BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13152
         (875 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB011479_1511449 Arabidopsis thaliana genomic DNA, chromosome...    43   2e-05   
pir|T49992|T49992 hypothetical protein F12B17.180 - Arabidopsis ...    42   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:A98314_1451446 Sequence 1 from Patent WO9913083.>gb:ATTH65_15...    42   4e-05   
gb:PFMAL8P1_1192156 Plasmodium falciparum 3D7 chromosome 8, *** ...    33   7.2     
gb:BX569689_775169 Synechococcus sp. WH8102 complete genome; seg...    33   9.4     


>gb:AB011479_1511449 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MNA5.
          Length = 1264

 Score = 43.1 bits (100), Expect(2) = 2e-05
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = -2

Query: 295 IKRTLAGEYLTSALNDFGPEQYDSLA 218
           +K T AGEYLT+ALNDF PEQY+ LA
Sbjct: 699 VKTTPAGEYLTAALNDFDPEQYEGLA 724



 Score = 28.1 bits (61), Expect(2) = 2e-05
 Identities = 13/14 (92%), Positives = 14/14 (100%)
 Frame = -3

Query: 213 AAISDGANKLLMLV 172
           AAI+DGANKLLMLV
Sbjct: 724 AAIADGANKLLMLV 737



>pir|T49992|T49992 hypothetical protein F12B17.180 - Arabidopsis
           thaliana>gb:ATF12B17_1548327 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F12B17 (ESSA
           project).>gb:AY100691_1576947 Arabidopsis thaliana
           geminivirus replication protein-interacting protein
           (GRIMP) mRNA, complete cds.
          Length = 1273

 Score = 42.0 bits (97), Expect(2) = 4e-05
 Identities = 18/26 (69%), Positives = 22/26 (84%)
 Frame = -2

Query: 295 IKRTLAGEYLTSALNDFGPEQYDSLA 218
           +K T AGEYLT+ALNDF PE+Y+ LA
Sbjct: 716 VKTTPAGEYLTAALNDFDPEEYEGLA 741



 Score = 28.1 bits (61), Expect(2) = 4e-05
 Identities = 13/14 (92%), Positives = 14/14 (100%)
 Frame = -3

Query: 213 AAISDGANKLLMLV 172
           AAI+DGANKLLMLV
Sbjct: 741 AAIADGANKLLMLV 754



>gb:A98314_1451446 Sequence 1 from Patent
           WO9913083.>gb:ATTH65_1556665 Arabidopsis thaliana mRNA
           for Cdc2a associating protein.
          Length = 394

 Score = 42.0 bits (97), Expect(2) = 4e-05
 Identities = 18/26 (69%), Positives = 22/26 (84%)
 Frame = -2

Query: 295 IKRTLAGEYLTSALNDFGPEQYDSLA 218
           +K T AGEYLT+ALNDF PE+Y+ LA
Sbjct: 244 VKTTPAGEYLTAALNDFDPEEYEGLA 269



 Score = 28.1 bits (61), Expect(2) = 4e-05
 Identities = 13/14 (92%), Positives = 14/14 (100%)
 Frame = -3

Query: 213 AAISDGANKLLMLV 172
           AAI+DGANKLLMLV
Sbjct: 269 AAIADGANKLLMLV 282



>gb:PFMAL8P1_1192156 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 563

 Score = 33.1 bits (74), Expect = 7.2
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +2

Query: 470 FSLGNLIASLLPTGDRNCFSFLCQYIKSPVSS 565
           F  G  I + +  GDRNCF + C  IKS + S
Sbjct: 479 FRSGTYIYNSMKIGDRNCFDYKCNIIKSNIGS 510



>gb:BX569689_775169 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 1008

 Score = 32.7 bits (73), Expect = 9.4
 Identities = 18/77 (23%), Positives = 32/77 (41%)
 Frame = +2

Query: 626 VEQERNFWALLTGIFYFYILPFDRIEVRKRKVKEWSAAPLCRLKISSSSSFWENYTRKPQ 805
           V+     W +  G+  F   P   +++R  +  +  +APLC  +      FW+ +    +
Sbjct: 675 VQVSPEIWRVSNGLVEFECSPVGLLQLRDAQGVDQLSAPLCPCRYRDRGEFWDAWDIAAE 734

Query: 806 LEEGATRAHPLESSDLG 856
                 R HPLE   +G
Sbjct: 735 Y-----RRHPLELEPVG 746


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 893,424,032
Number of Sequences: 1806583
Number of extensions: 18252452
Number of successful extensions: 34768
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 33867
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34761
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 60430988688
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)