NAD ADP-ribosyltransferase (EC 2.4.2.30) - cherry
           salmon  (fragment)
          Length = 135

 Score =  110 bits (274), Expect = 4e-23
 Identities = 50/89 (56%), Positives = 67/89 (75%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           + +++  ++ +Y++ THA TH  + L VE++F + R+GE  K+ PF+  L NR LLWHGS
Sbjct: 48  KTTKEAEIILQYVKNTHAATHNTYTLVVEEIFKIVREGEYQKYRPFQD-LPNRQLLWHGS 106

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGK 554
           R TN+ GILSQGLRIAPPEAP TGYMFGK
Sbjct: 107 RATNYAGILSQGLRIAPPEAPVTGYMFGK 135



>sp|Q08824|PPOL_ONCMA Poly [ADP-ribose] polymerase (EC 2.4.2.30)
           (PARP) (ADPRT) (NAD(+) ADP- ribosyltransferase)
           (Poly[ADP-ribose] synthetase) (Fragment).
          Length = 135

 Score =  110 bits (274), Expect = 4e-23
 Identities = 50/89 (56%), Positives = 67/89 (75%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           + +++  ++ +Y++ THA TH  + L VE++F + R+GE  K+ PF+  L NR LLWHGS
Sbjct: 48  KTTKEAEIILQYVKNTHAATHNTYTLVVEEIFKIVREGEYQKYRPFQD-LPNRQLLWHGS 106

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGK 554
           R TN+ GILSQGLRIAPPEAP TGYMFGK
Sbjct: 107 RATNYAGILSQGLRIAPPEAPVTGYMFGK 135



>gb:BC085863_2109422 Rattus norvegicus ADP-ribosyltransferase (NAD+,
           poly (ADP-ribose polymerase)-like 3 (predicted), mRNA
           (cDNA clone MGC:94593 IMAGE:7190424), complete cds.
          Length = 526

 Score =  107 bits (266), Expect = 4e-22
 Identities = 70/205 (34%), Positives = 111/205 (54%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           +++ ++ YL+ T     +    +++ V+ + R+GE D+F     KL NR LLWHG+ +  
Sbjct: 328 EYKAIQTYLEQTGNGYRRP---DLQHVWKVNREGEGDRFQA-HSKLGNRRLLWHGTNVAV 383

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y    R   + VG+M L EVAL
Sbjct: 384 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSASYVTAMRCGSHQVGYMFLGEVAL 439

Query: 454 GDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQESDYVKWR---DEVVVPCGKPVP-SKVK 290
           G +H +      +  PP G  S    G+T P  +  ++ +     VVVP G+PV     K
Sbjct: 440 GKVHHITMDDPSLKSPPPGFDSVIARGQTEPDPAQDIELQLDGQPVVVPQGRPVACPSFK 499

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L+++
Sbjct: 500 SSSFSQSEYLIYKESQCRLRYLLEI 524



>gb:XELADPRP_2581739 Xenopus laevis mRNA for poly(ADP-ribose)
           polymerase, partial cds.
          Length = 123

 Score =  105 bits (262), Expect = 1e-21
 Identities = 49/83 (59%), Positives = 64/83 (77%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +DSE+ R++  Y++ THA TH  + LEV ++F ++R+GE  ++ PF K+L NR LLWHGS
Sbjct: 42  KDSEESRIICDYVKNTHADTHNAYDLEVLEIFKIDREGEYQRYKPF-KQLHNRQLLWHGS 100

Query: 640 RLTNFVGILSQGLRIAPPEAPTT 572
           R TNF GILSQGLRIAPPEAP T
Sbjct: 101 RTTNFAGILSQGLRIAPPEAPVT 123



>gb:AF083068_1881588 Homo sapiens NAD+ ADP-ribosyltransferase 3
           (ADPRT3) mRNA, complete cds.
          Length = 533

 Score =  103 bits (258), Expect = 3e-21
 Identities = 70/205 (34%), Positives = 113/205 (55%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           ++++++ YL+ T +  H+     ++ ++ + ++GE D+F     KL NR LLWHG+ +  
Sbjct: 335 EYKVIQTYLEQTGS-NHR--CPTLQHIWKVNQEGEEDRFQA-HSKLGNRKLLWHGTNMAV 390

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y    +   + VG+M L EVAL
Sbjct: 391 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVAL 446

Query: 454 GDMHELKKAQ-YMDKPPKGKHSTKGLGKTVP---QESDYVKWRDEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G T P   Q+++      +VVVP G+PVP  +  
Sbjct: 447 GREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFS 506

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L++V
Sbjct: 507 SSTFSQSEYLIYQESQCRLRYLLEV 531



>gb:AX008896_1456295 Sequence 5 from Patent
           WO9964572.>gb:AY126341_1936731 Homo sapiens poly
           (ADP-ribose) polymerase 3 (PARP3) mRNA, complete
           cds.>gb:HSIRT1_2015526 Homo sapiens mRNA for IRT1
           protein, complete CDS.
          Length = 540

 Score =  103 bits (258), Expect = 3e-21
 Identities = 70/205 (34%), Positives = 113/205 (55%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           ++++++ YL+ T +  H+     ++ ++ + ++GE D+F     KL NR LLWHG+ +  
Sbjct: 342 EYKVIQTYLEQTGS-NHR--CPTLQHIWKVNQEGEEDRFQA-HSKLGNRKLLWHGTNMAV 397

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y    +   + VG+M L EVAL
Sbjct: 398 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVAL 453

Query: 454 GDMHELKKAQ-YMDKPPKGKHSTKGLGKTVP---QESDYVKWRDEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G T P   Q+++      +VVVP G+PVP  +  
Sbjct: 454 GREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFS 513

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L++V
Sbjct: 514 SSTFSQSEYLIYQESQCRLRYLLEV 538



>sp|Q9Y6F1|PPO3_HUMAN Poly [ADP-ribose] polymerase-3 (EC 2.4.2.30)
           (PARP-3) (NAD(+) ADP- ribosyltransferase-3)
           (Poly[ADP-ribose] synthetase-3) (pADPRT-3) (hPARP-3)
           (IRT1).>gb:AX008894_1456294 Sequence 3 from Patent
           WO9964572.>gb:BC014260_1974504 Homo sapiens poly
           (ADP-ribose) polymerase family, member 3, transcript
           variant 3, mRNA (cDNA clone MGC:20611 IMAGE:4763951),
           complete cds.
          Length = 533

 Score =  103 bits (258), Expect = 3e-21
 Identities = 70/205 (34%), Positives = 113/205 (55%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           ++++++ YL+ T +  H+     ++ ++ + ++GE D+F     KL NR LLWHG+ +  
Sbjct: 335 EYKVIQTYLEQTGS-NHR--CPTLQHIWKVNQEGEEDRFQA-HSKLGNRKLLWHGTNMAV 390

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y    +   + VG+M L EVAL
Sbjct: 391 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVAL 446

Query: 454 GDMHELKKAQ-YMDKPPKGKHSTKGLGKTVP---QESDYVKWRDEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G T P   Q+++      +VVVP G+PVP  +  
Sbjct: 447 GREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFS 506

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L++V
Sbjct: 507 SSTFSQSEYLIYQESQCRLRYLLEV 531



>gb:BC087453_2565294 Xenopus laevis hypothetical LOC496154, mRNA
           (cDNA clone MGC:99274 IMAGE:7210989), complete cds.
          Length = 549

 Score =  103 bits (257), Expect = 4e-21
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 5/207 (2%)
 Frame = -2

Query: 814 SEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRL 635
           SE+++++  Y++ T  P++    L++  V+S+ R+ E ++     K + NR LLWHG+ +
Sbjct: 352 SEEYKVINTYVKNT-GPSYSP--LKILNVWSVNREKEEERLNA-HKDIDNRRLLWHGTNI 407

Query: 634 TNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVAL 455
              V IL  GLRI     P +G   GKG+YFA   SKSA Y     KN +G M L+EVAL
Sbjct: 408 AVVVAILKSGLRI----MPHSGGRVGKGIYFASENSKSAGYVGCTSKN-LGIMFLNEVAL 462

Query: 454 GDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQES-DYVKWRD--EVVVPCGKPVP-SKVK 290
           G  H +      +  PPKG  S    G T P  + D+V   D  ++ VP G P+   K  
Sbjct: 463 GKEHHITMDDCSLKSPPKGYDSVVARGCTEPDPAKDHVLALDGRKITVPQGPPIKMEKYN 522

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKVRF 209
            +    +EY+VY  +Q +L++L+ ++F
Sbjct: 523 CTSFSQSEYLVYKESQARLRYLLLLQF 549



>gb:BC045935_2549449 Danio rerio zgc:66157, mRNA (cDNA clone
           MGC:56135 IMAGE:5411899), complete
           cds.>gb:BC055518_2551386 Danio rerio zgc:66157, mRNA
           (cDNA clone MGC:66157 IMAGE:5413269), complete cds.
          Length = 531

 Score =  102 bits (255), Expect = 7e-21
 Identities = 70/211 (33%), Positives = 112/211 (53%), Gaps = 5/211 (2%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           + S++++++EKYL+AT      +  L +  V+ ++R+ E ++F      L+NR LLWHG+
Sbjct: 332 KKSKEYKIIEKYLKATG-----QEGLTLVDVWEVDRETEAERFRE-NDALENRKLLWHGT 385

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEV 461
            +     IL  GLRI     P +G   G+G+YFA   SKSA Y      N +G M L+EV
Sbjct: 386 NVAVVAAILKSGLRI----MPHSGGRVGRGIYFASENSKSAGY--VRPSNKIGIMFLNEV 439

Query: 460 ALGDMHELKKAQ-YMDKPPKGKHSTKGLGKTVPQESDYVKWR---DEVVVPCGKPVPSKV 293
           ALG  + + +    + K P G  S    G   P  S  V       +VVVP GK +  + 
Sbjct: 440 ALGKEYTITRDDPSLRKAPAGYDSVIARGNQEPDPSKDVFIELDGKKVVVPQGKVIKQQQ 499

Query: 292 KASELLYN-EYIVYDIAQVKLQFLVKVRFQY 203
                 YN EY++Y  +Q ++++L++++F Y
Sbjct: 500 YEGSHFYNSEYLIYKESQCRIRYLLELKFNY 530



>gb:HSM800368_2017135 Homo sapiens mRNA; cDNA DKFZp566G0224 (from
           clone DKFZp566G0224); partial cds.
          Length = 459

 Score =  102 bits (254), Expect = 9e-21
 Identities = 69/205 (33%), Positives = 113/205 (55%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           ++++++ YL+ T +  H+     ++ ++ + ++GE D+F     KL NR LLWHG+ +  
Sbjct: 261 EYKVIQTYLEQTGS-NHR--CPTLQHIWKVNQEGEEDRFQA-HSKLGNRKLLWHGTNMAV 316

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   G+G+YFA   SKSA Y    +   + VG+M L EVAL
Sbjct: 317 VAAILTSGLRI----MPHSGGRVGEGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVAL 372

Query: 454 GDMHELKKAQ-YMDKPPKGKHSTKGLGKTVP---QESDYVKWRDEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G T P   Q+++      +VVVP G+PVP  +  
Sbjct: 373 GREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFS 432

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L++V
Sbjct: 433 SSTFSQSEYLIYQESQCRLRYLLEV 457



>pir|T08713|T08713 NAD+ ADP-ribosyltransferase homolog
           DKFZp566G0224.1 - human  (fragment)
          Length = 459

 Score =  102 bits (254), Expect = 9e-21
 Identities = 69/205 (33%), Positives = 113/205 (55%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           ++++++ YL+ T +  H+     ++ ++ + ++GE D+F     KL NR LLWHG+ +  
Sbjct: 261 EYKVIQTYLEQTGS-NHR--CPTLQHIWKVNQEGEEDRFQA-HSKLGNRKLLWHGTNMAV 316

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   G+G+YFA   SKSA Y    +   + VG+M L EVAL
Sbjct: 317 VAAILTSGLRI----MPHSGGRVGEGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVAL 372

Query: 454 GDMHELKKAQ-YMDKPPKGKHSTKGLGKTVP---QESDYVKWRDEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G T P   Q+++      +VVVP G+PVP  +  
Sbjct: 373 GREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFS 432

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L++V
Sbjct: 433 SSTFSQSEYLIYQESQCRLRYLLEV 457



>gb:AF368233_2064279 Mus musculus NAD+ ADP-ribosyltransferase 3
           PARP-3 mRNA, complete cds.
          Length = 528

 Score =  100 bits (250), Expect = 3e-20
 Identities = 70/205 (34%), Positives = 107/205 (52%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           +++ ++ YL+ T    +     ++  V+ + R+GE D+F     KL NR LLWHG+ +  
Sbjct: 330 EYKAIQTYLKQTG---NSYRCPDLRHVWKVNREGEGDRFQA-HSKLGNRRLLWHGTNVAV 385

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y  T     + VG+M L EVAL
Sbjct: 386 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVAL 441

Query: 454 GDMHELK-KAQYMDKPPKGKHSTKGLGKTVPQESDYVKWR---DEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G+T P  +  ++       VVVP G PV     K
Sbjct: 442 GKEHHITIDDPSLKSPPSGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFK 501

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L+++
Sbjct: 502 SSSFSQSEYLIYKESQCRLRYLLEI 526



>gb:BC014870_2092069 Mus musculus poly (ADP-ribose) polymerase
           family, member 3, mRNA (cDNA clone MGC:11997
           IMAGE:3602116), complete cds.>gb:BC058754_2103471 Mus
           musculus poly (ADP-ribose) polymerase family, member 3,
           mRNA (cDNA clone MGC:68047 IMAGE:6476689), complete cds.
          Length = 528

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 70/205 (34%), Positives = 106/205 (51%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           +++ ++ YL+ T    +      +  V+ + R+GE D+F     KL NR LLWHG+ +  
Sbjct: 330 EYKAIQTYLKQTG---NSYRCPNLRHVWKVNREGEGDRFQA-HSKLGNRRLLWHGTNVAV 385

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y  T     + VG+M L EVAL
Sbjct: 386 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVAL 441

Query: 454 GDMHELK-KAQYMDKPPKGKHSTKGLGKTVPQESDYVKWR---DEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G+T P  +  ++       VVVP G PV     K
Sbjct: 442 GKEHHITIDDPSLKSPPPGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFK 501

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L+++
Sbjct: 502 SSSFSQSEYLIYKESQCRLRYLLEI 526



>gb:AX008900_1456297 Sequence 9 from Patent WO9964572.
          Length = 528

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 70/205 (34%), Positives = 106/205 (51%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           +++ ++ YL+ T    +      +  V+ + R+GE D+F     KL NR LLWHG+ +  
Sbjct: 330 EYKAIQTYLKQTG---NSYRCPNLRHVWKVNREGEGDRFQA-HSKLGNRRLLWHGTNVAV 385

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y  T     + VG+M L EVAL
Sbjct: 386 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVAL 441

Query: 454 GDMHELK-KAQYMDKPPKGKHSTKGLGKTVPQESDYVKWR---DEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G+T P  +  ++       VVVP G PV     K
Sbjct: 442 GKEHHITIDDPSLKSPPPGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFK 501

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L+++
Sbjct: 502 SSSFSQSEYLIYKESQCRLRYLLEI 526



>gb:AK044223_1166872 Mus musculus adult retina cDNA, RIKEN
           full-length enriched library, clone:A930002C11
           product:similar to POLY [ADP-RIBOSE] POLYMERASE-3 (EC
           2.4.2.30) (PARP-3) (NAD(+) ADP-RIBOSYLTRANSFERASE-3)
           (POLY[ADP-RIBOSE] SYNTHETASE-3) (PADPRT-3) (HPARP-3)
           [Homo sapiens], full insert
           sequence.>gb:AX008898_1456296 Sequence 7 from Patent
           WO9964572.
          Length = 533

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 70/205 (34%), Positives = 106/205 (51%), Gaps = 7/205 (3%)
 Frame = -2

Query: 808 DFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTN 629
           +++ ++ YL+ T    +      +  V+ + R+GE D+F     KL NR LLWHG+ +  
Sbjct: 335 EYKAIQTYLKQTG---NSYRCPNLRHVWKVNREGEGDRFQA-HSKLGNRRLLWHGTNVAV 390

Query: 628 FVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNR--KNPVGFMLLSEVAL 455
              IL+ GLRI     P +G   GKG+YFA   SKSA Y  T     + VG+M L EVAL
Sbjct: 391 VAAILTSGLRI----MPHSGGRVGKGIYFASENSKSAGYVTTMHCGGHQVGYMFLGEVAL 446

Query: 454 GDMHELK-KAQYMDKPPKGKHSTKGLGKTVPQESDYVKWR---DEVVVPCGKPVP-SKVK 290
           G  H +      +  PP G  S    G+T P  +  ++       VVVP G PV     K
Sbjct: 447 GKEHHITIDDPSLKSPPPGFDSVIARGQTEPDPAQDIELELDGQPVVVPQGPPVQCPSFK 506

Query: 289 ASELLYNEYIVYDIAQVKLQFLVKV 215
           +S    +EY++Y  +Q +L++L+++
Sbjct: 507 SSSFSQSEYLIYKESQCRLRYLLEI 531



>gb:ONHADPRP_2577198 Oncorhynchus masou mRNA for poly(ADP-ribose)
           polymerase, partial cds.
          Length = 123

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 44/83 (53%), Positives = 61/83 (73%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           + +++  ++ +Y++ THA TH  + L VE++F + R+GE  K+ PF+  L NR LLWHGS
Sbjct: 42  KTTKEAEIILQYVKNTHAATHNTYTLVVEEIFKIVREGEYQKYRPFQD-LPNRQLLWHGS 100

Query: 640 RLTNFVGILSQGLRIAPPEAPTT 572
           R TN+ GILSQGLRIAPPEAP T
Sbjct: 101 RATNYAGILSQGLRIAPPEAPVT 123



>sp|Q09525|PME2_CAEEL Poly(ADP-ribose) polymerase 2 (EC 2.4.2.30)
           (Poly ADP-ribose metabolism enzyme 2).>pir|T20414|T20414
           hypothetical protein E02H1.4 - Caenorhabditis
           elegans>gb:AF500111_1277368 Caenorhabditis elegans poly
           ADP-ribose metabolism enzyme-2 (pme-2) mRNA, complete
           cds.>gb:CEE02H1_1361867 Caenorhabditis elegans cosmid
           E02H1, complete sequence.
          Length = 538

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 58/187 (31%), Positives = 93/187 (49%), Gaps = 6/187 (3%)
 Frame = -2

Query: 754 EWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPT 575
           E  +EV++V     +      AP       + LLWHG+R+TN   IL  GL+   P    
Sbjct: 351 EAPVEVQEVPKKRGRKSTKTAAPTVPPPTTKRLLWHGTRVTNVFSILMNGLQF--PVGDR 408

Query: 574 TGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGD-----MHELKKAQYMDKP 410
            G MFG GVYFA++ +KSA YC       V FMLL EV   +       E+   + M+K 
Sbjct: 409 CGLMFGNGVYFANVPTKSANYCCPEASKRV-FMLLCEVETANPLVLYESEIDADEKMEKA 467

Query: 409 PKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKP-VPSKVKASELLYNEYIVYDIAQVKL 233
              K S    GK  P+++  +       +P  K  + +  + + LLY+EY++++    K+
Sbjct: 468 K--KTSVYAAGKHTPRDTVEING-----IPAFKSNLETIEEETRLLYDEYVMFNKEHFKI 520

Query: 232 QFLVKVR 212
           +++V+V+
Sbjct: 521 KYVVEVK 527



>gb:AF047664_1236523 Caenorhabditis elegans cosmid ZK1005, complete
            sequence.
          Length = 2276

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 42/132 (31%), Positives = 65/132 (49%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            ++ D  + ++ LQ  H    K+   +V+ +  +      +KF PF     N+  LWHG++
Sbjct: 2070 ETPDSDISQRLLQWIHNSGGKQ--AKVKMILEISPMLSTEKFEPFVND-DNQKFLWHGTK 2126

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
             TN + IL  G  I PP A   G +FG G+Y AD   KS  YC  +    + +ML+ + A
Sbjct: 2127 ATNLMSILKNGFLIDPPSACKNGNLFGSGIYLADSFEKSTHYCQPS-AGGINYMLVCQTA 2185

Query: 457  LGDMHELKKAQY 422
            LG +  L    Y
Sbjct: 2186 LGKVRTLDTIPY 2197



>gb:AF047664_1236522 Caenorhabditis elegans cosmid ZK1005, complete
            sequence.>gb:AF548287_1281119 Caenorhabditis elegans poly
            ADP-ribose metabolism enzyme-5 (pme-5) mRNA, complete
            cds.
          Length = 2238

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 42/132 (31%), Positives = 65/132 (49%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSR 638
            ++ D  + ++ LQ  H    K+   +V+ +  +      +KF PF     N+  LWHG++
Sbjct: 2032 ETPDSDISQRLLQWIHNSGGKQ--AKVKMILEISPMLSTEKFEPFVND-DNQKFLWHGTK 2088

Query: 637  LTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVA 458
             TN + IL  G  I PP A   G +FG G+Y AD   KS  YC  +    + +ML+ + A
Sbjct: 2089 ATNLMSILKNGFLIDPPSACKNGNLFGSGIYLADSFEKSTHYCQPS-AGGINYMLVCQTA 2147

Query: 457  LGDMHELKKAQY 422
            LG +  L    Y
Sbjct: 2148 LGKVRTLDTIPY 2159



>gb:CR382129_1662006 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 600

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 58/215 (26%), Positives = 97/215 (45%), Gaps = 11/215 (5%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWA--LEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHG 644
           D   F  +    +++    H   A   +V+ ++ ++   +   FA   KK+K    LWHG
Sbjct: 412 DKRSFNRINTMFESSKNQIHGYTAKCAKVKNIYKIKLGSQQAPFAATSKKIKCVQELWHG 471

Query: 643 SRLTNFVGILSQGLRIAPPEAP--TTGYMFGKGVYFADMVSKSAQYC-------FTNRKN 491
           +RL N + IL +GL + P  +P    G MFG G+YFA+  SKS  YC         + K 
Sbjct: 472 TRLQNILSILGKGL-LLPKLSPGQKVGAMFGDGLYFANQSSKSLNYCDGMLWTSDGSGKP 530

Query: 490 PVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGK 311
              +M L+ VALG+ +   +      PP+G HS                W          
Sbjct: 531 ETIYMFLASVALGN-YFTPEGPVSTNPPEGYHS---------------YW---------- 564

Query: 310 PVPSKVKASELLYNEYIVYDIAQVKLQFLVKVRFQ 206
              +K   S ++ +E IV+D +Q++L +L+++  +
Sbjct: 565 ---AKAGQSGVMNDEIIVFDASQIRLDYLLEIELR 596



>gb:CR859406_1183523 Pongo pygmaeus mRNA; cDNA DKFZp469B246 (from
           clone DKFZp469B246).
          Length = 1720

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 56/208 (26%), Positives = 95/208 (45%), Gaps = 7/208 (3%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +++E+F  V K +   H   H +  ++V Q+F   R G +++   F  KL N   L HGS
Sbjct: 387 QNTEEFLRVRKEVLQNH---HSKSPVDVLQIF---RVGRVNETTEFLSKLGNVRPLLHGS 440

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYM------FGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            + N VGIL +GL + P      G         G G+YF+D +S S +Y      +    
Sbjct: 441 PVRNIVGILCRGL-LLPKVVEDHGVQRTDVGNLGSGIYFSDSLSTSIKYSHPGETDGTRL 499

Query: 478 MLLSEVALGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP 302
           +L+ +VALG   +L K  + + + P G  S  G+ +T    +D+                
Sbjct: 500 LLICDVALGKCMDLHKKDFSLTEAPPGYDSVHGVSQTASVTTDFED-------------- 545

Query: 301 SKVKASELLYNEYIVYDIAQVKLQFLVK 218
                     +E++VY   QVK+++++K
Sbjct: 546 ----------DEFVVYKTNQVKMKYIIK 563



>gb:AK172907_2069841 Mus musculus mRNA for mKIAA0177 protein.
          Length = 1269

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 56/208 (26%), Positives = 97/208 (46%), Gaps = 7/208 (3%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +++E+F  V K +   +     E  +++ Q+F   R G +++   F  KL N  LL+HGS
Sbjct: 395 QNTEEFSRVRKEVLQNN---RSEQPVDILQIF---RVGRVNEATEFLSKLGNVRLLFHGS 448

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYM------FGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            + N +GILS+GL + P  A   G         G G+YF+D +S S +Y      +    
Sbjct: 449 PVRNILGILSRGL-LLPKVAEDRGVQRTDVGNLGSGIYFSDSLSTSIKYAHAGETDGSRL 507

Query: 478 MLLSEVALGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP 302
           +++ +VALG    L K  + + + P G  S  G+ +T    +D+                
Sbjct: 508 LVVCDVALGKCVNLFKKDFSLTEAPPGYDSVHGVSETTSVPTDFQD-------------- 553

Query: 301 SKVKASELLYNEYIVYDIAQVKLQFLVK 218
                     +E++VY   QVK++++VK
Sbjct: 554 ----------DEFVVYKTNQVKMKYIVK 571



>gb:D79999_1994909 Homo sapiens mRNA for KIAA0177 protein, partial
           cds.
          Length = 1725

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 55/208 (26%), Positives = 95/208 (45%), Gaps = 7/208 (3%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +++E+F  V K +   H   H +  ++V Q+F   R G +++   F  KL N   L HGS
Sbjct: 388 QNTEEFLRVRKEVLQNH---HSKSPVDVLQIF---RVGRVNETTEFLSKLGNVRPLLHGS 441

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYM------FGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            + N VGIL +GL + P      G         G G+YF+D +S S +Y      +    
Sbjct: 442 PVQNIVGILCRGL-LLPKVVEDRGVQRTDVGNLGSGIYFSDSLSTSIKYSHPGETDGTRL 500

Query: 478 MLLSEVALGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP 302
           +L+ +VALG   +L +  + + + P G  S  G+ +T    +D+                
Sbjct: 501 LLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVTTDFED-------------- 546

Query: 301 SKVKASELLYNEYIVYDIAQVKLQFLVK 218
                     +E++VY   QVK+++++K
Sbjct: 547 ----------DEFVVYKTNQVKMKYIIK 564



>gb:AL359763_1925788 Human DNA sequence from clone RP11-169O17 on
           chromosome 13 Contains a cytochrome c pseudogene, a
           novel gene, the ADPRTL1 gene for ADP-ribosyltransferase
           (NAD+; poly (ADP-ribose) polymerase)-like protein 1 ,
           part of a TPTE and PTEN homologous inositol lipid
           phosphatase (TPIP) pseudogene and four CpG islands,
           complete sequence.
          Length = 1724

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 55/208 (26%), Positives = 95/208 (45%), Gaps = 7/208 (3%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +++E+F  V K +   H   H +  ++V Q+F   R G +++   F  KL N   L HGS
Sbjct: 387 QNTEEFLRVRKEVLQNH---HSKSPVDVLQIF---RVGRVNETTEFLSKLGNVRPLLHGS 440

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYM------FGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            + N VGIL +GL + P      G         G G+YF+D +S S +Y      +    
Sbjct: 441 PVQNIVGILCRGL-LLPKVVEDRGVQRTDVGNLGSGIYFSDSLSTSIKYSHPGETDGTRL 499

Query: 478 MLLSEVALGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP 302
           +L+ +VALG   +L +  + + + P G  S  G+ +T    +D+                
Sbjct: 500 LLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVTTDFED-------------- 545

Query: 301 SKVKASELLYNEYIVYDIAQVKLQFLVK 218
                     +E++VY   QVK+++++K
Sbjct: 546 ----------DEFVVYKTNQVKMKYIIK 563



>gb:AF158255_1886774 Homo sapiens vault protein mRNA, complete cds.
          Length = 1724

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 55/208 (26%), Positives = 95/208 (45%), Gaps = 7/208 (3%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +++E+F  V K +   H   H +  ++V Q+F   R G +++   F  KL N   L HGS
Sbjct: 387 QNTEEFLRVRKEVLQNH---HSKSPVDVLQIF---RVGRVNETTEFLSKLGNVRPLLHGS 440

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYM------FGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            + N VGIL +GL + P      G         G G+YF+D +S S +Y      +    
Sbjct: 441 PVQNIVGILCRGL-LLPKVVEDRGVQRTDVGNLGSGIYFSDSLSTSIKYSHPGETDGTRL 499

Query: 478 MLLSEVALGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP 302
           +L+ +VALG   +L +  + + + P G  S  G+ +T    +D+                
Sbjct: 500 LLICDVALGKCMDLHEKDFPLTEAPPGYDSVHGVSQTASVTTDFED-------------- 545

Query: 301 SKVKASELLYNEYIVYDIAQVKLQFLVK 218
                     +E++VY   QVK+++++K
Sbjct: 546 ----------DEFVVYKTNQVKMKYIIK 563



>gb:AF057160_1879605 Homo sapiens putative poly(ADP-ribosyl)
           transferase (PARPL) mRNA, complete cds.
          Length = 1724

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 55/208 (26%), Positives = 95/208 (45%), Gaps = 7/208 (3%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +++E+F  V K +   H   H +  ++V Q+F   R G +++   F  KL N   L HGS
Sbjct: 387 QNTEEFLRVRKEVLQNH---HSKSPVDVLQIF---RVGRVNETTEFLSKLGNVRPLLHGS 440

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYM------FGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            + N VGIL +GL + P      G         G G+YF+D +S S +Y      +    
Sbjct: 441 PVQNIVGILCRGL-LLPKVVEDRGVQRTDVGNLGSGIYFSDSLSTSIKYSHPGETDGTRL 499

Query: 478 MLLSEVALGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP 302
           +L+ +VALG   +L +  + + + P G  S  G+ +T    +D+                
Sbjct: 500 LLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVTTDFED-------------- 545

Query: 301 SKVKASELLYNEYIVYDIAQVKLQFLVK 218
                     +E++VY   QVK+++++K
Sbjct: 546 ----------DEFVVYKTNQVKMKYIIK 563



>sp|Q9UKK3|PPOV_HUMAN Vault poly(ADP-ribose) polymerase (EC
           2.4.2.30) (VPARP) (193-kDa vault protein)
           (PARP-related/IalphaI-related H5/proline-rich) (PH5P).
          Length = 1724

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 55/208 (26%), Positives = 95/208 (45%), Gaps = 7/208 (3%)
 Frame = -2

Query: 820 RDSEDFRLVEKYLQATHAPTHKEWALEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGS 641
           +++E+F  V K +   H   H +  ++V Q+F   R G +++   F  KL N   L HGS
Sbjct: 387 QNTEEFLRVRKEVLQNH---HSKSPVDVLQIF---RVGRVNETTEFLSKLGNVRPLLHGS 440

Query: 640 RLTNFVGILSQGLRIAPPEAPTTGYM------FGKGVYFADMVSKSAQYCFTNRKNPVGF 479
            + N VGIL +GL + P      G         G G+YF+D +S S +Y      +    
Sbjct: 441 PVQNIVGILCRGL-LLPKVVEDRGVQRTDVGNLGSGIYFSDSLSTSIKYSHPGETDGTRL 499

Query: 478 MLLSEVALGDMHELKKAQY-MDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVP 302
           +L+ +VALG   +L +  + + + P G  S  G+ +T    +D+                
Sbjct: 500 LLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVTTDFED-------------- 545

Query: 301 SKVKASELLYNEYIVYDIAQVKLQFLVK 218
                     +E++VY   QVK+++++K
Sbjct: 546 ----------DEFVVYKTNQVKMKYIIK 563



>gb:DDI534951_1376973 Dictyostelium discoideum mRNA for NAD(+)
           ADP-ribosyltransferase-4 (adprt-4 gene).
          Length = 644

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 58/196 (29%), Positives = 88/196 (44%), Gaps = 14/196 (7%)
 Frame = -2

Query: 745 LEVEQVFSLERKGELDKFAPFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPE------ 584
           +++   + L++K E D F      + N   L+HGS+  N VG+LS+G  I PP+      
Sbjct: 485 IKILNCYRLDKKLESDNFLD----VGNVQYLYHGSKPQNLVGLLSRG--ILPPDYVKQIG 538

Query: 583 --APTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVG-----FMLLSEVALGDMHELKKAQ 425
                 GY+ G G+YF+D V  S         +P+G     F+++S V+LG + E  K Q
Sbjct: 539 GKRTDFGYL-GSGIYFSDDVVSSTY------TSPIGEKGSRFIIMSSVSLGKVKEFSKIQ 591

Query: 424 -YMDKPPKGKHSTKGLGKTVPQESDYVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDI 248
             +   P G HS KGL  T    +D+                          NEY+V++ 
Sbjct: 592 PSLQCAPSGHHSCKGLKSTPTNPTDFKN------------------------NEYVVFNP 627

Query: 247 AQVKLQFLVKVRFQYK 200
            Q KL FL++    YK
Sbjct: 628 NQSKLSFLIEYIENYK 643



>gb:AC116956_1206532 Dictyostelium discoideum chromosome 2 map
           1418423-1684967 strain AX4, complete sequence.
          Length = 610

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 45/171 (26%), Positives = 76/171 (44%), Gaps = 14/171 (8%)
 Frame = -2

Query: 691 APFRKKLKNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
           +P   K  N + L+HG  +++  GI   G     P   +   MFG G+YFA+  SKS QY
Sbjct: 445 SPELDKKANELFLFHGLNVSSVAGIAKFGF---DPRFCSLDGMFGAGLYFAENSSKSNQY 501

Query: 511 CFTNRKNPVGF--------------MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGK 374
           C        GF              +L+  V +GD   L +  +    P    + +   +
Sbjct: 502 CHGGACTCSGFQATSCKCKPSDEVCLLVCRVVMGDC--LVENVFRGNGPGQFWNGR---R 556

Query: 373 TVPQESDYVKWRDEVVVPCGKPVPSKVKASELLYNEYIVYDIAQVKLQFLV 221
           T P++ + +   + V+   G+  P+    + L   EYIVY+ +QV +++ V
Sbjct: 557 TEPKKPNNINIYNSVI---GESKPNYGPKAALQLREYIVYESSQVFVEYKV 604



>gb:AF132196_1243608 Drosophila melanogaster clone LD22548 unknown
            mRNA.>gb:AX062279_1458742 Sequence 138 from Patent
            WO0100849.
          Length = 1181

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 51/195 (26%), Positives = 82/195 (42%), Gaps = 29/195 (14%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKE--------WALEVEQVFSLERKGELDKFAPFRKKL--- 671
            D ++F  VE+ +QAT    H++            + +V  ++ +   +++A  R+++   
Sbjct: 971  DDKEFVAVEEEMQAT-IREHRDNGQAGGYFTRYNIIRVQKVQNRKLWERYAHRRQEIAEE 1029

Query: 670  ----KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCF- 506
                 N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY + 
Sbjct: 1030 NFLQSNERMLFHGSPFIN--AIVQRGF---DERHAYIGGMFGAGIYFAEHSSKSNQYVYG 1084

Query: 505  -------TNRKNPVGF-----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQ 362
                    + K+   +     +LL  VALG       A  M   P G HS  G       
Sbjct: 1085 IGGGIGCPSHKDKSCYVCPRQLLLCRVALGKSFLQYSAMKMAHAPPGHHSVVGRPSAGGL 1144

Query: 361  E-SDYVKWRDEVVVP 320
              ++YV +R E   P
Sbjct: 1145 HFAEYVVYRGEQSYP 1159



>gb:AE014297_1141439 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003752_1223432 Drosophila melanogaster
            chromosome 3R, section 90 of 118 of the complete
            sequence.
          Length = 1181

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 51/195 (26%), Positives = 82/195 (42%), Gaps = 29/195 (14%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKE--------WALEVEQVFSLERKGELDKFAPFRKKL--- 671
            D ++F  VE+ +QAT    H++            + +V  ++ +   +++A  R+++   
Sbjct: 971  DDKEFVAVEEEMQAT-IREHRDNGQAGGYFTRYNIIRVQKVQNRKLWERYAHRRQEIAEE 1029

Query: 670  ----KNRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQYCF- 506
                 N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY + 
Sbjct: 1030 NFLQSNERMLFHGSPFIN--AIVQRGF---DERHAYIGGMFGAGIYFAEHSSKSNQYVYG 1084

Query: 505  -------TNRKNPVGF-----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQ 362
                    + K+   +     +LL  VALG       A  M   P G HS  G       
Sbjct: 1085 IGGGIGCPSHKDKSCYVCPRQLLLCRVALGKSFLQYSAMKMAHAPPGHHSVVGRPSAGGL 1144

Query: 361  E-SDYVKWRDEVVVP 320
              ++YV +R E   P
Sbjct: 1145 HFAEYVVYRGEQSYP 1159



>pir|T03058|T03058 NAD+ ADP-ribosyltransferase homolog 034L - Chilo
           iridescent virus>gb:AF303741_2231536 Chilo iridescent
           virus complete genome.
          Length = 181

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 28/98 (28%), Positives = 53/98 (54%), Gaps = 3/98 (3%)
 Frame = -2

Query: 733 QVFSLERKGELDKFAPFRKKL--KNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYM 563
           ++++++R  E + F  +  +   K   LL HG+R ++ + IL  GL+I P      +G +
Sbjct: 27  KIYTVQRFKEEEPFNKYISESVSKKTRLLIHGTRCSSVIPILQTGLKIRPSTSVHFSGKV 86

Query: 562 FGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGD 449
           +G+G YF++ V KS  Y   +       +L+ EV +G+
Sbjct: 87  YGEGNYFSEHVQKSLNYTGWDNDQ---ILLIYEVHVGN 121



>gb:BC022679_2093858 Mus musculus poly (ADP-ribose) polymerase
           family, member 8, mRNA (cDNA clone MGC:31379
           IMAGE:4240209), complete cds.
          Length = 263

 Score = 39.3 bits (90), Expect = 0.091
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -2

Query: 679 KKLKNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYMFGKGVYFADMVSKSAQYCFT 503
           KKL      +HGS + N+  IL  GL +A        G M+G G+Y + M S S  Y   
Sbjct: 96  KKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGM 155

Query: 502 NRKNPV 485
           N+K  V
Sbjct: 156 NKKQKV 161



>gb:BC021315_2093365 Mus musculus poly (ADP-ribose) polymerase
           family, member 8, mRNA (cDNA clone MGC:29205
           IMAGE:5027417), complete cds.>gb:BC021881_2093684 Mus
           musculus poly (ADP-ribose) polymerase family, member 8,
           mRNA (cDNA clone MGC:12129 IMAGE:3710450), complete cds.
          Length = 500

 Score = 39.3 bits (90), Expect = 0.091
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -2

Query: 679 KKLKNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYMFGKGVYFADMVSKSAQYCFT 503
           KKL      +HGS + N+  IL  GL +A        G M+G G+Y + M S S  Y   
Sbjct: 333 KKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGM 392

Query: 502 NRKNPV 485
           N+K  V
Sbjct: 393 NKKQKV 398



>gb:BC075801_1989606 Homo sapiens poly (ADP-ribose) polymerase
           family, member 8, mRNA (cDNA clone MGC:87748
           IMAGE:5226828), complete cds.
          Length = 812

 Score = 39.3 bits (90), Expect = 0.091
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -2

Query: 679 KKLKNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYMFGKGVYFADMVSKSAQYCFT 503
           KKL      +HGS + N+  IL  GL +A        G M+G G+Y + M S S  Y   
Sbjct: 645 KKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGM 704

Query: 502 NRKNPV 485
           N+K  V
Sbjct: 705 NKKQKV 710



>gb:AK024961_1910200 Homo sapiens cDNA: FLJ21308 fis, clone
           COL02131.
          Length = 501

 Score = 39.3 bits (90), Expect = 0.091
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -2

Query: 679 KKLKNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYMFGKGVYFADMVSKSAQYCFT 503
           KKL      +HGS + N+  IL  GL +A        G M+G G+Y + M S S  Y   
Sbjct: 334 KKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGM 393

Query: 502 NRKNPV 485
           N+K  V
Sbjct: 394 NKKQKV 399



>gb:HSM805580_1187603 Homo sapiens mRNA; cDNA DKFZp762K2011 (from
           clone DKFZp762K2011).
          Length = 854

 Score = 39.3 bits (90), Expect = 0.091
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -2

Query: 679 KKLKNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYMFGKGVYFADMVSKSAQYCFT 503
           KKL      +HGS + N+  IL  GL +A        G M+G G+Y + M S S  Y   
Sbjct: 687 KKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGM 746

Query: 502 NRKNPV 485
           N+K  V
Sbjct: 747 NKKQKV 752



>gb:CR858576_1182743 Pongo pygmaeus mRNA; cDNA DKFZp469M058 (from
           clone DKFZp469M058).
          Length = 833

 Score = 39.3 bits (90), Expect = 0.091
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -2

Query: 679 KKLKNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYMFGKGVYFADMVSKSAQYCFT 503
           KKL      +HGS + N+  IL  GL +A        G M+G G+Y + M S S  Y   
Sbjct: 666 KKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGM 725

Query: 502 NRKNPV 485
           N+K  V
Sbjct: 726 NKKQKV 731



>gb:AK013206_1157387 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810430O08 product:hypothetical ADP-ribosylation
           structure containing protein, full insert sequence.
          Length = 290

 Score = 39.3 bits (90), Expect = 0.091
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -2

Query: 679 KKLKNRMLLWHGSRLTNFVGILSQGLRIAP-PEAPTTGYMFGKGVYFADMVSKSAQYCFT 503
           KKL      +HGS + N+  IL  GL +A        G M+G G+Y + M S S  Y   
Sbjct: 123 KKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGM 182

Query: 502 NRKNPV 485
           N+K  V
Sbjct: 183 NKKQKV 188



>gb:BC063101_2105163 Mus musculus RIKEN cDNA 5430432P15 gene, mRNA
           (cDNA clone IMAGE:6392888), partial cds.
          Length = 408

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817 DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
           D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 203 DDKEFQSVEEEMQST-VREHRDGGHAGGVFNRYNILKIQKVCN---KKLWERYTHRRKEV 258

Query: 670 K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                   N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 259 SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 313

Query: 511 -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                            C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 314 VYGIGGGTGCPIHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 369

Query: 382 LGKTVPQE-SDYVKWRDEVVVP 320
                    ++YV +R E   P
Sbjct: 370 RPSVNGLALAEYVIYRGEQAYP 391



>gb:AF305081_1895930 Homo sapiens tankyrase-related protein mRNA,
            partial cds.
          Length = 1265

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 1060 DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 1115

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 1116 SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 1170

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 1171 VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 1226

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 1227 RPSVNGLALAEYVIYRGEQAYP 1248



>gb:AX076214_1460641 Sequence 4 from Patent WO0104326.
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 961  DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 1016

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 1017 SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 1071

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 1072 VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 1127

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 1128 RPSVNGLALAEYVIYRGEQAYP 1149



>gb:AX062318_1458746 Sequence 177 from Patent WO0100849.
          Length = 1099

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 885  DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 940

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 941  SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 995

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 996  VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 1051

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 1052 RPSVNGLALAEYVIYRGEQAYP 1073



>gb:AX062273_1458739 Sequence 132 from Patent WO0100849.
          Length = 1385

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 1180 DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 1235

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 1236 SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 1290

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 1291 VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 1346

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 1347 RPSVNGLALAEYVIYRGEQAYP 1368



>gb:AX062247_1458735 Sequence 106 from Patent WO0100849.
          Length = 1262

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 1057 DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 1112

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 1113 SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 1167

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 1168 VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 1223

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 1224 RPSVNGLALAEYVIYRGEQAYP 1245



>gb:AX062231_1458731 Sequence 90 from Patent WO0100849.
          Length = 756

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 551  DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 606

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 607  SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 661

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 662  VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 717

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 718  RPSVNGLALAEYVIYRGEQAYP 739



>gb:AX062229_1458730 Sequence 88 from Patent WO0100849.
          Length = 784

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 579  DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 634

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 635  SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 689

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 690  VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 745

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 746  RPSVNGLALAEYVIYRGEQAYP 767



>gb:AX062142_1458725 Sequence 1 from Patent
            WO0100849.>gb:AX062241_1458733 Sequence 100 from Patent
            WO0100849.
          Length = 1169

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 964  DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 1019

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 1020 SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 1074

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 1075 VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 1130

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 1131 RPSVNGLALAEYVIYRGEQAYP 1152



>sp|Q9H2K2|TNK2_HUMAN Tankyrase 2 (EC 2.4.2.30) (TANK2) (Tankyrase II)
            (TNKS-2) (TRF1- interacting ankyrin-related ADP-ribose
            polymerase 2) (Tankyrase-like protein) (Tankyrase-related
            protein).>gb:AX062275_1458740 Sequence 134 from Patent
            WO0100849.>gb:AF264912_1893764 Homo sapiens
            tankyrase-like protein (TNKL) mRNA, complete
            cds.>gb:AF309033_1896138 Homo sapiens tankyrase-2
            (TNKS-2) mRNA, complete cds.>gb:AF329696_1896977 Homo
            sapiens tankyrase 2 mRNA, complete
            cds.>gb:AF342982_1897571 Homo sapiens tankyrase 2 mRNA,
            complete cds.>gb:AF438201_1902117 Homo sapiens tankyrase
            II mRNA, complete cds.>gb:AL359707_1925680 Human DNA
            sequence from clone RP11-251A15 on chromosome 10 Contains
            a pseudogene similar to novel protein KIAA0887, the TNKS2
            gene for TRF1-interacting ankyrin-related ADP-ribose
            polymerase 2, a signal recognition particle 9kD (SRP9)
            pseudogene and a CpG island, complete sequence.
          Length = 1166

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 50/202 (24%), Positives = 80/202 (39%), Gaps = 36/202 (17%)
 Frame = -2

Query: 817  DSEDFRLVEKYLQATHAPTHKEWA-----------LEVEQVFSLERKGELDKFAPFRKKL 671
            D ++F+ VE+ +Q+T    H++             L++++V +   K   +++   RK++
Sbjct: 961  DDKEFQSVEEEMQST-VREHRDGGHAGGIFNRYNILKIQKVCN---KKLWERYTHRRKEV 1016

Query: 670  K-------NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY 512
                    N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY
Sbjct: 1017 SEENHNHANERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQY 1071

Query: 511  -----------------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                             C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 1072 VYGIGGGTGCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 1127

Query: 382  LGKTVPQE-SDYVKWRDEVVVP 320
                     ++YV +R E   P
Sbjct: 1128 RPSVNGLALAEYVIYRGEQAYP 1149



>gb:BC084432_2563808 Xenopus laevis hypothetical LOC495279, mRNA (cDNA
            clone MGC:86484 IMAGE:5511385), complete cds.
          Length = 1303

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 39/130 (30%), Positives = 50/130 (38%), Gaps = 14/130 (10%)
 Frame = -2

Query: 667  NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
            N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 1154 NERMLFHGSPFIN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 1208

Query: 511  -CFTNRKNPVGF----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVP-QESDY 350
             C T++          ML   V LG          M   P G HS  G         ++Y
Sbjct: 1209 GCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEY 1268

Query: 349  VKWRDEVVVP 320
            V +R E   P
Sbjct: 1269 VIYRGEQAYP 1278



>gb:AY142108_2514903 Gallus gallus tankyrase 1 mRNA, complete cds.
          Length = 1266

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 39/130 (30%), Positives = 50/130 (38%), Gaps = 14/130 (10%)
 Frame = -2

Query: 667  NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
            N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 1117 NERMLFHGSPFIN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 1171

Query: 511  -CFTNRKNPVGF----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVP-QESDY 350
             C T++          ML   V LG          M   P G HS  G         ++Y
Sbjct: 1172 GCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEY 1231

Query: 349  VKWRDEVVVP 320
            V +R E   P
Sbjct: 1232 VIYRGEQAYP 1241



>gb:AY142107_2514902 Gallus gallus tankyrase 2 mRNA, complete cds.
          Length = 1167

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 38/134 (28%), Positives = 50/134 (37%), Gaps = 18/134 (13%)
 Frame = -2

Query: 667  NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
            N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 1026 NERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 1080

Query: 511  ---------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQE 359
                     C+   +     +L   V LG       A  M   P G HS  G        
Sbjct: 1081 GCPIHKDRSCYVCHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLA 1136

Query: 358  -SDYVKWRDEVVVP 320
             ++YV +R E   P
Sbjct: 1137 LAEYVIYRGEQAYP 1150



>gb:BC057370_2102739 Mus musculus tankyrase, TRF1-interacting
            ankyrin-related ADP-ribose polymerase, mRNA (cDNA clone
            MGC:67299 IMAGE:6835784), complete cds.
          Length = 1320

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 39/130 (30%), Positives = 50/130 (38%), Gaps = 14/130 (10%)
 Frame = -2

Query: 667  NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
            N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 1171 NERMLFHGSPFIN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 1225

Query: 511  -CFTNRKNPVGF----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVP-QESDY 350
             C T++          ML   V LG          M   P G HS  G         ++Y
Sbjct: 1226 GCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEY 1285

Query: 349  VKWRDEVVVP 320
            V +R E   P
Sbjct: 1286 VIYRGEQAYP 1295



>gb:AF082557_1881569 Homo sapiens TRF1-interacting ankyrin-related
            ADP-ribose polymerase mRNA, partial cds.
          Length = 1094

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 39/130 (30%), Positives = 50/130 (38%), Gaps = 14/130 (10%)
 Frame = -2

Query: 667  NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
            N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 945  NERMLFHGSPFIN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 999

Query: 511  -CFTNRKNPVGF----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVP-QESDY 350
             C T++          ML   V LG          M   P G HS  G         ++Y
Sbjct: 1000 GCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEY 1059

Query: 349  VKWRDEVVVP 320
            V +R E   P
Sbjct: 1060 VIYRGEQAYP 1069



>gb:AK048860_1168523 Mus musculus 0 day neonate cerebellum cDNA, RIKEN
            full-length enriched library, clone:C230076L23
            product:TRF1-INTERACTING ANKYRIN-RELATED ADP-RIBOSE
            POLYMERASE homolog [Homo sapiens], full insert sequence.
          Length = 976

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 39/130 (30%), Positives = 50/130 (38%), Gaps = 14/130 (10%)
 Frame = -2

Query: 667  NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
            N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 827  NERMLFHGSPFIN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 881

Query: 511  -CFTNRKNPVGF----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVP-QESDY 350
             C T++          ML   V LG          M   P G HS  G         ++Y
Sbjct: 882  GCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEY 941

Query: 349  VKWRDEVVVP 320
            V +R E   P
Sbjct: 942  VIYRGEQAYP 951



>sp|O95271|TNK1_HUMAN Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyrase I)
            (TNKS-1) (TRF1- interacting ankyrin-related ADP-ribose
            polymerase).>gb:AX062144_1458726 Sequence 3 from Patent
            WO0100849.>gb:AF082556_1881568 Homo sapiens
            TRF1-interacting ankyrin-related ADP-ribose polymerase
            mRNA, complete cds.
          Length = 1327

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 39/130 (30%), Positives = 50/130 (38%), Gaps = 14/130 (10%)
 Frame = -2

Query: 667  NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
            N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 1178 NERMLFHGSPFIN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 1232

Query: 511  -CFTNRKNPVGF----MLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVP-QESDY 350
             C T++          ML   V LG          M   P G HS  G         ++Y
Sbjct: 1233 GCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEY 1292

Query: 349  VKWRDEVVVP 320
            V +R E   P
Sbjct: 1293 VIYRGEQAYP 1302



>gb:AX880827_1478432 Sequence 15732 from Patent
           EP1074617.>gb:AK023746_1909732 Homo sapiens cDNA
           FLJ13684 fis, clone PLACE2000021, moderately similar to
           Homo sapiens TRF1-interacting ankyrin-related ADP-ribose
           polymerase mRNA.
          Length = 261

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 38/134 (28%), Positives = 50/134 (37%), Gaps = 18/134 (13%)
 Frame = -2

Query: 667 NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
           N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 135 NERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 189

Query: 511 ---------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQE 359
                    C+   +     +L   V LG       A  M   P G HS  G        
Sbjct: 190 GCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLA 245

Query: 358 -SDYVKWRDEVVVP 320
            ++YV +R E   P
Sbjct: 246 LAEYVIYRGEQAYP 259



>gb:AX062186_1458729 Sequence 45 from Patent WO0100849.
          Length = 160

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 38/134 (28%), Positives = 50/134 (37%), Gaps = 18/134 (13%)
 Frame = -2

Query: 667 NRMLLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY-------- 512
           N  +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY        
Sbjct: 19  NERMLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGT 73

Query: 511 ---------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKGLGKTVPQE 359
                    C+   +     +L   V LG       A  M   P G HS  G        
Sbjct: 74  GCPVHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLA 129

Query: 358 -SDYVKWRDEVVVP 320
            ++YV +R E   P
Sbjct: 130 LAEYVIYRGEQAYP 143



>gb:CR380950_1649836 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 499

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 18/45 (40%), Positives = 28/45 (62%)
 Frame = -3

Query: 210 FSTSDEPKFCIINVSWSCI*WWNLCWIFCSLVLYLLKLPGCLAPN 76
           F + D+P+  I+  SWS   +WN C IF ++++Y  +L G  APN
Sbjct: 457 FGSKDQPR--IVTDSWS---FWNWCNIFWTVLVYANELIGTQAPN 496



>gb:AX062182_1458727 Sequence 41 from Patent
           WO0100849.>gb:AX062184_1458728 Sequence 43 from Patent
           WO0100849.
          Length = 119

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 32/109 (29%), Positives = 41/109 (37%), Gaps = 17/109 (15%)
 Frame = -2

Query: 658 LLWHGSRLTNFVGILSQGLRIAPPEAPTTGYMFGKGVYFADMVSKSAQY----------- 512
           +L+HGS   N   I+ +G           G MFG G+YFA+  SKS QY           
Sbjct: 1   MLFHGSPFVN--AIIHKGF---DERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCP 55

Query: 511 ------CFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPKGKHSTKG 383
                 C+   +     +L   V LG       A  M   P G HS  G
Sbjct: 56  VHKDRSCYICHRQ----LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTG 100



>gb:AX880408_1478265 Sequence 15313 from Patent
           EP1074617.>gb:AK023350_1909604 Homo sapiens cDNA
           FLJ13288 fis, clone OVARC1001167.
          Length = 363

 Score = 33.5 bits (75), Expect = 5.0
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 1/114 (0%)
 Frame = -2

Query: 742 EVEQVFSLERKGELDKFAPFRKKLKNR-MLLWHGSRLTNFVGILSQGLRIAPPEAPTTGY 566
           ++E++  +E    LDKF   + ++K    LL++ +       I S        E     Y
Sbjct: 216 KIEKIKKIENSELLDKFTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKY 275

Query: 565 MFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPK 404
             GKG+YFA     S + C  + KN V  M +++V +G   E     Y   PP+
Sbjct: 276 --GKGIYFAKDAIYSHKNCPYDAKNVV--MFVAQVLVGKFTE-GNITYTSPPPQ 324



>gb:HSM806627_2018379 Homo sapiens mRNA; cDNA DKFZp686H1869 (from
            clone DKFZp686H1869).
          Length = 902

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 1/114 (0%)
 Frame = -2

Query: 742  EVEQVFSLERKGELDKFAPFRKKLKNR-MLLWHGSRLTNFVGILSQGLRIAPPEAPTTGY 566
            ++E++  +E    LDKF   + ++K    LL++ +       I S        E     Y
Sbjct: 755  KIEKIKKIENSELLDKFTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKY 814

Query: 565  MFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPK 404
              GKG+YFA     S + C  + KN V  M +++V +G   E     Y   PP+
Sbjct: 815  --GKGIYFAKDAIYSHKNCPYDAKNVV--MFVAQVLVGKFIE-GNITYTSPPPQ 863



>gb:BC027462_1978897 Homo sapiens zinc finger CCCH type, antiviral
           1, mRNA (cDNA clone IMAGE:4154337), partial cds.
          Length = 227

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 1/114 (0%)
 Frame = -2

Query: 742 EVEQVFSLERKGELDKFAPFRKKLKNR-MLLWHGSRLTNFVGILSQGLRIAPPEAPTTGY 566
           ++E++  +E    LDKF   + ++K    LL++ +       I S        E     Y
Sbjct: 80  KIEKIKKIENSELLDKFTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKY 139

Query: 565 MFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPK 404
             GKG+YFA     S + C  + KN V  M +++V +G   E     Y   PP+
Sbjct: 140 --GKGIYFAKDAIYSHKNCPYDAKNVV--MFVAQVLVGKFIE-GNITYTSPPPQ 188



>gb:CR858482_1182655 Pongo pygmaeus mRNA; cDNA DKFZp469D094 (from
            clone DKFZp469D094).
          Length = 1025

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 9/122 (7%)
 Frame = -2

Query: 742  EVEQVFSLERKGELDKFAPFRKKLKN--RMLLWHGSR-------LTNFVGILSQGLRIAP 590
            ++E++  +E    LDKF   + ++K   ++L +  SR       + NF   L +      
Sbjct: 877  KIEKIKRIENSELLDKFTRKKSQMKEEGKLLFYATSRAWVESICVNNFDSFLHE------ 930

Query: 589  PEAPTTGYMFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKP 410
                T    +GKG+YFA     S + C  + KN V  M +++V +G   E     Y   P
Sbjct: 931  ----THENKYGKGIYFAKDAIYSHKNCPYDAKNVV--MFIAQVLVGKFIE-GSMTYTSPP 983

Query: 409  PK 404
            P+
Sbjct: 984  PQ 985



>sp|Q7Z2W4|ZCC2_HUMAN Zinc finger CCCH type antiviral protein 1 (Zinc
            finger CCCH type domain containing protein 2) (PRO1677).
          Length = 902

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 1/114 (0%)
 Frame = -2

Query: 742  EVEQVFSLERKGELDKFAPFRKKLKNR-MLLWHGSRLTNFVGILSQGLRIAPPEAPTTGY 566
            ++E++  +E    LDKF   + ++K    LL++ +       I S        E     Y
Sbjct: 755  KIEKIKKIENSELLDKFTWKKSQMKEEGKLLFYATSRAYVESICSNNFDSFLHETHENKY 814

Query: 565  MFGKGVYFADMVSKSAQYCFTNRKNPVGFMLLSEVALGDMHELKKAQYMDKPPK 404
              GKG+YFA     S + C  + KN V  M +++V +G   E     Y   PP+
Sbjct: 815  --GKGIYFAKDAIYSHKNCPYDAKNVV--MFVAQVLVGKFIE-GNITYTSPPPQ 863


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 906,875,123
Number of Sequences: 1806583
Number of extensions: 19779900
Number of successful extensions: 43346
Number of sequences better than 10.0: 127
Number of HSP's better than 10.0 without gapping: 41910
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43141
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 54315948166
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)