BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13132
         (823 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB061795_1522088 Bruguiera gymnorhiza bg55 mRNA, complete cds.     167   3e-40   
pir|G96698|G96698 hypothetical protein F12B7.8 [imported] - Arab...   130   4e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T00664|T00664 hypothetical protein F3I6.27 - Arabidopsis tha...   119   9e-26   Arabidopsis thaliana [mouse-ear cress]
pir|D86404|D86404 unknown protein [imported] - Arabidopsis thali...   118   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AP005323_1850633 Oryza sativa (japonica cultivar-group) genom...   117   3e-25   
gb:AP003512_1830165 Oryza sativa (japonica cultivar-group) genom...   114   2e-24   
pir|E85431|E85431 hypothetical protein AT4g36550 [imported] - Ar...   114   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00051_1693915 Oryza sativa genomic DNA, chromosome 4, BAC...   103   3e-21   
gb:AY224536_1590733 Oryza sativa (japonica cultivar-group) isola...   100   3e-20   
gb:AP002842_1823069 Oryza sativa (japonica cultivar-group) genom...   100   4e-20   
gb:AP002842_1823068 Oryza sativa (japonica cultivar-group) genom...   100   4e-20   
gb:AP003791_1833380 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:AP003313_1827861 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:AC144737_1744131 Oryza sativa (japonica cultivar-group) chrom...    97   3e-19   
gb:AY224537_1590734 Oryza sativa (japonica cultivar-group) isola...    97   3e-19   
gb:AP005319_1850521 Oryza sativa (japonica cultivar-group) genom...    97   4e-19   
gb:AY065279_1566429 Arabidopsis thaliana unknown protein (At3g54...    96   6e-19   
gb:AY035038_1559816 Arabidopsis thaliana unknown protein (At2g28...    95   2e-18   
pir|D84689|D84689 hypothetical protein At2g28830 [imported] - Ar...    95   2e-18   Arabidopsis thaliana [mouse-ear cress]
pir|T45588|T45588 arm repeat containing protein homolog - Arabid...    94   3e-18   Arabidopsis thaliana [mouse-ear cress]
gb:BT002518_1636121 Arabidopsis thaliana unknown protein (At1g23...    93   7e-18   
pir|D86364|D86364 hypothetical protein F10G19.3 - Arabidopsis th...    93   7e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AX250427_1464811 Sequence 33 from Patent WO0168863.>gb:ATAC00...    92   9e-18   
gb:AP004837_1845739 Oryza sativa (japonica cultivar-group) genom...    92   1e-17   
gb:AY064045_1565983 Arabidopsis thaliana putative arm repeat-con...    91   3e-17   
pir|A86416|A86416 probable arm repeat-containing protein - Arabi...    91   3e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AB016888_1513158 Arabidopsis thaliana genomic DNA, chromosome...    90   6e-17   
gb:AY219234_1590356 Nicotiana tabacum arm repeat-containing prot...    89   8e-17   
pir|T06735|T06735 hypothetical protein F28P10.170 - Arabidopsis ...    89   8e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AK175585_1817573 Arabidopsis thaliana mRNA for arm repeat con...    89   1e-16   
gb:AP003561_1830808 Oryza sativa (japonica cultivar-group) genom...    89   1e-16   
pir|T48204|T48204 hypothetical protein T20L15.100 - Arabidopsis ...    89   1e-16   Arabidopsis thaliana [mouse-ear cress]
gb:BT015818_1642436 Arabidopsis thaliana At5g67340 gene, complet...    87   4e-16   
gb:AY652589_1620174 Oryza sativa (japonica cultivar-group) cell ...    87   4e-16   
gb:AB007645_1510150 Arabidopsis thaliana genomic DNA, chromosome...    87   4e-16   
gb:AC008148_1536565 Arabidopsis thaliana chromosome I BAC F15H11...    87   5e-16   
pir|E96734|E96734 unknown protein F23N20.1 [imported] - Arabidop...    87   5e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP004584_1841875 Oryza sativa (japonica cultivar-group) genom...    85   2e-15   
gb:AP005391_1850946 Oryza sativa (japonica cultivar-group) genom...    84   2e-15   
gb:AY220483_1590517 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    82   9e-15   
gb:AP004030_1836607 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
pir|T00518|T00518 hypothetical protein At2g23140 [imported] - Ar...    81   2e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP004667_1842961 Oryza sativa (japonica cultivar-group) genom...    76   7e-13   
gb:AY084697_1569784 Arabidopsis thaliana clone 115372 mRNA, comp...    76   7e-13   
pir|T46047|T46047 hypothetical protein T16K5.160 - Arabidopsis t...    76   7e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AY087421_1572452 Arabidopsis thaliana clone 35218 mRNA, compl...    75   1e-12   
pir|D96686|D96686 unknown protein F15E12.6 [imported] - Arabidop...    75   1e-12   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00182_1696311 Oryza sativa genomic DNA, chromosome 4, BAC...    74   3e-12   
gb:AP003876_1834695 Oryza sativa (japonica cultivar-group) genom...    73   6e-12   
gb:BT020311_1642706 Arabidopsis thaliana At5g37490 gene, complet...    73   6e-12   
gb:AY062476_1565132 Arabidopsis thaliana Unknown protein (At5g65...    73   6e-12   
gb:AB018108_1513731 Arabidopsis thaliana genomic DNA, chromosome...    73   6e-12   
pir|T05882|T05882 hypothetical protein F6H11.10 - Arabidopsis th...    73   6e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AK118613_1816581 Arabidopsis thaliana At3g54790 mRNA for unkn...    72   1e-11   
gb:AB083031_1524144 Glycine max mRNA for syringolide-induced pro...    72   1e-11   
pir|T47638|T47638 hypothetical protein T5N23.150 - Arabidopsis t...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AK118346_1816329 Arabidopsis thaliana At1g49780 mRNA for unkn...    72   1e-11   
pir|E96534|E96534 Hypothetical protein [imported] - Arabidopsis ...    72   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AP005702_1856333 Oryza sativa (japonica cultivar-group) genom...    71   2e-11   
gb:AB025624_1516467 Arabidopsis thaliana genomic DNA, chromosome...    71   2e-11   
gb:AP004685_1843360 Oryza sativa (japonica cultivar-group) genom...    71   3e-11   
gb:STU306423_1723036 Solanum tuberosum subsp. andigena mRNA for ...    71   3e-11   
pir|T05177|T05177 hypothetical protein T6K22.80 - Arabidopsis th...    70   4e-11   Arabidopsis thaliana [mouse-ear cress]
pir|T08872|T08872 hypothetical protein ARC1 - rape>gb:AF024625_1...    70   4e-11   Brassica napus [oilseed rape]
gb:OSJN00024_1693489 Oryza sativa genomic DNA, chromosome 4, BAC...    70   5e-11   
gb:AP004096_1837683 Oryza sativa (japonica cultivar-group) genom...    70   6e-11   
gb:OSJN00062_1694156 Oryza sativa genomic DNA, chromosome 4, BAC...    69   1e-10   
gb:AY220485_1590519 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    69   1e-10   
pir|T02271|T02271 hypothetical protein T13D8.8 - Arabidopsis tha...    69   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AF274564_1782444 Petroselinum crispum immediate-early fungal ...    69   1e-10   
gb:AF274563_1782443 Petroselinum crispum immediate-early fungal ...    69   1e-10   
gb:BT005829_1638751 Arabidopsis thaliana At2g35930 gene, complet...    69   1e-10   
pir|G84774|G84774 hypothetical protein At2g35930 [imported] - Ar...    69   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AC103891_1737312 Oryza sativa (japonica cultivar-group) chrom...    68   2e-10   
gb:AC134930_1741940 Oryza sativa (japonica cultivar-group) chrom...    67   3e-10   
gb:AP004847_1845905 Oryza sativa (japonica cultivar-group) genom...    67   4e-10   
pir|T08454|T08454 hypothetical protein F22O6.170 - Arabidopsis t...    66   7e-10   Arabidopsis thaliana [mouse-ear cress]
gb:BT005359_1638299 Arabidopsis thaliana At3g18710 mRNA, complet...    66   9e-10   
gb:AB026654_1517300 Arabidopsis thaliana genomic DNA, chromosome...    66   9e-10   
gb:AB010076_1511008 Arabidopsis thaliana genomic DNA, chromosome...    66   9e-10   
gb:AP005469_1852403 Oryza sativa (japonica cultivar-group) genom...    65   1e-09   
gb:BT005367_1638307 Arabidopsis thaliana At3g61390 mRNA, complet...    65   1e-09   
pir|T47931|T47931 hypothetical protein T20K12.290 - Arabidopsis ...    65   1e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T49918|T49918 hypothetical protein F17I14.10 - Arabidopsis t...    65   1e-09   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00188_1696449 Oryza sativa genomic DNA, chromosome 4, BAC...    64   3e-09   
gb:AP005609_1854849 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AP005546_1853897 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
gb:AC114983_1739193 Oryza sativa (japonica cultivar-group) chrom...    64   4e-09   
gb:AB026295_1516916 Oryza sativa (japonica cultivar-group) genom...    63   6e-09   
pir|B86239|B86239 protein T10O24.19 [imported] - Arabidopsis tha...    63   6e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AP005828_1858612 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:AP005112_1848052 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:AP004139_1838153 Oryza sativa (japonica cultivar-group) genom...    63   8e-09   
gb:OSJN00036_1693692 Oryza sativa genomic DNA, chromosome 4, BAC...    63   8e-09   
gb:AP001859_1821435 Oryza sativa (japonica cultivar-group) genom...    62   2e-08   
gb:OSJN00084_1694601 Oryza sativa genomic DNA, chromosome 4, BAC...    62   2e-08   
gb:ATAC016795_1543597 Arabidopsis thaliana chromosome III BAC F2...    62   2e-08   
gb:BC089856_2111051 Rattus norvegicus cDNA clone MGC:108920 IMAG...    61   2e-08   
gb:AP004651_1842668 Oryza sativa (japonica cultivar-group) genom...    61   2e-08   
gb:AK011391_1156373 Mus musculus 10 days embryo whole body cDNA,...    61   2e-08   
gb:AB013395_1512166 Arabidopsis thaliana genomic DNA, chromosome...    60   4e-08   
gb:AP003270_1826860 Oryza sativa (japonica cultivar-group) genom...    60   5e-08   
gb:OSJN00179_1696259 Oryza sativa genomic DNA, chromosome 4, BAC...    60   5e-08   
pir|E86147|E86147 T1N6.4 protein - Arabidopsis thaliana>gb:AE005...    60   6e-08   Arabidopsis thaliana [mouse-ear cress]
gb:BC029520_1979537 Homo sapiens WD repeat and SAM domain contai...    59   1e-07   
gb:AK093494_1914000 Homo sapiens cDNA FLJ36175 fis, clone TESTI2...    59   1e-07   
gb:AY128369_1580668 Arabidopsis thaliana putative protein (At5g6...    59   1e-07   
gb:AB015469_1512515 Arabidopsis thaliana genomic DNA, chromosome...    59   1e-07   
gb:AC114983_1739186 Oryza sativa (japonica cultivar-group) chrom...    58   2e-07   
gb:AE016959_1020752 Oryza sativa (japonica cultivar-group) chrom...    58   2e-07   
gb:AP005828_1858614 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:AB026295_1516945 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:AE016959_1023722 Oryza sativa (japonica cultivar-group) chrom...    57   4e-07   
pir|F86147|F86147 hypothetical protein T1N6.5 [imported] - Arabi...    57   4e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AC133859_1741530 Oryza sativa chromosome 3 BAC OSJNBa0075A22 ...    57   5e-07   
gb:AY091018_1574249 Arabidopsis thaliana unknown protein (At3g47...    57   5e-07   
pir|T07721|T07721 hypothetical protein T23J7.150 - Arabidopsis t...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP004996_1846974 Oryza sativa (japonica cultivar-group) genom...    56   9e-07   
gb:AK176453_1818441 Arabidopsis thaliana mRNA, complete cds, clo...    56   9e-07   
gb:AK176423_1818411 Arabidopsis thaliana mRNA, complete cds, clo...    56   9e-07   
gb:AY050369_1562148 Arabidopsis thaliana AT3g49060/T2J13_100 mRN...    56   9e-07   
pir|T46124|T46124 hypothetical protein T2J13.100 - Arabidopsis t...    56   9e-07   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00163_1695975 Oryza sativa genomic DNA, chromosome 4, BAC...    55   2e-06   
gb:BT015764_1642382 Arabidopsis thaliana At2g45920 mRNA, complet...    55   2e-06   
pir|T02455|T02455 hypothetical protein At2g45920 [imported] - Ar...    55   2e-06   Arabidopsis thaliana [mouse-ear cress]
gb:BT002512_1636115 Arabidopsis thaliana putative protein kinase...    54   3e-06   
pir|T02456|T02456 protein kinase homolog F4I18.11 - Arabidopsis ...    54   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP005301_1850177 Oryza sativa (japonica cultivar-group) genom...    53   6e-06   
gb:AB023044_1515502 Arabidopsis thaliana genomic DNA, chromosome...    53   6e-06   
gb:AE016959_1023724 Oryza sativa (japonica cultivar-group) chrom...    53   8e-06   
gb:AY059775_1564625 Arabidopsis thaliana unknown protein (At1g20...    52   1e-05   
gb:AE005172_891034 Arabidopsis thaliana chromosome 1, top arm co...    52   1e-05   
gb:AP004648_1842618 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AK118101_1816098 Arabidopsis thaliana At1g01670 mRNA for unkn...    52   2e-05   
gb:AE016959_1023834 Oryza sativa (japonica cultivar-group) chrom...    52   2e-05   
gb:AP004729_1843899 Oryza sativa (japonica cultivar-group) genom...    51   3e-05   
gb:AY224495_1590697 Oryza sativa (japonica cultivar-group) isola...    50   4e-05   
pir|E96791|E96791 hypothetical protein F15M4.11 [imported] - Ara...    50   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP004026_1836552 Oryza sativa (japonica cultivar-group) genom...    50   5e-05   
gb:AE016959_1021139 Oryza sativa (japonica cultivar-group) chrom...    50   5e-05   
pir|T05537|T05537 probable serine/threonine-specific protein kin...    50   5e-05   Arabidopsis thaliana [mouse-ear cress]
pir|A96714|A96714 hypothetical protein T6L1.12 [imported] - Arab...    50   7e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP004994_1846913 Oryza sativa (japonica cultivar-group) genom...    49   9e-05   
pir|T01289|T01289 probable protein kinase At2g19410 [imported] -...    49   9e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023718 Oryza sativa (japonica cultivar-group) chrom...    49   1e-04   
gb:AP004139_1838156 Oryza sativa (japonica cultivar-group) genom...    48   3e-04   
gb:AB010699_1511236 Arabidopsis thaliana genomic DNA, chromosome...    48   3e-04   
gb:AY653733_2371645 Mimivirus, complete genome.                        47   3e-04   
gb:AP005728_1856699 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AP005284_1849815 Oryza sativa (japonica cultivar-group) genom...    47   6e-04   
gb:AB012239_1511664 Arabidopsis thaliana genomic DNA, chromosome...    45   0.001   
gb:AB012239_1511663 Arabidopsis thaliana genomic DNA, chromosome...    45   0.001   
gb:AP004994_1846915 Oryza sativa (japonica cultivar-group) genom...    44   0.004   
gb:AP003044_1824349 Oryza sativa (japonica cultivar-group) genom...    44   0.005   
pir|E96601|E96601 hypothetical protein T6h22.17 [imported] - Ara...    40   0.040   Arabidopsis thaliana [mouse-ear cress]
gb:CR382132_1665641 Yarrowia lipolytica chromosome F of strain C...    40   0.053   
gb:S80988_2579450 xnf7-O=nuclear factor 7 [Xenopus laevis, oocyt...    39   0.15    
pir|A43906|A43906 nuclear phosphoprotein xnf7 - African clawed f...    39   0.15    Xenopus laevis [clawed frog]
pir|S28418|S28418 probable zinc-binding protein - Iberian ribbed...    37   0.34    Pleurodeles waltl [Spanish newt]
sp|Q02084|A33_PLEWA|A33_PLEWA Zinc-binding protein A33.>gb:SMRPWA33A_25800...    37   0.34    Pleurodeles waltl [Spanish newt]
gb:AY095206_1298285 Drosophila melanogaster SD06937 full insert ...    37   0.45    
gb:AE014134_1128972 Drosophila melanogaster chromosome 2L, compl...    37   0.45    
gb:AP004864_1846196 Oryza sativa (japonica cultivar-group) genom...    36   0.76    
gb:BC052391_2101069 Mus musculus G protein-coupled receptor 125,...    35   1.3     
gb:BC019649_2093040 Mus musculus G protein-coupled receptor 125,...    35   1.3     
gb:AK172893_2069827 Mus musculus mRNA for mKIAA0126 protein.           35   1.7     
gb:D50916_1994781 Homo sapiens mRNA for KIAA0126 gene, partial cds.    35   1.7     
gb:AF091093_1882515 Homo sapiens clone 686 unknown mRNA, complet...    35   1.7     
gb:AB028839_1865785 Homo sapiens HDNB1(homzygously deleted in ne...    35   1.7     
gb:AB014584_1864613 Homo sapiens mRNA for KIAA0684 protein, part...    35   1.7     
gb:AF539857_1280296 Trypanosoma cruzi putative splicing factor X...    35   1.7     
gb:PFMAL7P1_1191794 Plasmodium falciparum 3D7 chromosome 7, *** ...    35   1.7     
gb:CR859425_1183542 Pongo pygmaeus mRNA; cDNA DKFZp469M236 (from...    35   1.7     
gb:CR858257_1182442 Pongo pygmaeus mRNA; cDNA DKFZp469M224 (from...    35   1.7     
gb:AY325198_1177867 Rattus norvegicus Ab2-232 mRNA, complete cds.      35   1.7     
gb:AK037131_1164760 Mus musculus adult female vagina cDNA, RIKEN...    35   1.7     
sp|O95155|UB4B_HUMAN|UB4B_HUMAN Ubiquitin conjugation factor E4 B (Ubiquiti...    35   1.7     Homo sapiens [man]
sp|Q14139|UB4A_HUMAN|UB4A_HUMAN Ubiquitin conjugation factor E4 A.                35   1.7     Homo sapiens [man]
gb:AY029484_2508654 Danio rerio ubiquitination factor E4/UFD2 mR...    35   2.2     
gb:AB080911_1524017 Arabis gemmifera gene for similar to A. thal...    35   2.2     
gb:AE017354_461164 Legionella pneumophila subsp. pneumophila str...    35   2.2     
gb:CR628336_113004 Legionella pneumophila str. Paris complete ge...    35   2.2     
gb:AJ720127_2502314 Gallus gallus mRNA for hypothetical protein,...    34   2.9     
gb:BC035645_1981641 Homo sapiens, Similar to RIKEN cDNA 3830613O...    34   2.9     
gb:AY181243_1937956 Homo sapiens G protein-coupled receptor 125 ...    34   2.9     
gb:BX908808_1644509 Neurospora crassa DNA linkage group IV Cosmi...    34   2.9     
gb:BC065969_2554223 Danio rerio tnf receptor-associated factor 4...    34   3.8     
gb:AF483536_2497122 Oncorhynchus mykiss clone B32 VHSV-induced p...    34   3.8     
gb:AX247824_1464740 Sequence 65 from Patent WO0166748.                 34   3.8     
gb:BC021259_1977458 Homo sapiens tripartite motif-containing 65,...    33   4.9     
gb:AY358401_1947280 Homo sapiens clone DNA50988 MYL5 (UNQ385) mR...    33   4.9     
gb:AK175637_1817625 Arabidopsis thaliana mRNA for putative zinc ...    33   4.9     
pir|T00949|T00949 hypothetical protein T3F12.10 - Arabidopsis th...    33   4.9     Arabidopsis thaliana [mouse-ear cress]
pir|T01825|T01825 hypothetical protein T15F16.7 - Arabidopsis th...    33   4.9     Arabidopsis thaliana [mouse-ear cress]
gb:BC075620_2106664 Mus musculus ubiquitination factor E4B, UFD2...    33   6.5     
gb:BC067402_2105982 Mus musculus ubiquitination factor E4B, UFD2...    33   6.5     
gb:AK122345_2069010 Mus musculus mRNA for mKIAA0684 protein.           33   6.5     
gb:AF260926_2060830 Mus musculus ubiquitin fusion degradation pr...    33   6.5     
gb:AB08324S27_2047736 Mus musculus gene for U-box-type ubiquitin...    33   6.5     
gb:ATAC009853_1543044 Arabidopsis thaliana chromosome III BAC F2...    33   6.5     
gb:AY427787_1430147 Bos taurus paternally expressed gene 3 (Peg3...    33   6.5     
gb:AK029914_1161715 Mus musculus adult male testis cDNA, RIKEN f...    33   6.5     
sp|Q9ES00|UB4B_MOUSE|UB4B_MOUSE Ubiquitin conjugation factor E4 B (Ubiquiti...    33   6.5     Mus musculus [mouse]


>gb:AB061795_1522088 Bruguiera gymnorhiza bg55 mRNA, complete cds.
          Length = 756

 Score =  167 bits (422), Expect = 3e-40
 Identities = 102/264 (38%), Positives = 146/264 (55%), Gaps = 29/264 (10%)
 Frame = -3

Query: 821 LRGARFSLEPSEEEAAKVVKELLFQCT------KSELESVQVAMWRLNITSPNALLMEKR 660
           LR A+F L+ S+EEA K V+ELL Q T      +SE++ ++ A  RL IT+P  LL+EKR
Sbjct: 125 LRVAKFVLDHSDEEAGKAVRELLQQHTSMSDAVESEIKVLRFAASRLCITTPKDLLIEKR 184

Query: 659 CIKTLLDNVGEGDGQXXXXXXXXXXXXXXXXKAIVEQNTENGYNNLQRDHLFPARANILN 480
            IK L++ V + D                   +I+ +  EN   N Q++ LF   +++ +
Sbjct: 185 SIKKLVNKVRDNDPTKKKILIYLLHLLKKYGNSILGEQGEN--LNSQQEELFADGSSVSS 242

Query: 479 R-----------------------PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRW 369
           +                       P PP+ +KCP+S RLMYDPVVIASG+TFER+WIQ+W
Sbjct: 243 QAAEVGPCTACKQIVAEAEMSNIPPAPPEEYKCPLSKRLMYDPVVIASGQTFERIWIQKW 302

Query: 368 FDAGHNTCPKTGETLPDLTITPNNLLKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASS 189
           FD G++TCPKT   L   ++ PN  LK LI KWC + GV   DP +  +     S + SS
Sbjct: 303 FDEGNDTCPKTLVKLDHQSLMPNTALKDLISKWCEKYGVTILDPNSQAF----QSLDTSS 358

Query: 188 ASIASLNSYMDGLSLPIGFNNLSI 117
            S+AS    M+ L LP+  +N+S+
Sbjct: 359 TSVASFGISMNDLHLPLDISNVSL 382



>pir|G96698|G96698 hypothetical protein F12B7.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_894374 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011020_1537198 Arabidopsis thaliana
           chromosome 1 BAC F12B7 genomic sequence, complete
           sequence.>gb:BT006484_1639371 Arabidopsis thaliana
           At1g67530 gene, complete cds.>gb:AK117197_1815242
           Arabidopsis thaliana At1g67530 mRNA for unknown protein,
           complete cds, clone: RAFL16-74-G20.
          Length = 782

 Score =  130 bits (326), Expect = 4e-29
 Identities = 92/278 (33%), Positives = 134/278 (48%), Gaps = 40/278 (14%)
 Frame = -3

Query: 821 LRGARFSLEPSEEEAAKVVKELLFQCTK-------SELESVQVAMWRLNITSPNALLMEK 663
           L   RF L+PSE+E    +  LL Q  K       +ELE    A  RL+ITS    L E+
Sbjct: 123 LENTRFMLDPSEKEVGDQIIALLQQGKKFDNCNDNTELEIFHRAATRLSITSSRVALAER 182

Query: 662 RCIKTLLDNVGEGDGQXXXXXXXXXXX-----XXXXXKAIVEQNTENGYN--NLQRDH-- 510
           R +K L+D     + +                       I+++N   G    +   DH  
Sbjct: 183 RALKKLIDRARAEEDKRKESIVAYLLHLMRKCSKLFRSEILDENDSPGSYPCSPNEDHGS 242

Query: 509 -------------LFPARANILNR---PIPPDVFKCPISSRLMYDPVVIASGETFERMWI 378
                        L     N +N    P+PP+  +CPIS +LM DPV+IASG+T+ER+ I
Sbjct: 243 VHGFGRQLSRFGSLNDKPMNSINSGQMPVPPEELRCPISLQLMCDPVIIASGQTYERVCI 302

Query: 377 QRWFDAGHNTCPKTGETLPDLTITPNNLLKGLILKWCAEQG--VACSDPTTCIYD----A 216
           ++WF  GHNTCPKT + LP +++TPNN +KGLI  WC + G  +    P +   D    A
Sbjct: 303 EKWFSDGHNTCPKTQQQLPHISLTPNNCVKGLIASWCEQNGTQIPSGPPESQDLDYWRLA 362

Query: 215 VPHSWEASSASIASLNSY-MDGLSL-PIGFNNLSIVTR 108
           +  S    S S+ S+ SY + G+ + P+  N  ++V R
Sbjct: 363 LSDSESTKSQSVNSIGSYKLKGVKIVPLEENGTTVVER 400



>pir|T00664|T00664 hypothetical protein F3I6.27 - Arabidopsis
           thaliana>gb:AE005172_891386 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC002396_1530695 Arabidopsis thaliana
           chromosome I BAC F3I6 genomic sequence, complete
           sequence.
          Length = 709

 Score =  119 bits (297), Expect = 9e-26
 Identities = 73/225 (32%), Positives = 106/225 (47%), Gaps = 35/225 (15%)
 Frame = -3

Query: 821 LRGARFSLEPSEEEAAKVVKELLFQCTK-------SELESVQVAMWRLNITSPNALLMEK 663
           L   +F L+PSE+E    +  LL Q  K       +ELE    A  RL+ITS  + L E+
Sbjct: 61  LEHTKFLLDPSEKEVGDRIIALLQQGKKFDNGSDSTELEIFHQAATRLSITSSRSALAER 120

Query: 662 RCIKTLLDNVGEGDGQXXXXXXXXXXXXXXXXKAIVEQNTENGYNNLQRDHLFPA----- 498
           R +K ++D     + +                  +      +  ++       P      
Sbjct: 121 RALKKVIDRARVEEDKRKESIVAYLLHLMRKYSKLFRSEMMDENDSPCSTPCSPTGQGPN 180

Query: 497 --RANILNR---------------------PIPPDVFKCPISSRLMYDPVVIASGETFER 387
             R N   R                     PIPP+  +CPIS +LMYDPV+IASG+T+ER
Sbjct: 181 EDRVNAFGRQLSKFGSINYKPMNSRKSGQMPIPPEELRCPISLQLMYDPVIIASGQTYER 240

Query: 386 MWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLILKWCAEQGV 252
           + I++WF  GHN+CPKT + LP L++TPN  +KGLI  WC + G+
Sbjct: 241 VCIEKWFSDGHNSCPKTQQQLPHLSLTPNYCVKGLIASWCEQNGI 285



>pir|D86404|D86404 unknown protein [imported] - Arabidopsis
           thaliana>gb:AE005172_891674 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069471_1540837 Arabidopsis thaliana
           chromosome 1 BAC F13K9 genomic sequence, complete
           sequence.>gb:AY094469_1575764 Arabidopsis thaliana
           At1g27910/F13K9_2 mRNA, complete
           cds.>gb:BT002721_1636324 Arabidopsis thaliana
           At1g27910/F13K9_2 gene, complete cds.
          Length = 768

 Score =  118 bits (295), Expect = 2e-25
 Identities = 76/233 (32%), Positives = 106/233 (45%), Gaps = 39/233 (16%)
 Frame = -3

Query: 821 LRGARFSLEPSEEEAAKVVKELLFQ-------CTKSELESVQVAMWRLNITSPNALLMEK 663
           L    FSL+P+E+E    +  LL Q          +ELE    A  RL ITS  A L E+
Sbjct: 123 LENTEFSLDPAEKEIGDQIIGLLQQGGNFESSSDNNELEVFHQAATRLGITSSRAALTER 182

Query: 662 RCIKTLLDNVGEGDGQXXXXXXXXXXX-----XXXXXKAIVEQNTENGYNNLQ-----RD 513
           RC+K L++     D +                       I + N   G ++L      + 
Sbjct: 183 RCLKKLIERARMEDDKRKESIVAYLLHLMRKYSKLFRSEIWDDNDSQGSSSLPCSPTIQG 242

Query: 512 HLFPARANILNRP----------------------IPPDVFKCPISSRLMYDPVVIASGE 399
            +  A     +R                       +PP+  +CPIS +LMYDPV+IASG+
Sbjct: 243 SIDDAHGRAFDRQLSKLSSFNFRSCNNNRRSSQMSVPPEELRCPISLQLMYDPVIIASGQ 302

Query: 398 TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLILKWCAEQGVACSD 240
           T+ER+ I++WF  GHNTCPKT + L  L +TPN  +K LI  WC + GV   D
Sbjct: 303 TYERICIEKWFSDGHNTCPKTHQQLSHLCLTPNYCVKALISSWCEQNGVQVPD 355



>gb:AP005323_1850633 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0680A05.
          Length = 770

 Score =  117 bits (293), Expect = 3e-25
 Identities = 76/244 (31%), Positives = 117/244 (47%), Gaps = 37/244 (15%)
 Frame = -3

Query: 809 RFSLEPSEEEAAKVVKELLFQCTKSE---LESVQVAMWRLNITSPNALLMEKRCIKTLLD 639
           +F ++P+EEEA K + E+L Q   +E   LE+   A   LN+TSP ++L+E+R IK LLD
Sbjct: 129 KFVIDPTEEEAGKTILEMLRQSDVTEELELETFLQAASNLNLTSPKSMLIERRAIKKLLD 188

Query: 638 NVGEGD-------------------------GQXXXXXXXXXXXXXXXXKAIVEQNTENG 534
            +   D                         G+                  + + +T   
Sbjct: 189 KISGTDPKKEGVLKFLLYLVKKYGKNIKPETGERNENMQSESQSSTPSSSFVSDTSTPGK 248

Query: 533 Y---NNLQRDHLFPARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFD 363
           +    ++QR+     + ++     PP  F CPIS++LM DPV+I SG+T+ER  I+RWF 
Sbjct: 249 WYTPTDIQRNE---DQTSMSGAATPPAEFCCPISTKLMRDPVIITSGQTYERENIERWFR 305

Query: 362 AGHNTCPKTGETLPDLTITPNNLLKGLILKWCAEQGVACSD---PTTCIYDAVP---HSW 201
            G++TCP+T   L +  + PN  ++ LI  WC E G   SD   P+   Y  +P   H +
Sbjct: 306 EGYDTCPRTHIKLENFAMIPNTCMRDLIFNWCKEHGFIISDILPPSKNAYSYLPEQLHGY 365

Query: 200 EASS 189
             SS
Sbjct: 366 SMSS 369



>gb:AP003512_1830165 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0618D11.
          Length = 761

 Score =  114 bits (286), Expect = 2e-24
 Identities = 68/215 (31%), Positives = 104/215 (48%), Gaps = 28/215 (13%)
 Frame = -3

Query: 821 LRGARFSLEPSEEEAAKVVKELLFQCTKS---ELESVQVAMWRLNITSPNALLMEKRCIK 651
           L   +F ++P E+EA K + E+L Q   +   EL++   A  +LN+TSP A+L+E+R IK
Sbjct: 125 LGDVKFIVDPEEDEAGKAILEMLRQSDATQEHELQTFLFAASKLNLTSPKAILIERRAIK 184

Query: 650 TLLDNVGEGDG----------------------QXXXXXXXXXXXXXXXXKAIVEQNTEN 537
            LLD +   D                       +                  ++   T+ 
Sbjct: 185 KLLDKINGNDPKKEGILKFFQYLVRKYGKTMKPEGSAKNEGVDVANVTSSTNLIASGTDA 244

Query: 536 GYNNLQRDHLFPARA---NILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWF 366
                   + +  R    N L+R   P  F CP+S +LMYDPV+IASG+T+ER  I++WF
Sbjct: 245 PQKCFSPTNSWTGRCEEQNNLSRFSTPPEFCCPLSMKLMYDPVIIASGQTYERENIEKWF 304

Query: 365 DAGHNTCPKTGETLPDLTITPNNLLKGLILKWCAE 261
             G++ CP+T   L + TITPN  +K +I  WC +
Sbjct: 305 SEGYDICPRTQLKLENFTITPNTCMKAVICNWCKD 339



>pir|E85431|E85431 hypothetical protein AT4g36550 [imported] -
           Arabidopsis thaliana>gb:ATAP22_1544042 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 2.>gb:ATCHRIV85_1547610 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 85.
          Length = 680

 Score =  114 bits (284), Expect = 3e-24
 Identities = 70/206 (33%), Positives = 106/206 (51%), Gaps = 11/206 (5%)
 Frame = -3

Query: 821 LRGARFSLEPSEEEAAKVVKELLFQCTKS-----ELESVQVAMWRLNITSPNALLMEKRC 657
           LR  + +LE SEEEA K ++EL+ + T S     E++    A  +L +++P A++ E+R 
Sbjct: 82  LRSTQLTLEFSEEEAGKAIRELMQKSTSSSASPDEIKDFHYAALKLQLSTPEAIVTERRS 141

Query: 656 IKTLLDNVGEGDGQXXXXXXXXXXXXXXXXKAIVEQNTENGYNNLQR--DHLFP----AR 495
           +K                              I E + +N + + Q   D L      A 
Sbjct: 142 LKI-----------------------------ICEDHKQNSFTHHQSIDDSLHANAAEAE 172

Query: 494 ANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDL 315
           A+  +    P+ FKC +S  +MYDPV+I+SG TFERM IQ+WFD G+++CP +   L D 
Sbjct: 173 ASEEHNGTLPEKFKCTLSRTVMYDPVIISSGNTFERMQIQKWFDEGNDSCPISKRKLDDF 232

Query: 314 TITPNNLLKGLILKWCAEQGVACSDP 237
           T+ PN  LK  I +WCA+ G+   DP
Sbjct: 233 TLKPNVELKSQISEWCAKNGLDVQDP 258



>gb:OSJN00051_1693915 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K20, complete
           sequence.>gb:OSJN00261_1697563 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0076N16, complete
           sequence.
          Length = 800

 Score =  103 bits (258), Expect = 3e-21
 Identities = 49/104 (47%), Positives = 68/104 (65%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           P+PP+  +CPIS +LM+DPV+IASG+T+ER  I++WF +G+ TCPKT   L  L++TPN 
Sbjct: 277 PLPPEELRCPISLQLMHDPVIIASGQTYERACIEKWFSSGNTTCPKTRNELSQLSMTPNY 336

Query: 296 LLKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLNS 165
            +KGLI  WC + GV        +  A P S +     I+SLNS
Sbjct: 337 CIKGLIASWCEQNGV-------LVPSAPPDSPKLKYLRISSLNS 373



>gb:AY224536_1590733 Oryza sativa (japonica cultivar-group) isolate
           23274 arm repeat protein mRNA, complete
           cds.>gb:AP003230_1825753 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0031D02.
          Length = 680

 Score =  100 bits (249), Expect = 3e-20
 Identities = 44/76 (57%), Positives = 55/76 (72%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           P+PP  F+CPIS  LM DPVV+ASG+T++R  I RWF +G +TCPKTG+ L +L +  N 
Sbjct: 272 PVPPSDFRCPISLDLMRDPVVVASGQTYDRESIDRWFSSGKSTCPKTGQVLANLELVSNK 331

Query: 296 LLKGLILKWCAEQGVA 249
            LK LI KWC E GVA
Sbjct: 332 ALKNLISKWCRENGVA 347



>gb:AP002842_1823069 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0075G19.
          Length = 604

 Score =  100 bits (248), Expect = 4e-20
 Identities = 46/89 (51%), Positives = 62/89 (69%), Gaps = 1/89 (1%)
 Frame = -3

Query: 515 DHLFPARANILNR-PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPK 339
           D L    A+I +R PI PD F+CPIS  LM DPV+++SG+T+ER  IQ+W D+GH TCPK
Sbjct: 212 DALTTRSASIKHRSPIIPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPK 271

Query: 338 TGETLPDLTITPNNLLKGLILKWCAEQGV 252
           T + L   ++TPN +LK LI +WC   G+
Sbjct: 272 TQQPLSHTSLTPNFVLKSLISQWCEANGI 300



>gb:AP002842_1823068 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0075G19.
          Length = 611

 Score =  100 bits (248), Expect = 4e-20
 Identities = 46/89 (51%), Positives = 62/89 (69%), Gaps = 1/89 (1%)
 Frame = -3

Query: 515 DHLFPARANILNR-PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPK 339
           D L    A+I +R PI PD F+CPIS  LM DPV+++SG+T+ER  IQ+W D+GH TCPK
Sbjct: 212 DALTTRSASIKHRSPIIPDEFRCPISLELMQDPVIVSSGQTYERSCIQKWLDSGHKTCPK 271

Query: 338 TGETLPDLTITPNNLLKGLILKWCAEQGV 252
           T + L   ++TPN +LK LI +WC   G+
Sbjct: 272 TQQPLSHTSLTPNFVLKSLISQWCEANGI 300



>gb:AP003791_1833380 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1065G12.
          Length = 826

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 41/81 (50%), Positives = 58/81 (71%)
 Frame = -3

Query: 482 NRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITP 303
           N  IPP+  +CPIS +LMYDPV+I+SG+T+ER+ I++WF+ GH+TCPKT + L  L++TP
Sbjct: 305 NMSIPPEELRCPISLQLMYDPVIISSGQTYERVCIEKWFNDGHSTCPKTQQQLSHLSLTP 364

Query: 302 NNLLKGLILKWCAEQGVACSD 240
           N  +K LI  WC +      D
Sbjct: 365 NYCVKALIASWCEQNDFPVPD 385



 Score = 35.8 bits (81), Expect = 1.00
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 7/63 (11%)
 Frame = -3

Query: 806 FSLEPSEEEAAKVVKELLFQCTK-------SELESVQVAMWRLNITSPNALLMEKRCIKT 648
           F+L+ SE+EA   V  LL +  K        ELE   +A  +L ITS  A L E+R +K 
Sbjct: 144 FTLDQSEKEAGDEVINLLQRNRKMNSSSDSGELEVFHMAALKLGITSSRAALTERRALKK 203

Query: 647 LLD 639
           L++
Sbjct: 204 LIE 206



>gb:AP003313_1827861 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0035F12.
          Length = 800

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 41/81 (50%), Positives = 58/81 (71%)
 Frame = -3

Query: 482 NRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITP 303
           N  IPP+  +CPIS +LMYDPV+I+SG+T+ER+ I++WF+ GH+TCPKT + L  L++TP
Sbjct: 289 NMSIPPEELRCPISLQLMYDPVIISSGQTYERVCIEKWFNDGHSTCPKTQQQLSHLSLTP 348

Query: 302 NNLLKGLILKWCAEQGVACSD 240
           N  +K LI  WC +      D
Sbjct: 349 NYCVKALIASWCEQNDFPVPD 369



 Score = 35.8 bits (81), Expect = 1.00
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 7/63 (11%)
 Frame = -3

Query: 806 FSLEPSEEEAAKVVKELLFQCTK-------SELESVQVAMWRLNITSPNALLMEKRCIKT 648
           F+L+ SE+EA   V  LL +  K        ELE   +A  +L ITS  A L E+R +K 
Sbjct: 128 FTLDQSEKEAGDEVINLLQRNRKMNSSSDSGELEVFHMAALKLGITSSRAALTERRALKK 187

Query: 647 LLD 639
           L++
Sbjct: 188 LIE 190



>gb:AC144737_1744131 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0018K15, complete sequence.
          Length = 677

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 44/76 (57%), Positives = 54/76 (71%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           P PP  F+CPIS  LM DPVV ASG+T++R  I RWF +G +TCPKTG+ L +L + PN 
Sbjct: 273 PSPPPDFRCPISLDLMRDPVVSASGQTYDRESITRWFGSGKSTCPKTGQVLANLELVPNK 332

Query: 296 LLKGLILKWCAEQGVA 249
            LK LI +WC E GVA
Sbjct: 333 ALKNLISRWCRENGVA 348



>gb:AY224537_1590734 Oryza sativa (japonica cultivar-group) isolate
           23275 arm repeat protein mRNA, complete
           cds.>gb:AC144743_1744255 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0009H09, complete
           sequence.
          Length = 684

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 44/76 (57%), Positives = 54/76 (71%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           P PP  F+CPIS  LM DPVV ASG+T++R  I RWF +G +TCPKTG+ L +L + PN 
Sbjct: 273 PSPPPDFRCPISLDLMRDPVVSASGQTYDRESITRWFGSGKSTCPKTGQVLANLELVPNK 332

Query: 296 LLKGLILKWCAEQGVA 249
            LK LI +WC E GVA
Sbjct: 333 ALKNLISRWCRENGVA 348



>gb:AP005319_1850521 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0643A10.
          Length = 637

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 39/72 (54%), Positives = 57/72 (79%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F+CPIS  LM DPV++++G+T+ER +IQRW D G+ TCPKT   L ++T+TPN +L+
Sbjct: 263 PEDFRCPISLELMRDPVIVSTGQTYERAFIQRWIDCGNRTCPKTQLKLQNITLTPNYVLR 322

Query: 287 GLILKWCAEQGV 252
            LIL+WC E+G+
Sbjct: 323 SLILQWCEEKGI 334



>gb:AY065279_1566429 Arabidopsis thaliana unknown protein
           (At3g54850) mRNA, complete cds.>gb:AY096530_1576072
           Arabidopsis thaliana unknown protein (At3g54850) mRNA,
           complete cds.
          Length = 632

 Score = 96.3 bits (238), Expect = 6e-19
 Identities = 40/75 (53%), Positives = 54/75 (72%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           P+ P+ F+CPIS  LM DPV++++G+T+ER  IQ+W DAGH TCPK+ ETL    +TPN 
Sbjct: 246 PVIPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNY 305

Query: 296 LLKGLILKWCAEQGV 252
           +LK LI  WC   G+
Sbjct: 306 VLKSLIALWCESNGI 320



>gb:AY035038_1559816 Arabidopsis thaliana unknown protein
           (At2g28830) mRNA, complete cds.
          Length = 654

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 45/97 (46%), Positives = 64/97 (65%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           IPP+ F+CPIS  LM DPV+++SG+T+ER  I++W + GH TCPKT ETL    +TPN +
Sbjct: 255 IPPEEFRCPISLELMTDPVIVSSGQTYERECIKKWLEGGHLTCPKTQETLTSDIMTPNYV 314

Query: 293 LKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSAS 183
           L+ LI +WC   G+   +P      + P S  +SS+S
Sbjct: 315 LRSLIAQWCESNGI---EPPKRPNISQPSSKASSSSS 348



>pir|D84689|D84689 hypothetical protein At2g28830 [imported] -
           Arabidopsis thaliana>gb:AC005727_1532973 Arabidopsis
           thaliana chromosome 2 clone F8N16 map mi54, complete
           sequence.
          Length = 654

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 45/97 (46%), Positives = 64/97 (65%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           IPP+ F+CPIS  LM DPV+++SG+T+ER  I++W + GH TCPKT ETL    +TPN +
Sbjct: 255 IPPEEFRCPISLELMTDPVIVSSGQTYERECIKKWLEGGHLTCPKTQETLTSDIMTPNYV 314

Query: 293 LKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSAS 183
           L+ LI +WC   G+   +P      + P S  +SS+S
Sbjct: 315 LRSLIAQWCESNGI---EPPKRPNISQPSSKASSSSS 348



>pir|T45588|T45588 arm repeat containing protein homolog -
           Arabidopsis thaliana>gb:ATF12A12_1548292 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           F12A12.>gb:AY042791_1560856 Arabidopsis thaliana arm
           repeat containing protein homolog (F12A12.30) mRNA,
           complete cds.>gb:AY128813_1580893 Arabidopsis thaliana
           arm repeat containing protein homolog (At3g46510) mRNA,
           complete cds.
          Length = 660

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 37/84 (44%), Positives = 57/84 (67%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           P+ PD F+CPIS  +M DPV+++SG+T+ER  I++W + GH+TCPKT + L   T+TPN 
Sbjct: 254 PVIPDDFRCPISLEMMRDPVIVSSGQTYERTCIEKWIEGGHSTCPKTQQALTSTTLTPNY 313

Query: 296 LLKGLILKWCAEQGVACSDPTTCI 225
           +L+ LI +WC    +    P + +
Sbjct: 314 VLRSLIAQWCEANDIEPPKPPSSL 337



>gb:BT002518_1636121 Arabidopsis thaliana unknown protein
           (At1g23030) mRNA, complete cds.
          Length = 612

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 40/74 (54%), Positives = 55/74 (74%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           IP D F CP+S  LM DPV++A+G+T+ER +IQRW D G+ TCPKT + L + T+TPN +
Sbjct: 241 IPVD-FLCPVSLELMKDPVIVATGQTYERAYIQRWIDCGNLTCPKTQQKLENFTLTPNYV 299

Query: 293 LKGLILKWCAEQGV 252
           L+ LI +WCAE  +
Sbjct: 300 LRSLISRWCAEHNI 313



>pir|D86364|D86364 hypothetical protein F10G19.3 - Arabidopsis
           thaliana>gb:AE005172_891253 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATAF000657_1543808 Arabidopsis thaliana BAC
           F19G10, complete sequence.
          Length = 618

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 40/74 (54%), Positives = 55/74 (74%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           IP D F CP+S  LM DPV++A+G+T+ER +IQRW D G+ TCPKT + L + T+TPN +
Sbjct: 247 IPVD-FLCPVSLELMKDPVIVATGQTYERAYIQRWIDCGNLTCPKTQQKLENFTLTPNYV 305

Query: 293 LKGLILKWCAEQGV 252
           L+ LI +WCAE  +
Sbjct: 306 LRSLISRWCAEHNI 319



>gb:AX250427_1464811 Sequence 33 from Patent
           WO0168863.>gb:ATAC009853_1543043 Arabidopsis thaliana
           chromosome III BAC F21O3 genomic sequence, complete
           sequence.>gb:AY075636_1567777 Arabidopsis thaliana
           AT3g07360/F21O3_7 mRNA, complete cds.
          Length = 460

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 35/72 (48%), Positives = 56/72 (77%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F+CP+S+ LM DPVV+ASG+T+++++IQ+W  +G+ TCPKT + LP   +TPN L++
Sbjct: 75  PEEFRCPLSNELMRDPVVLASGQTYDKLFIQKWLSSGNRTCPKTQQVLPHTALTPNLLIR 134

Query: 287 GLILKWCAEQGV 252
            +I KWC + G+
Sbjct: 135 EMISKWCKKNGL 146



>gb:AP004837_1845739 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0483C08.>gb:AP005322_1850625 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0677G01.
          Length = 467

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 37/75 (49%), Positives = 55/75 (73%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F CPISS +M DPVV+ASG+T++R +IQ W  AG+ TCP+T + L +  + PN+L++
Sbjct: 84  PEQFLCPISSEIMRDPVVLASGQTYDRRFIQEWLSAGNRTCPQTQQVLSNTILIPNHLVR 143

Query: 287 GLILKWCAEQGVACS 243
            +I +WC E G+A S
Sbjct: 144 SMIAQWCTENGIALS 158



>gb:AY064045_1565983 Arabidopsis thaliana putative arm
           repeat-containing protein (At1g29340) mRNA, complete
           cds.
          Length = 729

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 46/110 (41%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  LM DPV+I++G+T++R  I RW + GH TCPKTG+ L D  I PN  LK
Sbjct: 306 PKDFVCPISLDLMTDPVIISTGQTYDRNSIARWIEEGHCTCPKTGQMLMDSRIVPNRALK 365

Query: 287 GLILKWCAEQGVA-----CSDPTTCIYDAVP--HSWEASSASIASLNSYM 159
            LI++WC   G++        P      A+P   + EA+ A+++ L  Y+
Sbjct: 366 NLIVQWCTASGISYESEFTDSPNESFASALPTKAAVEANKATVSILIKYL 415



>pir|A86416|A86416 probable arm repeat-containing protein -
           Arabidopsis thaliana>gb:AE005172_891785 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC068667_1540437 Arabidopsis thaliana
           chromosome 1 BAC F15D2 genomic sequence, complete
           sequence.>gb:AY150512_1585077 Arabidopsis thaliana
           putative arm repeat-containing protein (At1g29340) mRNA,
           complete cds.
          Length = 729

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 46/110 (41%), Positives = 65/110 (59%), Gaps = 7/110 (6%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  LM DPV+I++G+T++R  I RW + GH TCPKTG+ L D  I PN  LK
Sbjct: 306 PKDFVCPISLDLMTDPVIISTGQTYDRNSIARWIEEGHCTCPKTGQMLMDSRIVPNRALK 365

Query: 287 GLILKWCAEQGVA-----CSDPTTCIYDAVP--HSWEASSASIASLNSYM 159
            LI++WC   G++        P      A+P   + EA+ A+++ L  Y+
Sbjct: 366 NLIVQWCTASGISYESEFTDSPNESFASALPTKAAVEANKATVSILIKYL 415



>gb:AB016888_1513158 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDH9.
          Length = 656

 Score = 89.7 bits (221), Expect = 6e-17
 Identities = 38/69 (55%), Positives = 51/69 (73%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           I P  F CPI+  +M DPV+IA+G+T+E+  IQ+WFDAGH TCPKT + L  L++ PN  
Sbjct: 285 ILPHEFLCPITLEIMLDPVIIATGQTYEKESIQKWFDAGHKTCPKTRQELDHLSLAPNFA 344

Query: 293 LKGLILKWC 267
           LK LI++WC
Sbjct: 345 LKNLIMQWC 353



>gb:AY219234_1590356 Nicotiana tabacum arm repeat-containing protein
           mRNA, complete cds.
          Length = 790

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 41/80 (51%), Positives = 51/80 (63%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           PIPPD F CP+S  LM DPV++ASG+T+ER +I+RW D G   CPKT +TL    + PN 
Sbjct: 235 PIPPD-FCCPLSLELMTDPVIVASGQTYERAFIRRWIDLGLTVCPKTRQTLGHTNLIPNY 293

Query: 296 LLKGLILKWCAEQGVACSDP 237
            +K LI  WC    V   DP
Sbjct: 294 TVKALIANWCEINNVKLPDP 313



>pir|T06735|T06735 hypothetical protein F28P10.170 - Arabidopsis
           thaliana>gb:ATF28P10_1550411 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F28P10.
          Length = 639

 Score = 89.4 bits (220), Expect = 8e-17
 Identities = 40/82 (48%), Positives = 54/82 (65%), Gaps = 7/82 (8%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGE-------TFERMWIQRWFDAGHNTCPKTGETLPD 318
           P+ P+ F+CPIS  LM DPV++++G+       T+ER  IQ+W DAGH TCPK+ ETL  
Sbjct: 246 PVIPEYFRCPISLELMKDPVIVSTGQLNFSTLQTYERSSIQKWLDAGHKTCPKSQETLLH 305

Query: 317 LTITPNNLLKGLILKWCAEQGV 252
             +TPN +LK LI  WC   G+
Sbjct: 306 AGLTPNYVLKSLIALWCESNGI 327



>gb:AK175585_1817573 Arabidopsis thaliana mRNA for arm repeat
           containing protein, complete cds, clone: RAFL22-04-A03.
          Length = 660

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 38/69 (55%), Positives = 51/69 (73%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           I P  F CPI+  +M DPV+IA+G+T+E+  IQ+WFDAGH TCPKT + L  L++ PN  
Sbjct: 289 ILPHEFLCPITLGIMLDPVIIATGQTYEKESIQKWFDAGHKTCPKTRQELDHLSLAPNFA 348

Query: 293 LKGLILKWC 267
           LK LI++WC
Sbjct: 349 LKNLIMQWC 357



>gb:AP003561_1830808 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1065E10.
          Length = 796

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 42/119 (35%), Positives = 65/119 (54%)
 Frame = -3

Query: 530 NNLQRDHLFPARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHN 351
           N++   H+   +   +N    P  F CP+S  LM DPV++ASG+T+E ++I++WFD G+N
Sbjct: 204 NHMLDKHVEEKQTRSINGVTIPADFCCPLSLELMSDPVIVASGQTYEHVFIRKWFDLGYN 263

Query: 350 TCPKTGETLPDLTITPNNLLKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIAS 174
            CPKT + L    + PN  +K LI  WC   G+   DP   +    P S   +  S ++
Sbjct: 264 ICPKTRQILGHTKLIPNFTVKQLIENWCEVHGIMLPDPVKLLSLCFPVSLNITDGSASA 322



>pir|T48204|T48204 hypothetical protein T20L15.100 - Arabidopsis
           thaliana>gb:ATT20L15_1555036 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T20L15 (ESSA
           project).>gb:BT015367_1642195 Arabidopsis thaliana
           At5g01830 gene, complete cds.>gb:BT015725_1642343
           Arabidopsis thaliana At5g01830 gene, complete cds.
          Length = 674

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 39/85 (45%), Positives = 56/85 (65%)
 Frame = -3

Query: 506 FPARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGET 327
           F    ++ +  IP D F+CPI+  LM DPVV+A+G+T++R  I  W  +GHNTCPKTG+ 
Sbjct: 263 FRRHQSLSDANIPAD-FRCPITLELMRDPVVVATGQTYDRESIDLWIQSGHNTCPKTGQV 321

Query: 326 LPDLTITPNNLLKGLILKWCAEQGV 252
           L   ++ PN  LK LI+ WC +Q +
Sbjct: 322 LKHTSLVPNRALKNLIVLWCRDQKI 346



>gb:BT015818_1642436 Arabidopsis thaliana At5g67340 gene, complete
           cds.>gb:BT020206_1642601 Arabidopsis thaliana At5g67340
           mRNA, complete cds.
          Length = 707

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 37/86 (43%), Positives = 53/86 (61%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+C +S  LM DPV++ASG+TFER++IQ+W D G   CPKT + L   T+TPN +++
Sbjct: 241 PSDFRCSLSLELMTDPVIVASGQTFERVFIQKWIDMGLMVCPKTRQALSHTTLTPNFIVR 300

Query: 287 GLILKWCAEQGVACSDPTTCIYDAVP 210
             +  WC    V   DP   I+ + P
Sbjct: 301 AFLASWCETNNVYPPDPLELIHSSEP 326



>gb:AY652589_1620174 Oryza sativa (japonica cultivar-group) cell
           death-related protein SPL11 (Spl11) mRNA, complete
           cds.>gb:AY652590_1620175 Oryza sativa (japonica
           cultivar-group) cell death-related protein SPL11 (Spl11)
           gene, complete cds.
          Length = 694

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 42/107 (39%), Positives = 65/107 (60%), Gaps = 1/107 (0%)
 Frame = -3

Query: 482 NRPIP-PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTIT 306
           +RPI  PD F+CPIS  LM DPV++++G+T+ER  I++W  +GH+TCP T + +    +T
Sbjct: 268 SRPITIPDEFRCPISLELMKDPVIVSTGQTYERACIEKWIASGHHTCPTTQQKMSTSALT 327

Query: 305 PNNLLKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLNS 165
           PN +L+ LI +WC   G+     +T      P    +  A+I +L S
Sbjct: 328 PNYVLRSLISQWCETNGMEPPKRSTQPNKPTPACSSSERANIDALLS 374



>gb:AB007645_1510150 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K8K14.
          Length = 698

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 37/86 (43%), Positives = 53/86 (61%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+C +S  LM DPV++ASG+TFER++IQ+W D G   CPKT + L   T+TPN +++
Sbjct: 237 PSDFRCSLSLELMTDPVIVASGQTFERVFIQKWIDMGLMVCPKTRQALSHTTLTPNFIVR 296

Query: 287 GLILKWCAEQGVACSDPTTCIYDAVP 210
             +  WC    V   DP   I+ + P
Sbjct: 297 AFLASWCETNNVYPPDPLELIHSSEP 322



>gb:AC008148_1536565 Arabidopsis thaliana chromosome I BAC F15H11
           genomic sequence, complete sequence.
          Length = 530

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 37/77 (48%), Positives = 54/77 (70%)
 Frame = -3

Query: 482 NRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITP 303
           N  IP D F CPIS  LM DP ++++G+T+ER +IQRW D G+ +CPKT + L + T+TP
Sbjct: 142 NLTIPED-FLCPISLELMKDPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKLENFTLTP 200

Query: 302 NNLLKGLILKWCAEQGV 252
           N +L+ LI +WC +  +
Sbjct: 201 NYVLRSLISQWCTKHNI 217



>pir|E96734|E96734 unknown protein F23N20.1 [imported] - Arabidopsis
           thaliana>gb:AE005173_894679 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016972_1538284 Arabidopsis thaliana
           chromosome 1 BAC F23N20 genomic sequence, complete
           sequence.>gb:AY075626_1567770 Arabidopsis thaliana
           At1g71020/F23N20_1 mRNA, complete
           cds.>gb:AY142062_1582899 Arabidopsis thaliana
           At1g71020/F23N20_1 mRNA, complete cds.
          Length = 628

 Score = 86.7 bits (213), Expect = 5e-16
 Identities = 37/77 (48%), Positives = 54/77 (70%)
 Frame = -3

Query: 482 NRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITP 303
           N  IP D F CPIS  LM DP ++++G+T+ER +IQRW D G+ +CPKT + L + T+TP
Sbjct: 240 NLTIPED-FLCPISLELMKDPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKLENFTLTP 298

Query: 302 NNLLKGLILKWCAEQGV 252
           N +L+ LI +WC +  +
Sbjct: 299 NYVLRSLISQWCTKHNI 315



>gb:AP004584_1841875 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0007D08.
          Length = 824

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 42/99 (42%), Positives = 55/99 (55%), Gaps = 2/99 (2%)
 Frame = -3

Query: 527 NLQRDHLFPARA--NILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGH 354
           N   DHL       +I   PIP D F CP+S  LM DPV++ASG+T+ER++I+ W D G 
Sbjct: 209 NYMHDHLLRETQLLSINGVPIPAD-FCCPLSLELMSDPVIVASGQTYERVYIKLWLDEGF 267

Query: 353 NTCPKTGETLPDLTITPNNLLKGLILKWCAEQGVACSDP 237
             CPKT + L    + PN  +K LI  WC    +   DP
Sbjct: 268 TICPKTRQRLGHSNLIPNYTVKALIANWCESHNIRLPDP 306



>gb:AP005391_1850946 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBb0092C08.
          Length = 642

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 35/72 (48%), Positives = 51/72 (70%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F CPI+  +M DPV++A+G+T+ER  IQ+W D+G  TCPKT + L  +++ PN  LK
Sbjct: 270 PNDFLCPITLAIMRDPVIVATGQTYERRSIQKWLDSGERTCPKTRQRLSHMSLAPNYALK 329

Query: 287 GLILKWCAEQGV 252
            LIL+WC +  V
Sbjct: 330 NLILEWCDKNKV 341



>gb:AY220483_1590517 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
           protein 276 (ACRE276) mRNA, complete cds.
          Length = 726

 Score = 82.4 bits (202), Expect = 9e-15
 Identities = 34/68 (50%), Positives = 47/68 (69%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  LM DPV++++G+T++R  I RW + GH TCPKTG+ L    + PN  L+
Sbjct: 300 PKDFCCPISLDLMRDPVIVSTGQTYDRASISRWMEEGHCTCPKTGQLLDHTRLVPNRALR 359

Query: 287 GLILKWCA 264
            LI++WCA
Sbjct: 360 NLIMQWCA 367



>gb:AP004030_1836607 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1145_E05.
          Length = 728

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 35/77 (45%), Positives = 49/77 (63%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  LM DPVV ++G+T++R  I +W + GH+TCP +G+TL D  + PN  L+
Sbjct: 298 PKEFSCPISLDLMRDPVVASTGQTYDRPSIIQWIEEGHSTCPNSGQTLADHRLVPNRALR 357

Query: 287 GLILKWCAEQGVACSDP 237
            LI +WC   G+    P
Sbjct: 358 SLISQWCGVYGLQYDSP 374



>pir|T00518|T00518 hypothetical protein At2g23140 [imported] -
           Arabidopsis thaliana>gb:AC002391_1530644 Arabidopsis
           thaliana chromosome 2 clone T20D16 map CIC06C07,
           complete sequence.>gb:AC004401_1531662 Arabidopsis
           thaliana chromosome 2 clone F21P24 map CIC06C07,
           complete sequence.
          Length = 924

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 34/74 (45%), Positives = 47/74 (63%)
 Frame = -3

Query: 458 FKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLI 279
           F CP+S  +M DPV+++SG+T+E+ +I+RW D G   CPKT +TL   T+ PN  +K LI
Sbjct: 313 FFCPLSLEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALI 372

Query: 278 LKWCAEQGVACSDP 237
             WC    V   DP
Sbjct: 373 ANWCETNDVKLPDP 386



>gb:AP004667_1842961 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0433E10.
          Length = 690

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 41/114 (35%), Positives = 65/114 (57%), Gaps = 3/114 (2%)
 Frame = -3

Query: 503 PARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETL 324
           P  A+ L R I P+  +CPI+  LM DPV +A+G+T++R  I+RW  +G  TCP TGE L
Sbjct: 273 PRAASYLAR-INPEGLQCPITLELMTDPVTLATGQTYDRASIKRWVKSGCRTCPVTGEKL 331

Query: 323 PDLTITPNNLLKGLILKWCAEQGVACSDPTT---CIYDAVPHSWEASSASIASL 171
               + PN  ++G++ +     GV+  +P++   C  D     + A++A  A L
Sbjct: 332 RSADVVPNVAVRGIVEQLLLSSGVSLHEPSSKHRCAVDKTASPFGAAAAGGARL 385



>gb:AY084697_1569784 Arabidopsis thaliana clone 115372 mRNA,
           complete sequence.
          Length = 448

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 35/72 (48%), Positives = 47/72 (65%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P VF CPIS   M DPV + +G+T+ER+ I +WF+ GH TCP T + L D T+TPN  L 
Sbjct: 65  PSVFICPISLEPMQDPVTLCTGQTYERLNIHKWFNLGHLTCPTTMQELWDDTVTPNKTLH 124

Query: 287 GLILKWCAEQGV 252
            LI  W +++ V
Sbjct: 125 HLIYTWFSQKYV 136



>pir|T46047|T46047 hypothetical protein T16K5.160 - Arabidopsis
           thaliana>gb:ATT16K5_1554594 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T16K5.
          Length = 480

 Score = 76.3 bits (186), Expect = 7e-13
 Identities = 35/72 (48%), Positives = 47/72 (65%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P VF CPIS   M DPV + +G+T+ER+ I +WF+ GH TCP T + L D T+TPN  L 
Sbjct: 65  PSVFICPISLEPMQDPVTLCTGQTYERLNIHKWFNLGHLTCPTTMQELWDDTVTPNKTLH 124

Query: 287 GLILKWCAEQGV 252
            LI  W +++ V
Sbjct: 125 HLIYTWFSQKYV 136



>gb:AY087421_1572452 Arabidopsis thaliana clone 35218 mRNA, complete
           sequence.
          Length = 431

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 32/67 (47%), Positives = 45/67 (67%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CPIS  LM DPV+IASG T++R  I++WF++G+ TCP T   L  L   PN+ ++
Sbjct: 34  PSQFQCPISYELMKDPVIIASGITYDRENIEKWFESGYQTCPVTNTVLTSLEQIPNHTIR 93

Query: 287 GLILKWC 267
            +I  WC
Sbjct: 94  RMIQGWC 100



>pir|D96686|D96686 unknown protein F15E12.6 [imported] - Arabidopsis
           thaliana>gb:AE005173_894264 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC026480_1539649 Arabidopsis thaliana
           chromosome 1 BAC F15E12 genomic sequence, complete
           sequence.>gb:AY034913_1559698 Arabidopsis thaliana
           unknown protein (At1g66160) mRNA, complete
           cds.>gb:AY063104_1565679 Arabidopsis thaliana unknown
           protein (At1g66160) mRNA, complete cds.
          Length = 431

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 32/67 (47%), Positives = 45/67 (67%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CPIS  LM DPV+IASG T++R  I++WF++G+ TCP T   L  L   PN+ ++
Sbjct: 34  PSQFQCPISYELMKDPVIIASGITYDRENIEKWFESGYQTCPVTNTVLTSLEQIPNHTIR 93

Query: 287 GLILKWC 267
            +I  WC
Sbjct: 94  RMIQGWC 100



>gb:OSJN00182_1696311 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0086O06, complete sequence.
          Length = 421

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 40/96 (41%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRW-FDAGHNTCPKTGETLPDLTITPNNL 294
           PP +F CPIS  LM DPV +A+G T++R  I+RW F  G  TCP T + L     TPN+ 
Sbjct: 5   PPPLFLCPISMELMEDPVTVATGVTYDRRSIERWFFKYGKTTCPATMQRLASFDFTPNHT 64

Query: 293 LKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSA 186
           LK +I  W  ++  + S P+T    A   S  +S+A
Sbjct: 65  LKRVISSW-LDRASSSSSPSTAGSPATTSSSSSSNA 99



>gb:AP003876_1834695 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1119_D01.
          Length = 361

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 42/100 (42%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETL-PDLTITPNNLL 291
           PD F+CPIS  +M DPV++ SG TFER  IQRW D GH TCP T   L P   + PN+ L
Sbjct: 12  PDDFRCPISLEVMTDPVILPSGHTFERRSIQRWLDGGHLTCPVTNLPLPPSPPLIPNHAL 71

Query: 290 KGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASL 171
           + LI         A + PT           E ++A+I+S+
Sbjct: 72  RRLIA--AVSPVAAAAVPTAAAGGGGGERREPAAAAISSV 109



>gb:BT020311_1642706 Arabidopsis thaliana At5g37490 gene, complete
           cds.>gb:BT020439_1642834 Arabidopsis thaliana At5g37490
           mRNA, complete cds.
          Length = 435

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 32/73 (43%), Positives = 49/73 (67%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           IPP+ F+CPIS  LM DPV+I++G T++R+ I+ W ++G+ TCP T   L      PN+ 
Sbjct: 31  IPPE-FQCPISIDLMKDPVIISTGITYDRVSIETWINSGNKTCPVTNTVLTTFDQIPNHT 89

Query: 293 LKGLILKWCAEQG 255
           ++ +I  WC E+G
Sbjct: 90  IRKMIQGWCVEKG 102



>gb:AY062476_1565132 Arabidopsis thaliana Unknown protein
           (At5g65920; K14B20.9) mRNA, complete
           cds.>gb:AY093259_1575213 Arabidopsis thaliana unknown
           protein (At5g65920) mRNA, complete cds.
          Length = 444

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 36/78 (46%), Positives = 47/78 (60%)
 Frame = -3

Query: 485 LNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTIT 306
           L  P  P VF CPIS   M DPV + +G+T+ER  I +WF+ GH TCP T + L D  +T
Sbjct: 55  LELPEIPSVFICPISLEPMQDPVTLCTGQTYERSNILKWFNIGHCTCPTTMQELWDDLVT 114

Query: 305 PNNLLKGLILKWCAEQGV 252
           PN  L  LI  W +++ V
Sbjct: 115 PNKTLHQLIYTWFSQKYV 132



>gb:AB018108_1513731 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K14B20.
          Length = 444

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 36/78 (46%), Positives = 47/78 (60%)
 Frame = -3

Query: 485 LNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTIT 306
           L  P  P VF CPIS   M DPV + +G+T+ER  I +WF+ GH TCP T + L D  +T
Sbjct: 55  LELPEIPSVFICPISLEPMQDPVTLCTGQTYERSNILKWFNIGHCTCPTTMQELWDDLVT 114

Query: 305 PNNLLKGLILKWCAEQGV 252
           PN  L  LI  W +++ V
Sbjct: 115 PNKTLHQLIYTWFSQKYV 132



>pir|T05882|T05882 hypothetical protein F6H11.10 - Arabidopsis
           thaliana>gb:ATF6H11_1550844 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F6H11 (ESSAII project).
          Length = 1026

 Score = 73.2 bits (178), Expect = 6e-12
 Identities = 36/78 (46%), Positives = 47/78 (60%)
 Frame = -3

Query: 485 LNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTIT 306
           L  P  P VF CPIS   M DPV + +G+T+ER  I +WF+ GH TCP T + L D  +T
Sbjct: 178 LELPEIPSVFICPISLEPMQDPVTLCTGQTYERSNILKWFNIGHCTCPTTMQELWDDLVT 237

Query: 305 PNNLLKGLILKWCAEQGV 252
           PN  L  LI  W +++ V
Sbjct: 238 PNKTLHQLIYTWFSQKYV 255



>gb:AK118613_1816581 Arabidopsis thaliana At3g54790 mRNA for unknown
           protein, complete cds, clone: RAFL19-87-C08.
          Length = 760

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 34/100 (34%), Positives = 53/100 (53%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CP+S+ LM DPV++ASG+TF+R  I++W D G   CP+T + L    + PN  +K
Sbjct: 239 PPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTVK 298

Query: 287 GLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLN 168
            +I  W     +  +  +   YD    S  A++      N
Sbjct: 299 AMIASWLEANRINLATNSCHQYDGGDASSMANNMGSQDFN 338



>gb:AB083031_1524144 Glycine max mRNA for syringolide-induced
           protein 13-1-1, complete cds.
          Length = 431

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 28/69 (40%), Positives = 45/69 (65%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F CP+S  LM DPV +++G T++R+ I++W + G+ TCP T + L    I PN+ ++
Sbjct: 30  PNHFHCPVSLELMTDPVTLSTGITYDRVSIEKWIEGGNRTCPVTNQVLTTFDIIPNHAIR 89

Query: 287 GLILKWCAE 261
            +I  WC E
Sbjct: 90  RMIQDWCVE 98



>pir|T47638|T47638 hypothetical protein T5N23.150 - Arabidopsis
           thaliana>gb:ATT5N23_1556239 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T5N23.
          Length = 727

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 34/100 (34%), Positives = 53/100 (53%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CP+S+ LM DPV++ASG+TF+R  I++W D G   CP+T + L    + PN  +K
Sbjct: 203 PPYFRCPLSTELMLDPVIVASGQTFDRTSIKKWLDNGLAVCPRTRQVLTHQELIPNYTVK 262

Query: 287 GLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLN 168
            +I  W     +  +  +   YD    S  A++      N
Sbjct: 263 AMIASWLEANRINLATNSCHQYDGGDASSMANNMGSQDFN 302



>gb:AK118346_1816329 Arabidopsis thaliana At1g49780 mRNA for unknown
           protein, complete cds, clone: RAFL19-61-K21.
          Length = 421

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 32/67 (47%), Positives = 43/67 (64%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CPIS  LM DPV I++G+T++R  I  W   G+ TCP T   L D T+ PN+ L+
Sbjct: 15  PYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTRVALSDFTLIPNHTLR 74

Query: 287 GLILKWC 267
            LI +WC
Sbjct: 75  RLIQEWC 81



>pir|E96534|E96534 Hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005173_892909 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC011807_1537443 Arabidopsis thaliana
           chromosome I BAC F14J22 genomic sequence, complete
           sequence.
          Length = 421

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 32/67 (47%), Positives = 43/67 (64%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CPIS  LM DPV I++G+T++R  I  W   G+ TCP T   L D T+ PN+ L+
Sbjct: 15  PYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTRVALSDFTLIPNHTLR 74

Query: 287 GLILKWC 267
            LI +WC
Sbjct: 75  RLIQEWC 81



>gb:AP005702_1856333 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0027G10.>gb:AP005838_1858825 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBa0041C07.
          Length = 712

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 32/74 (43%), Positives = 46/74 (62%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           I P+  +CPI+  LM DPV +++G+T++R  I RW  AG  TCP TGE L    + PN +
Sbjct: 289 IRPEALQCPITLDLMTDPVTVSTGQTYDRASITRWMKAGCRTCPVTGERLSTADLVPNTV 348

Query: 293 LKGLILKWCAEQGV 252
           L+G+I +     GV
Sbjct: 349 LRGIIERMLLINGV 362



>gb:AB025624_1516467 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLD14.>gb:AY086503_1571551 Arabidopsis
           thaliana clone 255040 mRNA, complete sequence.
          Length = 421

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHN-TCPKTGETLPDLTITPNNLL 291
           P  F+CPIS  LM DPV + +G+T++R  I+ W   G+N TCP T   L D T+ PN+ L
Sbjct: 15  PYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDFTLIPNHTL 74

Query: 290 KGLILKWC 267
           + LI +WC
Sbjct: 75  RRLIQEWC 82



>gb:AP004685_1843360 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0017G10.
          Length = 621

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 34/72 (47%), Positives = 44/72 (61%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F CPIS  +M DP       T+ER  IQ+W DAG  TCPKT + L  L++ PN  LK
Sbjct: 261 PNDFLCPISLEIMTDP-------TYERRSIQKWLDAGQRTCPKTQQPLGHLSLAPNYALK 313

Query: 287 GLILKWCAEQGV 252
            LI++WC +  V
Sbjct: 314 NLIMQWCDKNKV 325



>gb:STU306423_1723036 Solanum tuberosum subsp. andigena mRNA for
           photoperiod responsive protein (phor1 gene).
          Length = 418

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 40/107 (37%), Positives = 54/107 (50%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P +F+CPIS  +M  PV + +G T++R  IQ W   GHNTCP T + LP     PN  L+
Sbjct: 14  PSLFRCPISMDVMKSPVSLCTGVTYDRSSIQTWLSQGHNTCPATMQILPSTDFIPNLTLR 73

Query: 287 GLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLNSYMDGLS 147
            LI  W   Q  +    TT    +V  S       + +LN  +D LS
Sbjct: 74  RLINVWIQHQPSSSPGYTTPSSSSVTKSEVVE--IVKNLNGEVDRLS 118



>pir|T05177|T05177 hypothetical protein T6K22.80 - Arabidopsis
           thaliana>gb:ATCHRIV54_1545972 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 54.>gb:ATT6K22_1556400
           Arabidopsis thaliana DNA chromosome 4, BAC clone T6K22
           (ESSAII project).
          Length = 374

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 41/102 (40%), Positives = 58/102 (56%), Gaps = 1/102 (0%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLT-ITPNNLL 291
           P+ F+CPIS  +M DPV++ SG TF+R+ IQ+W D+G+ TCP T   L +   + PN+ L
Sbjct: 6   PNDFRCPISLEIMSDPVILQSGHTFDRVSIQQWIDSGNRTCPITKLPLSETPYLIPNHAL 65

Query: 290 KGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLNS 165
           + LIL +        S P T       HS   S A I++L S
Sbjct: 66  RSLILNFAHVSLKESSRPRT----QQEHSHSQSQALISTLVS 103



>pir|T08872|T08872 hypothetical protein ARC1 -
           rape>gb:AF024625_1762131 Brassica napus arm repeat
           containing protein (ARC1) mRNA, complete cds.
          Length = 661

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 36/86 (41%), Positives = 49/86 (56%), Gaps = 1/86 (1%)
 Frame = -3

Query: 491 NILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWF-DAGHNTCPKTGETLPDL 315
           N     +P D F C IS  LM DPV+I++G+T++R  I RW    G +TCPKTG+ L DL
Sbjct: 274 NTFTTTLPKD-FICSISLNLMNDPVIISTGQTYDRTSIARWIHQEGRSTCPKTGQKLVDL 332

Query: 314 TITPNNLLKGLILKWCAEQGVACSDP 237
           +   N  L+ L   WC   G++   P
Sbjct: 333 SFVSNLALRHLTTLWCEVTGLSHDSP 358



>gb:OSJN00024_1693489 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0006B20, complete sequence.
          Length = 426

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 1/67 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLT-ITPNNLL 291
           P +F+CPIS  +  DPV + +G+T++R  I+RW  AGH TCP T + L D T + PN  L
Sbjct: 4   PHLFRCPISLDIFTDPVTLCTGQTYDRPCIERWLAAGHRTCPVTMQPLGDATALVPNRTL 63

Query: 290 KGLILKW 270
           + LI +W
Sbjct: 64  RHLIERW 70



>gb:AP004096_1837683 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1743_B12.
          Length = 425

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 40/112 (35%), Positives = 59/112 (52%), Gaps = 1/112 (0%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRW-FDAGHNTCPKTGETLPDLTITPNNL 294
           PP +F CPIS  LM DPV +++G T++R  I+ W F  G  TCP T + L +  +TPN+ 
Sbjct: 7   PPQLFLCPISMELMEDPVTVSTGVTYDRRSIEEWLFVYGRTTCPATMQPLSNFDLTPNHT 66

Query: 293 LKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLNSYMDGLSLPI 138
           LK +I  W                D    S  +SS S ++L+S +  L+ P+
Sbjct: 67  LKRVISSW---------------LDRGSSSSSSSSPSTSTLSSPIHELATPL 103



>gb:OSJN00062_1694156 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0108J11, complete sequence.
          Length = 451

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 31/76 (40%), Positives = 42/76 (55%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CPIS  +M  PV + +G T++R  IQRW D+G+ TCP T   LP   + PN  L+
Sbjct: 38  PSFFRCPISLDVMRSPVSLCTGVTYDRASIQRWLDSGNTTCPATMLPLPSTDLVPNLTLR 97

Query: 287 GLILKWCAEQGVACSD 240
            LI  W +       D
Sbjct: 98  SLISHWSSSSPATSGD 113



>gb:AY220485_1590519 Nicotiana tabacum Avr9/Cf-9 rapidly elicited
           protein 74 (ACRE74) mRNA, complete cds.
          Length = 445

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 30/69 (43%), Positives = 46/69 (66%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  LM DPV +++G T++R  I++W +AG+ TCP T +TL +    PN+ ++
Sbjct: 31  PRHFTCPISLDLMKDPVTLSTGITYDRENIEKWIEAGNQTCPITNQTLRNGEPIPNHSIR 90

Query: 287 GLILKWCAE 261
            +I +WC E
Sbjct: 91  KMIQQWCVE 99



>pir|T02271|T02271 hypothetical protein T13D8.8 - Arabidopsis
           thaliana>gb:AE005173_893699 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:T13D8_1723397 Arabidopsis thaliana
           chromosome 1 BAC T13D8, complete sequence.
          Length = 686

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 32/76 (42%), Positives = 47/76 (61%)
 Frame = -3

Query: 479 RPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPN 300
           R +  D  +CPIS  +M DPVV+ SG T++R  I +WF +G+ TCPKTG+TL    +  N
Sbjct: 275 RSLNVDDLRCPISLEIMSDPVVLESGHTYDRSSITKWFASGNITCPKTGKTLVSTVLVDN 334

Query: 299 NLLKGLILKWCAEQGV 252
             +K +I  +  + GV
Sbjct: 335 FSVKQVIQSYSKQNGV 350



>gb:AF274564_1782444 Petroselinum crispum immediate-early fungal
           elicitor protein CMPG1 (CMPG1) gene, CMPG1-a allele,
           complete cds.>gb:AF274565_1782445 Petroselinum crispum
           immediate-early fungal elicitor protein CMPG1 (CMPG1)
           mRNA, complete cds.
          Length = 442

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 29/69 (42%), Positives = 45/69 (65%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F+CPIS  LM DPV +++G T++R  I+ W +AG+ TCP T + L  L   PN+ ++
Sbjct: 31  PNHFRCPISLDLMKDPVTLSTGITYDRHSIETWIEAGNKTCPITKQMLSTLEPIPNHTIR 90

Query: 287 GLILKWCAE 261
            +I  WC +
Sbjct: 91  KMIQDWCVD 99



>gb:AF274563_1782443 Petroselinum crispum immediate-early fungal
           elicitor protein CMPG1 (CMPG1) gene, partial cds.
          Length = 230

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 29/69 (42%), Positives = 45/69 (65%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F+CPIS  LM DPV +++G T++R  I+ W +AG+ TCP T + L  L   PN+ ++
Sbjct: 31  PNHFRCPISLDLMKDPVTLSTGITYDRHSIETWIEAGNKTCPITKQMLSTLEPIPNHTIR 90

Query: 287 GLILKWCAE 261
            +I  WC +
Sbjct: 91  KMIQDWCVD 99



>gb:BT005829_1638751 Arabidopsis thaliana At2g35930 gene, complete
           cds.
          Length = 411

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAG-HNTCPKTGETLPDLTITPNNLL 291
           P  F CPIS  +M DPV++++G T++R  I++W  AG  N+CP T + + D  +TPN+ L
Sbjct: 13  PPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDADLTPNHTL 72

Query: 290 KGLILKWC 267
           + LI  WC
Sbjct: 73  RRLIQSWC 80



>pir|G84774|G84774 hypothetical protein At2g35930 [imported] -
           Arabidopsis thaliana>gb:AC007017_1534960 Arabidopsis
           thaliana chromosome 2 clone F11F19 map g6825, complete
           sequence.
          Length = 406

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAG-HNTCPKTGETLPDLTITPNNLL 291
           P  F CPIS  +M DPV++++G T++R  I++W  AG  N+CP T + + D  +TPN+ L
Sbjct: 8   PPFFLCPISLEIMKDPVIVSTGITYDRDSIEKWLFAGKKNSCPVTKQDITDADLTPNHTL 67

Query: 290 KGLILKWC 267
           + LI  WC
Sbjct: 68  RRLIQSWC 75



>gb:AC103891_1737312 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1175C11, complete sequence.
          Length = 648

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 32/66 (48%), Positives = 39/66 (59%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P VF CPIS   M DPV + +G+T+E   I RW   GH TCP T + L D+T  PN  L+
Sbjct: 66  PAVFICPISLEPMVDPVTLCTGQTYESANISRWLALGHRTCPTTMQELWDVTPIPNTTLR 125

Query: 287 GLILKW 270
            LI  W
Sbjct: 126 QLIAAW 131



>gb:AC134930_1741940 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0042J17, complete sequence.
          Length = 452

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 31/66 (46%), Positives = 39/66 (59%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNN 297
           P  P  F+CPIS  +M  PV + +G T++R  IQRW D GH TCP T   L    + PN 
Sbjct: 26  PSTPAAFRCPISLEVMRSPVSLPTGATYDRASIQRWLDTGHRTCPATRLPLASTDLVPNL 85

Query: 296 LLKGLI 279
           LL+ LI
Sbjct: 86  LLRRLI 91



>gb:AP004847_1845905 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1298_H07.
          Length = 505

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 30/68 (44%), Positives = 41/68 (60%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CPIS  +M  PV + +G T++R  IQRW D+G+ TCP T   LP   + PN  L+
Sbjct: 76  PTFFRCPISLDVMRSPVSLCTGVTYDRASIQRWIDSGNTTCPATMLPLPSTDLVPNLTLR 135

Query: 287 GLILKWCA 264
            LI  W +
Sbjct: 136 RLIALWAS 143



>pir|T08454|T08454 hypothetical protein F22O6.170 - Arabidopsis
           thaliana>gb:ATF22O6_1549702 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F22O6.>gb:BT015763_1642381
           Arabidopsis thaliana At3g52450 mRNA, complete
           cds.>gb:BT020203_1642598 Arabidopsis thaliana At3g52450
           mRNA, complete cds.
          Length = 435

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 28/68 (41%), Positives = 44/68 (64%), Gaps = 1/68 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRW-FDAGHNTCPKTGETLPDLTITPNNLL 291
           P  F CPIS  +M DPV++++G T++R  I++W F    N+CP T + + +  +TPN+ L
Sbjct: 8   PSFFLCPISLDIMKDPVIVSTGITYDRESIEKWLFSGKKNSCPVTKQVITETDLTPNHTL 67

Query: 290 KGLILKWC 267
           + LI  WC
Sbjct: 68  RRLIQSWC 75



>gb:BT005359_1638299 Arabidopsis thaliana At3g18710 mRNA, complete
           cds.>gb:AK117976_1815982 Arabidopsis thaliana At3g18710
           mRNA for unknown protein, complete cds, clone:
           RAFL19-18-C09.
          Length = 415

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 31/66 (46%), Positives = 39/66 (59%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  FKCPIS  +M  PV + +G T++R  IQRW D G+NTCP T + L      PN  L+
Sbjct: 13  PSFFKCPISLDVMRSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQLLKTKDFVPNLTLQ 72

Query: 287 GLILKW 270
            LI  W
Sbjct: 73  RLINIW 78



>gb:AB026654_1517300 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MVE11.
          Length = 415

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 31/66 (46%), Positives = 39/66 (59%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  FKCPIS  +M  PV + +G T++R  IQRW D G+NTCP T + L      PN  L+
Sbjct: 13  PSFFKCPISLDVMRSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQLLKTKDFVPNLTLQ 72

Query: 287 GLILKW 270
            LI  W
Sbjct: 73  RLINIW 78



>gb:AB010076_1511008 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUB3.
          Length = 420

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 30/66 (45%), Positives = 40/66 (60%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F+CPIS  +M  PV + +G T++R  IQRW D G+NTCP T + L +    PN  L+
Sbjct: 11  PTFFRCPISLDVMKSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQILQNKDFIPNRTLQ 70

Query: 287 GLILKW 270
            LI  W
Sbjct: 71  RLIEIW 76



>gb:AP005469_1852403 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBa0040I22.>gb:AP005611_1854903 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0051E21.
          Length = 423

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 30/68 (44%), Positives = 42/68 (61%), Gaps = 1/68 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLP-DLTITPNNLL 291
           P  F+CPIS  LM DPV +++G+T++R  I+ W   G+ TCP T   L    T+ PN+ L
Sbjct: 25  PWYFRCPISLELMRDPVTVSTGQTYDRASIESWVATGNTTCPVTRSPLDRAFTLIPNHTL 84

Query: 290 KGLILKWC 267
           + LI  WC
Sbjct: 85  RRLIQDWC 92



>gb:BT005367_1638307 Arabidopsis thaliana At3g61390 mRNA, complete
           cds.>gb:AK117154_1815201 Arabidopsis thaliana At3g61390
           mRNA for unknown protein, complete cds, clone:
           RAFL16-69-L13.
          Length = 434

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 31/75 (41%), Positives = 41/75 (54%)
 Frame = -3

Query: 494 ANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDL 315
           A+  N   PP  F CPI+  +M DP V A G T+E   I RWF+ GH T P   + LP  
Sbjct: 344 ASTSNHREPPQYFICPITHDIMEDPHVAADGFTYEGEAISRWFERGHETSPMINKRLPHT 403

Query: 314 TITPNNLLKGLILKW 270
           ++ PN  L+  I +W
Sbjct: 404 SLVPNLALRSAIQEW 418



>pir|T47931|T47931 hypothetical protein T20K12.290 - Arabidopsis
           thaliana>gb:ATT20K12_1554978 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20K12.
          Length = 426

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 31/75 (41%), Positives = 41/75 (54%)
 Frame = -3

Query: 494 ANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDL 315
           A+  N   PP  F CPI+  +M DP V A G T+E   I RWF+ GH T P   + LP  
Sbjct: 336 ASTSNHREPPQYFICPITHDIMEDPHVAADGFTYEGEAISRWFERGHETSPMINKRLPHT 395

Query: 314 TITPNNLLKGLILKW 270
           ++ PN  L+  I +W
Sbjct: 396 SLVPNLALRSAIQEW 410



>pir|T49918|T49918 hypothetical protein F17I14.10 - Arabidopsis
           thaliana>gb:AB020752_1514692 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MTH16.>gb:ATF17I14_1548906 Arabidopsis thaliana
           DNA chromosome 5, BAC clone F17I14 (ESSA
           project).>gb:BT010883_1640829 Arabidopsis thaliana
           At5g09800 gene, complete cds.>gb:AK175195_1817183
           Arabidopsis thaliana mRNA for putative protein, complete
           cds, clone: RAFL21-61-C20.>gb:AK176549_1818537
           Arabidopsis thaliana mRNA for putative protein, complete
           cds, clone: RAFL25-06-O19.
          Length = 409

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 31/66 (46%), Positives = 41/66 (62%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  FKCPIS  +M  PV +++G T++R+ IQRW D G+NTCP T + L +    PN  L 
Sbjct: 12  PCFFKCPISLDVMKSPVSLSTGVTYDRVSIQRWLDDGNNTCPATMQILQNKEFVPNLTLH 71

Query: 287 GLILKW 270
            LI  W
Sbjct: 72  RLIDHW 77



>gb:OSJN00188_1696449 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088A01, complete sequence.
          Length = 879

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITP-NNLL 291
           P  F CP++ ++   PV I +G+TFER  I +WFD G   CP TG+ L  L+I   N +L
Sbjct: 492 PSDFLCPLTRQIFNRPVTIETGQTFERHAIVQWFDKGIRMCPITGQELESLSIPDINRVL 551

Query: 290 KGLILKWCAEQGVACSDPTTC 228
           K LI  W +E     +  +TC
Sbjct: 552 KRLIDNWKSEHCKTLNSESTC 572



>gb:AP005609_1854849 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0014M17.
          Length = 442

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 8/80 (10%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWF------DAGHNTCPKTGETL--PDLT 312
           P  F CPIS  +M DPV +A+G T++R  I+RW       D G  TCP T   L   +  
Sbjct: 9   PSYFLCPISLEIMRDPVTLATGITYDRSSIERWMFGGGGGDGGKGTCPVTRRQLAPAERE 68

Query: 311 ITPNNLLKGLILKWCAEQGV 252
            TPN+ L+ LI  WCA   V
Sbjct: 69  ATPNHTLRRLIQAWCAAHAV 88



>gb:AP005546_1853897 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1003_C09.
          Length = 407

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 28/66 (42%), Positives = 38/66 (57%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPI   +M DP++ A G T+E   I+ WFD+GH T P T   LP   + PN+ L+
Sbjct: 336 PSYFICPIQQDVMRDPLIAADGFTYEAEAIREWFDSGHYTSPMTNLDLPHRDLLPNHALR 395

Query: 287 GLILKW 270
             I +W
Sbjct: 396 SAIQEW 401



>gb:AC114983_1739193 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0032H19 map E30331S, complete
           sequence.
          Length = 664

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 30/70 (42%), Positives = 42/70 (60%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPI   +M DP V + G T+E   I+RWFD+G+N  P T   LPDL + PN +L+
Sbjct: 583 PAPFICPILMEIMKDPQVASDGFTYEGEAIRRWFDSGNNRSPMTNLVLPDLKLIPNRVLR 642

Query: 287 GLILKWCAEQ 258
             I ++  +Q
Sbjct: 643 SSIHEYLRQQ 652



>gb:AB026295_1516916 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone:P0681F10.>gb:AP005828_1858617
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, PAC clone:P0702F05.
          Length = 343

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 32/81 (39%), Positives = 44/81 (54%)
 Frame = -3

Query: 491 NILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLT 312
           +ILNR  P   F CPI   +M DP + A G T++   I+ W DAGH+T P T   L  + 
Sbjct: 259 SILNREPP---FTCPIFLHVMEDPYITADGHTYDGEAIRAWLDAGHDTSPVTNLPLEHME 315

Query: 311 ITPNNLLKGLILKWCAEQGVA 249
           + PN  L+  I+ W  +Q  A
Sbjct: 316 LIPNRALRSAIVWWHEQQNAA 336



>pir|B86239|B86239 protein T10O24.19 [imported] - Arabidopsis
           thaliana>gb:AE005172_890065 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007067_1535137 Genomic sequence for
           Arabidopsis thaliana BAC T10O24 from Chromosome 1,
           complete sequence.
          Length = 697

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 3/92 (3%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLILK 273
           CPIS  +M DPVVI +G T++R  I +WF +G+ TCP TG+ L    +  N  ++ +I K
Sbjct: 294 CPISLEIMTDPVVIETGHTYDRSSITKWFGSGNITCPITGKILTSTELVDNVSVRQVIRK 353

Query: 272 WCAEQGV---ACSDPTTCIYDAVPHSWEASSA 186
            C   G+     S       D VP S  A  A
Sbjct: 354 HCKTNGIVLAGISRRRKSHDDVVPESLAAKGA 385



>gb:AP005828_1858612 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0702F05.
          Length = 430

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 29/77 (37%), Positives = 42/77 (54%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  +M DP   A G T+E   I++W + GH+T P T E L    +TPN+ L+
Sbjct: 347 PPHFICPISQEVMNDPHFAADGHTYEAEHIRKWLNDGHDTSPMTNERLQHKKLTPNHALR 406

Query: 287 GLILKWCAEQGVACSDP 237
             I +W   + +  + P
Sbjct: 407 SAIREWHQHRNMRHTSP 423



>gb:AP005112_1848052 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0684F11.
          Length = 452

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 27/67 (40%), Positives = 39/67 (58%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD F CPIS  +M DPV   +G T++R  ++ W + G  TCP TG  L    + PN+  +
Sbjct: 40  PDHFLCPISLDMMRDPVTAPTGITYDRDGVEVWLERGRPTCPVTGRPLRPEELVPNHATR 99

Query: 287 GLILKWC 267
            +I +WC
Sbjct: 100 RMIQEWC 106



>gb:AP004139_1838153 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1486_E07.>gb:AP005108_1847978 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0461B08.
          Length = 398

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 29/67 (43%), Positives = 37/67 (55%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
           PP  F CPI    M DP + A G T+E   I+ W D+GH+T P T  TL    + PN  L
Sbjct: 315 PPSYFVCPIFQEEMNDPHIAADGFTYEAEAIKGWLDSGHDTSPMTNLTLEHRELIPNRAL 374

Query: 290 KGLILKW 270
           +  IL+W
Sbjct: 375 RSAILEW 381



>gb:OSJN00036_1693692 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0033G16, complete sequence.
          Length = 451

 Score = 62.8 bits (151), Expect = 8e-09
 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 3/72 (4%)
 Frame = -3

Query: 458 FKCPISSRLMYDPVVIASGETFERMWIQRW-FDAGHNTCPKTGETL--PDLTITPNNLLK 288
           F CPIS  +M DPV +++G T++R  I+RW F  GH  CP T + L   D   TPN+ L+
Sbjct: 19  FVCPISLEIMRDPVTLSTGITYDRESIERWVFTDGHGECPVTKQRLAPADREPTPNHTLR 78

Query: 287 GLILKWCAEQGV 252
            LI  WCA   V
Sbjct: 79  RLIQGWCAVHAV 90



>gb:AP001859_1821435 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0485D09.
          Length = 1392

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 34/90 (37%), Positives = 49/90 (54%), Gaps = 3/90 (3%)
 Frame = -3

Query: 491 NILNRPI--PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPD 318
           ++  RP+   P  F CPI+S++  DPV + +G+T+ER  IQ W D G+ TCP T   L  
Sbjct: 415 DVARRPVVATPKDFVCPITSQVFDDPVTLETGQTYERRAIQEWLDRGNATCPITRHRLHG 474

Query: 317 LTI-TPNNLLKGLILKWCAEQGVACSDPTT 231
             + + N +LK LI  W  +   A S   T
Sbjct: 475 AHLPSTNYVLKRLIAAWRDQNPAASSSAPT 504



>gb:OSJN00084_1694601 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0070M12, complete sequence.
          Length = 413

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 31/69 (44%), Positives = 42/69 (60%), Gaps = 1/69 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETL-PDLTITPNNLL 291
           P  F CPIS ++M DPV + +G T++R  I+RW      TCP T + + PD   TPN+ L
Sbjct: 14  PSYFVCPISLQIMRDPVTLPTGITYDRDGIERWLLTA-GTCPLTKQPVPPDCDPTPNHTL 72

Query: 290 KGLILKWCA 264
           + LI  WCA
Sbjct: 73  RRLIQSWCA 81



>gb:ATAC016795_1543597 Arabidopsis thaliana chromosome III BAC
           F26K24 genomic sequence, complete
           sequence.>gb:AY084238_1569330 Arabidopsis thaliana clone
           100676 mRNA, complete sequence.
          Length = 456

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 1/70 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLP-DLTITPNNLL 291
           P+ F CPIS  +M DPV   SG T++R  I +W +    +CP T + LP D  +TPN++L
Sbjct: 11  PNYFICPISLEIMKDPVTTVSGITYDRQNIVKWLEK-VPSCPVTKQPLPLDSDLTPNHML 69

Query: 290 KGLILKWCAE 261
           + LI  WC E
Sbjct: 70  RRLIQHWCVE 79



>gb:BC089856_2111051 Rattus norvegicus cDNA clone MGC:108920
           IMAGE:7381399, complete cds.
          Length = 476

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/66 (42%), Positives = 37/66 (56%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD F CPI+  LM DPV+ + G ++ER  ++ W      T P T   LP L +TPN  LK
Sbjct: 405 PDEFICPITRELMKDPVIASDGYSYEREAMESWIHKKKRTSPMTNLALPSLVLTPNRTLK 464

Query: 287 GLILKW 270
             I +W
Sbjct: 465 MAINRW 470



>gb:AP004651_1842668 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0091G06.
          Length = 449

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 26/67 (38%), Positives = 38/67 (56%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  +M DPV   +G T++R  ++ W   GH+TCP TG  +    + PN+  +
Sbjct: 39  PANFVCPISLEMMRDPVTAPTGITYDRESVEGWLARGHDTCPVTGRPVRLADLVPNHATR 98

Query: 287 GLILKWC 267
            +I  WC
Sbjct: 99  RMIQDWC 105



>gb:AK011391_1156373 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610014F08
           product:hypothetical SAM domain (Sterile alpha
           motif)/Modified RING finger domain/G-protein beta WD-40
           repeats containing protein, full insert
           sequence.>gb:BC061948_2104739 Mus musculus RIKEN cDNA
           2610014F08 gene, mRNA (cDNA clone MGC:65547
           IMAGE:6312489), complete cds.
          Length = 474

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 28/66 (42%), Positives = 37/66 (56%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD F CPI+  LM DPV+ + G ++ER  ++ W      T P T   LP L +TPN  LK
Sbjct: 403 PDEFICPITRELMKDPVIASDGYSYEREAMESWIHKKKRTSPMTNLALPSLVLTPNRTLK 462

Query: 287 GLILKW 270
             I +W
Sbjct: 463 MAINRW 468



>gb:AB013395_1512166 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQN23.>gb:BT015352_1642180 Arabidopsis thaliana
           At5g65200 gene, complete cds.>gb:BT015720_1642338
           Arabidopsis thaliana At5g65200 gene, complete cds.
          Length = 556

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 37/82 (45%), Positives = 47/82 (57%), Gaps = 4/82 (4%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTG---ETLPDLT-ITP 303
           PP  F CPIS  +M DPVV++SG+TFER+ +Q   D   N  PK     E+LPD + I P
Sbjct: 33  PPVEFLCPISKSVMSDPVVVSSGQTFERVCVQVCRDL--NFIPKLNDDEESLPDFSNIIP 90

Query: 302 NNLLKGLILKWCAEQGVACSDP 237
           N  +K  I  WC   GV+   P
Sbjct: 91  NLNMKSTIDTWCDTVGVSRPQP 112



>gb:AP003270_1826860 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0505D12.
          Length = 404

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 39/104 (37%), Positives = 53/104 (50%), Gaps = 3/104 (2%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDA--GHNTCPKTGETLP-DLTITPNN 297
           P  F CPIS +LM DPV + +G +++R  I RW  A     TCP T + L   L +TPN+
Sbjct: 9   PSYFVCPISLQLMRDPVTLPTGISYDRAAIARWLAAPGARRTCPVTRQPLEHGLELTPNH 68

Query: 296 LLKGLILKWCAEQGVACSDPTTCIYDAVPHSWEASSASIASLNS 165
            L+ LI  W A        P + + + V      SS  +ASL S
Sbjct: 69  TLRRLIQSWAAS-----VSPGSAVDEEVAALRPVSSDEVASLLS 107



>gb:OSJN00179_1696259 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0069D17, complete sequence.
          Length = 628

 Score = 60.1 bits (144), Expect = 5e-08
 Identities = 29/79 (36%), Positives = 45/79 (56%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P+ F CPIS+++M +PVVI+SG+T E + +++W+      CP T E L +    PN L+ 
Sbjct: 235 PEFFLCPISNKVMVNPVVISSGKTVEVLALEKWWSENRRLCPVTDEILDNSIFIPNILIM 294

Query: 287 GLILKWCAEQGVACSDPTT 231
                W    G+  +D TT
Sbjct: 295 LCTALWRTRNGI--TDVTT 311



>pir|E86147|E86147 T1N6.4 protein - Arabidopsis
            thaliana>gb:AE005172_889214 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:T1N6_1723674
            Sequence of BAC T1N6 from Arabidopsis thaliana chromosome
            1, complete sequence.
          Length = 952

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 27/67 (40%), Positives = 36/67 (53%)
 Frame = -3

Query: 470  PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
            PP  F CPIS  +M +P V A G T+E   ++ W D GH T P T   L    + PN+ L
Sbjct: 881  PPSYFICPISQEVMREPRVAADGFTYEAESLREWLDNGHETSPMTNLKLAHNNLVPNHAL 940

Query: 290  KGLILKW 270
            +  I +W
Sbjct: 941  RSAIQEW 947



>gb:BC029520_1979537 Homo sapiens WD repeat and SAM domain
           containing 1, mRNA (cDNA clone MGC:33855 IMAGE:5301559),
           complete cds.
          Length = 384

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 26/66 (39%), Positives = 36/66 (54%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD F CPI+  LM DPV+ + G ++E+  ++ W      T P T   LP   +TPN  LK
Sbjct: 313 PDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTSPMTNLVLPSAVLTPNRTLK 372

Query: 287 GLILKW 270
             I +W
Sbjct: 373 MAINRW 378



>gb:AK093494_1914000 Homo sapiens cDNA FLJ36175 fis, clone
           TESTI2026453, weakly similar to PUTATIVE
           SERINE/THREONINE-PROTEIN KINASE PKWA (EC 2.7.1.-).
          Length = 476

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 26/66 (39%), Positives = 36/66 (54%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD F CPI+  LM DPV+ + G ++E+  ++ W      T P T   LP   +TPN  LK
Sbjct: 405 PDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTSPMTNLVLPSAVLTPNRTLK 464

Query: 287 GLILKW 270
             I +W
Sbjct: 465 MAINRW 470



>gb:AY128369_1580668 Arabidopsis thaliana putative protein
           (At5g62560) mRNA, complete cds.>gb:BT000351_1634629
           Arabidopsis thaliana putative protein (At5g62560) mRNA,
           complete cds.
          Length = 559

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDL-TITPNNLL 291
           P  F CPI+  LM DPVV++SG+TFER+ +Q   + G+      G T PDL T+ PN  +
Sbjct: 32  PPEFLCPITGFLMSDPVVVSSGQTFERLSVQVCRNLGYIPDLLDG-TRPDLSTVIPNLAM 90

Query: 290 KGLILKWCAEQGVACSDPTTCIY 222
           K  I  WC  Q V    P    Y
Sbjct: 91  KSTIFSWCDRQKVDHPRPPDAAY 113



>gb:AB015469_1512515 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19B1.
          Length = 533

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 35/83 (42%), Positives = 45/83 (54%), Gaps = 1/83 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDL-TITPNNLL 291
           P  F CPI+  LM DPVV++SG+TFER+ +Q   + G+      G T PDL T+ PN  +
Sbjct: 32  PPEFLCPITGFLMSDPVVVSSGQTFERLSVQVCRNLGYIPDLLDG-TRPDLSTVIPNLAM 90

Query: 290 KGLILKWCAEQGVACSDPTTCIY 222
           K  I  WC  Q V    P    Y
Sbjct: 91  KSTIFSWCDRQKVDHPRPPDAAY 113



>gb:AC114983_1739186 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0032H19 map E30331S, complete
           sequence.
          Length = 683

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 28/70 (40%), Positives = 39/70 (55%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  +M DP V + G T+E   I+ WFD G +  P T   LP+L + PN +L+
Sbjct: 601 PAAFICPISMEIMKDPQVASDGFTYEAEAIRCWFDRGISRSPMTNLALPNLNLVPNRVLR 660

Query: 287 GLILKWCAEQ 258
             I  +  +Q
Sbjct: 661 SFIHGYLQQQ 670



>gb:AE016959_1020752 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC131967_1741065
           Oryza sativa (japonica cultivar-group) chromosome 10
           clone OSJNAa0049K09, complete
           sequence.>gb:AE017051_1750571 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 5 of 77 of the
           complete sequence.
          Length = 460

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 8/81 (9%)
 Frame = -3

Query: 485 LNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWF--------DAGHNTCPKTGE 330
           L  P+PP+ F+CPIS  LM DPVV  +G T++R  I+ W          A  +TCP T  
Sbjct: 17  LELPVPPE-FRCPISLELMRDPVVGPTGITYDRAGIEAWLLAAGAGKTAAASSTCPVTKG 75

Query: 329 TLPDLTITPNNLLKGLILKWC 267
            L    + PN+ L+ +I  WC
Sbjct: 76  DLRADDLVPNHALRRVIQAWC 96



>gb:AP005828_1858614 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0702F05.
          Length = 441

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 26/60 (43%), Positives = 34/60 (56%)
 Frame = -3

Query: 458 FKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLI 279
           F CPIS  +M DP++ A G T+E  +I+ WF  GHNT P T   L    + PN  L+  I
Sbjct: 377 FTCPISHEVMNDPLMAADGHTYEAKFIRDWFRRGHNTSPITNVELEHKKLVPNRALRSAI 436



>gb:AB026295_1516945 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone:P0681F10.
          Length = 805

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 27/74 (36%), Positives = 38/74 (51%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
           PP  F CPIS  +M DP + A G T+E   I+ W   GH+T P T   L    + PN  L
Sbjct: 731 PPSYFICPISQDIMDDPHIAADGFTYEAEAIRSWLCNGHDTSPMTNLLLEHEELIPNRAL 790

Query: 290 KGLILKWCAEQGVA 249
           +  I +W  +  ++
Sbjct: 791 RSAIQEWLQQHSMS 804



>gb:AE016959_1023722 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC020666_1538613 Oryza sativa
            chromosome 10 BAC OSJNBa0082M15 genomic sequence,
            complete sequence.>gb:AE017117_1753541 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 71 of 77
            of the complete sequence.
          Length = 881

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 28/69 (40%), Positives = 38/69 (55%)
 Frame = -3

Query: 485  LNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTIT 306
            +N+   P  F CPIS  +M DP + A G ++E   I+ W  +GHNT P T  TL  L + 
Sbjct: 800  VNKNRTPFYFICPISQEVMRDPHIAADGFSYEEEAIKGWLGSGHNTSPMTKSTLEHLQLI 859

Query: 305  PNNLLKGLI 279
            PN  L+  I
Sbjct: 860  PNLALRSAI 868



>pir|F86147|F86147 hypothetical protein T1N6.5 [imported] -
           Arabidopsis thaliana>gb:AE005172_889215 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:T1N6_1723675 Sequence of BAC T1N6 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 308

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 26/63 (41%), Positives = 37/63 (58%)
 Frame = -3

Query: 458 FKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLI 279
           FKCPIS  +M DP V A G T+E    ++W  +G  T PKT + L +  + PN+ L+ +I
Sbjct: 237 FKCPISMEIMRDPHVAADGFTYEAEEFRKWLRSGGRTSPKTNKPLENHNLVPNHTLRIII 296

Query: 278 LKW 270
             W
Sbjct: 297 KDW 299



>gb:AC133859_1741530 Oryza sativa chromosome 3 BAC OSJNBa0075A22
           genomic sequence, complete sequence.
          Length = 852

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 29/72 (40%), Positives = 43/72 (59%), Gaps = 5/72 (6%)
 Frame = -3

Query: 464 DVFKCPISSRLMYDPVVIASGETFERMWIQRWF----DAGHN-TCPKTGETLPDLTITPN 300
           + F CP++ ++M DPV I +G+TFER  I +WF    D G   TCP T   L D  ++P+
Sbjct: 16  EAFVCPLTKQVMRDPVTIETGQTFEREAILKWFRECRDNGRRPTCPLTQRELRDTEVSPS 75

Query: 299 NLLKGLILKWCA 264
             L+ +I +W A
Sbjct: 76  VALRSVIHEWRA 87



>gb:AY091018_1574249 Arabidopsis thaliana unknown protein
           (At3g47820) mRNA, partial cds.
          Length = 511

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 2/69 (2%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGE-TLPDL-TITPNNL 294
           P  F CPI+  LM DPVV+ASG+TFER+ +Q       +  PK  + T PDL T+ PN  
Sbjct: 13  PTEFLCPITGFLMSDPVVVASGQTFERISVQ--VCRNLSFAPKLHDGTQPDLSTVIPNLA 70

Query: 293 LKGLILKWC 267
           +K  IL WC
Sbjct: 71  MKSTILSWC 79



>pir|T07721|T07721 hypothetical protein T23J7.150 - Arabidopsis
           thaliana>gb:ATT23J7_1555379 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T23J7.>gb:BT020355_1642750
           Arabidopsis thaliana At3g47820 gene, complete cds.
          Length = 509

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 2/69 (2%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGE-TLPDL-TITPNNL 294
           P  F CPI+  LM DPVV+ASG+TFER+ +Q       +  PK  + T PDL T+ PN  
Sbjct: 11  PTEFLCPITGFLMSDPVVVASGQTFERISVQ--VCRNLSFAPKLHDGTQPDLSTVIPNLA 68

Query: 293 LKGLILKWC 267
           +K  IL WC
Sbjct: 69  MKSTILSWC 77



>gb:AP004996_1846974 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0027A02.
          Length = 869

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 28/75 (37%), Positives = 40/75 (53%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            P  F CPI   +M DP V A G T+E+  I+ W    H   P T   LP+L++ PN+ L+
Sbjct: 796  PSHFICPIMQEVMNDPYVAADGHTYEQQAIKAWLKK-HKVSPVTRRILPNLSVIPNHSLR 854

Query: 287  GLILKWCAEQGVACS 243
              I +W ++   A S
Sbjct: 855  AAIQQWKSQSAHAKS 869



>gb:AK176453_1818441 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL24-22-H23.
          Length = 805

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 28/77 (36%), Positives = 39/77 (50%)
 Frame = -3

Query: 500 ARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLP 321
           A  N+  RP  P  + CPI   +M DP++ A G T+E   I+ W   GH+T P T   + 
Sbjct: 727 ANQNVPRRP--PSHYLCPIFQEVMKDPLIAADGFTYEAEAIREWLANGHDTSPMTNLKME 784

Query: 320 DLTITPNNLLKGLILKW 270
           D  + PN+ L   I  W
Sbjct: 785 DCNLIPNHALHLAIQDW 801



>gb:AK176423_1818411 Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL24-16-N05.
          Length = 509

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 28/77 (36%), Positives = 39/77 (50%)
 Frame = -3

Query: 500 ARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLP 321
           A  N+  RP  P  + CPI   +M DP++ A G T+E   I+ W   GH+T P T   + 
Sbjct: 431 ANQNVPRRP--PSHYLCPIFQEVMKDPLIAADGFTYEAEAIREWLANGHDTSPMTNLKME 488

Query: 320 DLTITPNNLLKGLILKW 270
           D  + PN+ L   I  W
Sbjct: 489 DCNLIPNHALHLAIQDW 505



>gb:AY050369_1562148 Arabidopsis thaliana AT3g49060/T2J13_100 mRNA,
           complete cds.>gb:BT004526_1637560 Arabidopsis thaliana
           At3g49060/T2J13_100 gene, complete
           cds.>gb:AK176246_1818234 Arabidopsis thaliana mRNA,
           complete cds, clone: RAFL23-14-B18.>gb:AK176327_1818315
           Arabidopsis thaliana mRNA, complete cds, clone:
           RAFL23-31-D03.
          Length = 805

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 28/77 (36%), Positives = 39/77 (50%)
 Frame = -3

Query: 500 ARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLP 321
           A  N+  RP  P  + CPI   +M DP++ A G T+E   I+ W   GH+T P T   + 
Sbjct: 727 ANQNVPRRP--PSHYLCPIFQEVMKDPLIAADGFTYEAEAIREWLANGHDTSPMTNLKME 784

Query: 320 DLTITPNNLLKGLILKW 270
           D  + PN+ L   I  W
Sbjct: 785 DCNLIPNHALHLAIQDW 801



>pir|T46124|T46124 hypothetical protein T2J13.100 - Arabidopsis
           thaliana>gb:ATT2J13_1555701 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T2J13.
          Length = 1175

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 28/77 (36%), Positives = 39/77 (50%)
 Frame = -3

Query: 500 ARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLP 321
           A  N+  RP  P  + CPI   +M DP++ A G T+E   I+ W   GH+T P T   + 
Sbjct: 653 ANQNVPRRP--PSHYLCPIFQEVMKDPLIAADGFTYEAEAIREWLANGHDTSPMTNLKME 710

Query: 320 DLTITPNNLLKGLILKW 270
           D  + PN+ L   I  W
Sbjct: 711 DCNLIPNHALHLAIQDW 727



>gb:OSJN00163_1695975 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0020I02, complete sequence.
          Length = 516

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 24/67 (35%), Positives = 38/67 (56%)
 Frame = -3

Query: 398 TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLILKWCAEQGVACSDPTTCIYD 219
           T++R  IQ WF AG+  CP+T + L    + PN+L++ +I +WC E G+   +      D
Sbjct: 156 TYDRRSIQEWFSAGNQICPQTQQVLSHTIVIPNHLVRTMISQWCTENGLTLPEIENQEQD 215

Query: 218 AVPHSWE 198
            V +S E
Sbjct: 216 HVTNSEE 222



 Score = 35.0 bits (79), Expect = 1.7
 Identities = 17/30 (56%), Positives = 21/30 (70%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWI 378
           P +F CPISS +M DPVVI SG+    +WI
Sbjct: 76  PALFLCPISSGIMRDPVVIESGQC--EVWI 103



>gb:BT015764_1642382 Arabidopsis thaliana At2g45920 mRNA, complete
           cds.>gb:BT020181_1642576 Arabidopsis thaliana At2g45920
           mRNA, complete cds.>gb:AK175182_1817170 Arabidopsis
           thaliana mRNA, complete cds, clone: RAFL21-59-J20.
          Length = 400

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 26/66 (39%), Positives = 32/66 (48%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  +M DP + A G T+E   I  W   GH T P T   L    + PN  L+
Sbjct: 326 PQYFICPISLEVMKDPQLAADGFTYEAEAISTWLQGGHETSPMTNTKLHHTKLVPNLALR 385

Query: 287 GLILKW 270
             I +W
Sbjct: 386 SAIQEW 391



>pir|T02455|T02455 hypothetical protein At2g45920 [imported] -
           Arabidopsis thaliana>gb:AC004665_1531925 Arabidopsis
           thaliana chromosome 2 clone F4I18 map CIC02E07, complete
           sequence.
          Length = 325

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 26/66 (39%), Positives = 32/66 (48%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  +M DP + A G T+E   I  W   GH T P T   L    + PN  L+
Sbjct: 251 PQYFICPISLEVMKDPQLAADGFTYEAEAISTWLQGGHETSPMTNTKLHHTKLVPNLALR 310

Query: 287 GLILKW 270
             I +W
Sbjct: 311 SAIQEW 316



>gb:BT002512_1636115 Arabidopsis thaliana putative protein kinase
           (At2g45910) mRNA, complete cds.
          Length = 834

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 26/68 (38%), Positives = 36/68 (52%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           I P  F CPI   +M DP V A G T+E   I+ W D+ H+T P T   L   ++  N+ 
Sbjct: 762 IAPPYFICPIFQEVMQDPHVAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIANHA 821

Query: 293 LKGLILKW 270
           L+  I +W
Sbjct: 822 LRSAIQEW 829



>pir|T02456|T02456 protein kinase homolog F4I18.11 - Arabidopsis
           thaliana>gb:AC004665_1531926 Arabidopsis thaliana
           chromosome 2 clone F4I18 map CIC02E07, complete
           sequence.
          Length = 799

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 26/68 (38%), Positives = 36/68 (52%)
 Frame = -3

Query: 473 IPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           I P  F CPI   +M DP V A G T+E   I+ W D+ H+T P T   L   ++  N+ 
Sbjct: 727 IAPPYFICPIFQEVMQDPHVAADGFTYEAEAIRAWLDSEHDTSPMTNVKLSHTSLIANHA 786

Query: 293 LKGLILKW 270
           L+  I +W
Sbjct: 787 LRSAIQEW 794



>gb:AP005301_1850177 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0077M12.
          Length = 585

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 31/89 (34%), Positives = 41/89 (46%)
 Frame = -3

Query: 503 PARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETL 324
           PA        + P+ F CPIS   M DPV++  G T+ER  +     AG + CP  G + 
Sbjct: 37  PAPGKEEEEEVMPEEFLCPISGAPMADPVILPPGRTYERACVDAC--AGLSLCP-PGASA 93

Query: 323 PDLTITPNNLLKGLILKWCAEQGVACSDP 237
                 PN+ L+  I  WCA  G A   P
Sbjct: 94  ATAAAIPNDALRAAIRTWCARHGRAPPAP 122



>gb:AB023044_1515502 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MWD22.
          Length = 819

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 23/67 (34%), Positives = 37/67 (55%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
           PP  F CP+   +M +P + A G T++R  I+ W +  H T P T   L ++ + PN+ L
Sbjct: 749 PPSHFFCPLLKDVMKEPCIAADGYTYDRRAIEEWME-NHRTSPVTNSPLQNVNLLPNHTL 807

Query: 290 KGLILKW 270
              I++W
Sbjct: 808 YAAIVEW 814



>gb:AE016959_1023724 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC020666_1538611
           Oryza sativa chromosome 10 BAC OSJNBa0082M15 genomic
           sequence, complete sequence.>gb:AE017117_1753543 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           71 of 77 of the complete sequence.
          Length = 407

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 25/63 (39%), Positives = 33/63 (52%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPIS  +M +P + A G T+E   I  WFD GH   P T + L    + PN  L+
Sbjct: 333 PSHFICPISQEIMREPCIAADGFTYEAEAIINWFDEGHEVSPMTKQPLVHRDLIPNFALR 392

Query: 287 GLI 279
            +I
Sbjct: 393 SVI 395



>gb:AY059775_1564625 Arabidopsis thaliana unknown protein
           (At1g20780) mRNA, complete cds.>gb:AY096753_1576288
           Arabidopsis thaliana unknown protein (At1g20780) mRNA,
           complete cds.
          Length = 383

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = -3

Query: 464 DVFKCPISSRLMYDPVVIASGETFERMWIQRWF----DAGH-NTCPKTGETLPDLTITPN 300
           + F CP++  +M+DPV + +G TFER  I++WF    D+G   +CP T + L    ++ +
Sbjct: 25  EAFICPLTKEVMHDPVTLENGRTFEREAIEKWFKECRDSGRPPSCPLTSQELTSTDVSAS 84

Query: 299 NLLKGLILKWCAEQGVACSD 240
             L+  I +W +    A  D
Sbjct: 85  IALRNTIEEWRSRNDAAKLD 104



>gb:AE005172_891034 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC069251_1540738 Genomic sequence
           for Arabidopsis thaliana BAC F2D10 from chromosome I,
           complete sequence.
          Length = 801

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = -3

Query: 464 DVFKCPISSRLMYDPVVIASGETFERMWIQRWF----DAGH-NTCPKTGETLPDLTITPN 300
           + F CP++  +M+DPV + +G TFER  I++WF    D+G   +CP T + L    ++ +
Sbjct: 25  EAFICPLTKEVMHDPVTLENGRTFEREAIEKWFKECRDSGRPPSCPLTSQELTSTDVSAS 84

Query: 299 NLLKGLILKWCAEQGVACSD 240
             L+  I +W +    A  D
Sbjct: 85  IALRNTIEEWRSRNDAAKLD 104



>gb:AP004648_1842618 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1449_H02.
          Length = 333

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P    CP+   +M DPV+IA+G+T +R  ++ WFD   + CP T + +   T+  N  ++
Sbjct: 251 PQNLVCPLCGNVMVDPVMIATGKTMDRHCVRAWFDKHGHICPVTCQPVSS-TVLRNERIR 309

Query: 287 GLILKW 270
           G + +W
Sbjct: 310 GYVEEW 315



>gb:AK118101_1816098 Arabidopsis thaliana At1g01670 mRNA for unknown
           protein, complete cds, clone: RAFL19-36-B16.
          Length = 365

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 25/67 (37%), Positives = 34/67 (50%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
           PP  F CPIS  +M +P V A G T+E    +RW + G    P T   L +  + PN +L
Sbjct: 294 PPQCFICPISKDIMQNPHVAADGYTYEADEFRRWLNHGGEKSPMTNLRLENRNLIPNLVL 353

Query: 290 KGLILKW 270
           +  I  W
Sbjct: 354 RSAIKDW 360



>gb:AE016959_1023834 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079890_1733040
           Oryza sativa chromosome 10 BAC OSJNBb0089A17 genomic
           sequence, complete sequence.>gb:AE017119_1753653 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           73 of 77 of the complete sequence.
          Length = 782

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 3/76 (3%)
 Frame = -3

Query: 479 RPI---PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTI 309
           RP+   PP  F CPI  R+M DP + + G +++R+ I+ W    ++  P T   LP+  +
Sbjct: 705 RPVISGPPSHFICPILKRIMQDPCIASDGYSYDRVAIEMWL-CENDKSPITKSRLPNKDL 763

Query: 308 TPNNLLKGLILKWCAE 261
            PN+ L   I  W AE
Sbjct: 764 VPNHALLCAITSWKAE 779



>gb:AP004729_1843899 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0006A22.
          Length = 806

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 27/66 (40%), Positives = 35/66 (53%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPI   +M DP V A G T+E   I+ W    H T P T + L  L+I PN+ L+
Sbjct: 737 PSHFICPILQEVMDDPYVAADGHTYEHRAIKAWLKK-HKTSPVTKQRLQYLSIIPNHSLR 795

Query: 287 GLILKW 270
             I +W
Sbjct: 796 VAIQQW 801



>gb:AY224495_1590697 Oryza sativa (japonica cultivar-group) isolate
           31017 putative serine/threonine protein kinase mRNA,
           partial cds.
          Length = 448

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 24/67 (35%), Positives = 36/67 (53%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
           PP  F CPI   +M DP V + G T++R  I+ W    ++  P T   LP  ++ PN+ L
Sbjct: 379 PPSHFICPILQEVMADPYVASDGYTYDRKAIELWLSM-NDKSPMTNLRLPHKSLIPNHSL 437

Query: 290 KGLILKW 270
           +  I+ W
Sbjct: 438 RSAIIDW 444



>pir|E96791|E96791 hypothetical protein F15M4.11 [imported] -
           Arabidopsis thaliana>gb:AE005173_895170 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC012394_1537625 Arabidopsis thaliana
           chromosome 1 BAC F15M4 genomic sequence, complete
           sequence.
          Length = 811

 Score = 50.4 bits (119), Expect = 4e-05
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 5/72 (6%)
 Frame = -3

Query: 464 DVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHN-----TCPKTGETLPDLTITPN 300
           + F CP++ ++M++PV + +G+TFER  I++WF          +CP T + L    ++P+
Sbjct: 27  EAFICPLTKQVMHNPVTLENGQTFEREAIEKWFQECRENGQPLSCPITSKELSITDLSPS 86

Query: 299 NLLKGLILKWCA 264
             L+  I +W A
Sbjct: 87  IALRNTIEEWRA 98



>gb:AP004026_1836552 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1136_C04.
          Length = 893

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 23/66 (34%), Positives = 33/66 (50%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            P  F CPI   +M DP +   G ++E   I+ W  +G +T P T   LP   + PN+ L+
Sbjct: 809  PSYFVCPILKEVMRDPQIAGDGFSYEAEAIREWLRSGRDTSPMTNLKLPRRELVPNHPLR 868

Query: 287  GLILKW 270
              I  W
Sbjct: 869  DAIHHW 874



>gb:AE016959_1021139 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC090488_1734379
           Genomic sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBb0081F12 from chromosome 10, complete
           sequence.>gb:AE017062_1750958 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 16 of 77 of the
           complete sequence.
          Length = 154

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 23/47 (48%), Positives = 29/47 (61%)
 Frame = -3

Query: 476 PIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKT 336
           P PP  F+CPIS  LM DP+V+ASG+T++R    RW  A     P T
Sbjct: 104 PAPPSDFRCPISLDLMRDPIVVASGQTYDRDSSGRWSGAERRRHPAT 150



>pir|T05537|T05537 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F13M23.300 - Arabidopsis
           thaliana>gb:ATCHRIV62_1546398 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           62.>gb:ATF13M23_1548516 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F13M23 (ESSAII project).
          Length = 814

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 25/67 (37%), Positives = 34/67 (50%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
           PP  F CP+   +M +P V A G T++R  I+ W    HNT P T   L    + PN  L
Sbjct: 745 PPTHFICPLLKDVMNEPCVAADGYTYDRHAIEEWLKE-HNTSPMTDSPLHSKNLLPNYTL 803

Query: 290 KGLILKW 270
              I++W
Sbjct: 804 YTAIMEW 810



>pir|A96714|A96714 hypothetical protein T6L1.12 [imported] -
           Arabidopsis thaliana>gb:AE005173_894510 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011665_1537343 Arabidopsis thaliana
           chromosome 1 BAC T6L1 genomic sequence, complete
           sequence.
          Length = 1033

 Score = 49.7 bits (117), Expect = 7e-05
 Identities = 30/97 (30%), Positives = 47/97 (48%), Gaps = 4/97 (4%)
 Frame = -3

Query: 548 NTENGYNNLQRDHLFPARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRW 369
           +++  Y NL        +      P P   F CP++  +M DPV   +G T ER  +  W
Sbjct: 221 SSQRKYGNLSESLSMLPQVTQFMEP-PYQAFICPLTKEIMEDPVTTETGVTCERQAVIEW 279

Query: 368 FDAGHNT----CPKTGETLPDLTITPNNLLKGLILKW 270
           FD+  N+    CP TG+ L    ++ N +LK +I +W
Sbjct: 280 FDSFGNSDEINCPVTGQKL-TTELSANVVLKTIIQEW 315



>gb:AP004994_1846913 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846950 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 518

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 30/77 (38%), Positives = 38/77 (49%), Gaps = 9/77 (11%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRW---------FDAGHNTCPKTGETLPD 318
           PP  F CPIS  LM DPVV+  G+TFER  IQ             A  ++ P +  +   
Sbjct: 31  PPAEFLCPISGTLMADPVVVPPGQTFERACIQACAALAFSPPAVAADLSSLPPSASS--P 88

Query: 317 LTITPNNLLKGLILKWC 267
           L + PN  L+  IL WC
Sbjct: 89  LVLVPNVALRTAILNWC 105



>pir|T01289|T01289 probable protein kinase At2g19410 [imported] -
           Arabidopsis thaliana>gb:AC003058_1531064 Arabidopsis
           thaliana chromosome 2 clone F27F23 map CIC06E08,
           complete sequence.
          Length = 801

 Score = 49.3 bits (116), Expect = 9e-05
 Identities = 24/66 (36%), Positives = 34/66 (51%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  + CPI   +M +P + A G T+ER  I  W +  HN  P T + L    +TPN+ L+
Sbjct: 726 PSHYFCPILREIMEEPEIAADGFTYERKAILAWLEK-HNISPVTRQKLDHFKLTPNHTLR 784

Query: 287 GLILKW 270
             I  W
Sbjct: 785 SAIRDW 790



>gb:AE016959_1023718 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC020666_1538617
           Oryza sativa chromosome 10 BAC OSJNBa0082M15 genomic
           sequence, complete sequence.>gb:AE017117_1753537 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           71 of 77 of the complete sequence.
          Length = 675

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 27/78 (34%), Positives = 38/78 (48%), Gaps = 6/78 (7%)
 Frame = -3

Query: 467 PDVFKCPISSRL------MYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTIT 306
           P  F CPIS  L      M DP + A G T+E   I+ W D GH+  P T +TL +    
Sbjct: 587 PSYFLCPISQVLQVRKVTMRDPQMAADGFTYEADAIRDWLDKGHDRSPVTNQTLANCDTI 646

Query: 305 PNNLLKGLILKWCAEQGV 252
           PN  L+  I ++  +  +
Sbjct: 647 PNIALRSAIQEYLKQNNM 664



>gb:AP004139_1838156 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1486_E07.>gb:AP005108_1847981 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0461B08.
          Length = 721

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = -3

Query: 434 LMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLILKW 270
           +M DP + A G T+E   I+ W D G+   P T  +L +  +TPN +L+  IL+W
Sbjct: 662 VMTDPHIAADGYTYEANAIRNWLDGGNARSPMTNLSLENRELTPNRVLRSAILEW 716



>gb:AB010699_1511236 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSN9.
          Length = 540

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDL-TITPNNLL 291
           P  F CPIS  LM DP++++SG ++ER  +      G    P      PD  T+ PN  L
Sbjct: 49  PAEFLCPISGSLMADPIIVSSGHSYERACVIACKTLGFTPTPP-----PDFSTVIPNLAL 103

Query: 290 KGLILKWC 267
           K  I  WC
Sbjct: 104 KSAIHSWC 111



>gb:AY653733_2371645 Mimivirus, complete genome.
          Length = 1297

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 29/90 (32%), Positives = 40/90 (44%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLL 291
           P   F CPIS  +M  PVV   G T+E+  I +WF+   +T P T E +    I  N +L
Sbjct: 679 PLQEFLCPISHEIMEHPVVAKDGFTYEKSNILKWFE-NKSTSPMTNEKI-SKKICDNKVL 736

Query: 290 KGLILKWCAEQGVACSDPTTCIYDAVPHSW 201
           K +I  W     V        +   +P  W
Sbjct: 737 KSIIRDWKENNTVIEQSDKLSVTIKLPDPW 766



>gb:AP005728_1856699 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0048A13.
          Length = 547

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 30/91 (32%), Positives = 41/91 (45%), Gaps = 8/91 (8%)
 Frame = -3

Query: 503 PARANIL---NRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTG 333
           PAR+ ++       PP  F C I   LM DPV++ SG+T+ER  +Q         C +  
Sbjct: 32  PARSAVVVVAEEEAPPAEFVCSILGALMADPVILPSGQTYERACLQ--------ACAELA 83

Query: 332 ETLPDL-----TITPNNLLKGLILKWCAEQG 255
              P +      + PN  LK  I  WCA  G
Sbjct: 84  FLPPGMGSASDAVIPNAALKAAIGTWCARSG 114



>gb:AP005284_1849815 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1121A12.
          Length = 973

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 7/88 (7%)
 Frame = -3

Query: 512 HLFPARANILNRPIPP--DVFKCPISSRLMYDPVVIASGETFERMWI----QRWFDAGHN 351
           HLF +   + +  I P  D   CP+++++M DPV+  SG T+ER  I    +R+ D+  N
Sbjct: 155 HLFSSLPEV-SEYIEPLYDALFCPLTNQVMTDPVLTESGVTYERRAIEEHFERFADSSEN 213

Query: 350 T-CPKTGETLPDLTITPNNLLKGLILKW 270
             CP T   L   T+  N  LK +I +W
Sbjct: 214 VICPVTKMPLQSKTLMNNASLKSVIAEW 241



>gb:AB012239_1511664 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11J9.
          Length = 763

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 22/66 (33%), Positives = 34/66 (51%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           P  F CPI+  +M +P V + G T+E+  I+ W    H + P T    P  ++ PN+ L 
Sbjct: 693 PTHFYCPITKDVMENPCVASDGYTYEKRAIKEWLQKNHKS-PMTDLPFPSDSLLPNHSLL 751

Query: 287 GLILKW 270
             I +W
Sbjct: 752 SAIKEW 757



>gb:AB012239_1511663 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11J9.
          Length = 845

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 2/76 (2%)
 Frame = -3

Query: 491 NILNRPI--PPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPD 318
           N+L+R    PP  F CP+   +M +P V A G T++R  I+ W     +T P T   LP+
Sbjct: 766 NLLSRTPSGPPSHFICPLLKGVMNEPCVAADGYTYDREAIEEWL-RQKDTSPVTNLPLPN 824

Query: 317 LTITPNNLLKGLILKW 270
             +  N  L   I++W
Sbjct: 825 KNLIANYTLYSAIMEW 840



>gb:AP004994_1846915 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC
           clone:OSJNBa0052G07.>gb:AP004995_1846952 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0068B06.
          Length = 491

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 27/76 (35%), Positives = 37/76 (48%), Gaps = 4/76 (5%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHN--TCPKTGE--TLPDLTITPN 300
           P  F CPIS  LM DPV++ SGETFER  ++     G      P + +    P   + PN
Sbjct: 12  PPEFVCPISGELMADPVIVPSGETFERGCVEACVALGFTPAALPLSVDLAASPPPALIPN 71

Query: 299 NLLKGLILKWCAEQGV 252
             L+  I  +C   G+
Sbjct: 72  ANLRKAISSYCDRVGL 87



>gb:AP003044_1824349 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0038C05.
          Length = 973

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 5/70 (7%)
 Frame = -3

Query: 464 DVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHN-----TCPKTGETLPDLTITPN 300
           D F CP+++++M DPV   SG T++R  I+ +F+   +      CP T  ++    +  N
Sbjct: 165 DSFFCPLTNKVMVDPVTTESGVTYDRKAIEEYFEKFADGSEPVVCPVTKMSMQSKALRSN 224

Query: 299 NLLKGLILKW 270
             LK  I +W
Sbjct: 225 VPLKSTIAEW 234



>pir|E96601|E96601 hypothetical protein T6h22.17 [imported] -
           Arabidopsis thaliana>gb:AE005173_893486 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC009894_1536880 Arabidopsis thaliana
           chromosome I BAC T6H22 genomic sequence, complete
           sequence.
          Length = 448

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = -3

Query: 446 ISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLKGLI 279
           + + +M +P + A G T+E   IQ+W + GH T P T   L   +  PN  L+  I
Sbjct: 388 LKTDVMKNPHMAADGFTYELEAIQKWINTGHRTSPMTNLKLSHFSFFPNRALRSAI 443



>gb:CR382132_1665641 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 236

 Score = 40.0 bits (92), Expect = 0.053
 Identities = 23/69 (33%), Positives = 32/69 (46%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD    PIS  L  DPVV  +G+T+ER W+      G        + L    ++P +L  
Sbjct: 165 PDYLADPISFNLFMDPVVTPAGQTYERSWLLEHLKGGGK------DPLTRKNLSPKDLYP 218

Query: 287 GLILKWCAE 261
            L +K  AE
Sbjct: 219 NLAVKKAAE 227



>gb:S80988_2579450 xnf7-O=nuclear factor 7 [Xenopus laevis, oocytes,
           mRNA, 2343 nt].
          Length = 610

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQR-WFDAGHNTCPKTGETLPDLTITPNNLLKGLIL 276
           CP+   L  DPV++A G  F R  I + W       CP+  E++ D   T N +L  L  
Sbjct: 146 CPLCVELFKDPVMVACGHNFCRSCIDKVWEGQSSFACPECKESITDRKYTINRVLANLAK 205

Query: 275 K 273
           K
Sbjct: 206 K 206



>pir|A43906|A43906 nuclear phosphoprotein xnf7 - African clawed
           frog>gb:S64515_2579264 xnf7=zinc finger nuclear
           phosphoprotein [Xenopus laevis, mRNA, 2255
           nt].>gb:XELXNF7AA_2582304 X.laeivs xnf7 protein mRNA,
           complete cds.
          Length = 609

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQR-WFDAGHNTCPKTGETLPDLTITPNNLLKGLIL 276
           CP+   L  DPV++A G  F R  I + W       CP+  E++ D   T N +L  L  
Sbjct: 145 CPLCVELFKDPVMVACGHNFCRSCIDKAWEGQSSFACPECRESITDRKYTINRVLANLAK 204

Query: 275 K 273
           K
Sbjct: 205 K 205



>pir|S28418|S28418 probable zinc-binding protein - Iberian ribbed
           newt
          Length = 624

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQR-WFDAGHNTCPKTGETLPDLTITPNNLLKGLIL 276
           CP+   L  +PV++  G  F +  I + W  A   +CP+  E L +   T N +L  L+ 
Sbjct: 162 CPLCRSLFKEPVILECGHNFCKHCIDKSWESASAFSCPECKEVLTERKYTTNRVLANLVK 221

Query: 275 K 273
           K
Sbjct: 222 K 222



>sp|Q02084|A33_PLEWA Zinc-binding protein A33.>gb:SMRPWA33A_2580069
           Pleurodeles waltlii Zn-binding protein (PWa33) mRNA,
           complete cds.
          Length = 624

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQR-WFDAGHNTCPKTGETLPDLTITPNNLLKGLIL 276
           CP+   L  +PV++  G  F +  I + W  A   +CP+  E L +   T N +L  L+ 
Sbjct: 162 CPLCRSLFKEPVILECGHNFCKHCIDKSWESASAFSCPECKEVLTERKYTTNRVLANLVK 221

Query: 275 K 273
           K
Sbjct: 222 K 222



>gb:AY095206_1298285 Drosophila melanogaster SD06937 full insert cDNA.
          Length = 965

 Score = 37.0 bits (84), Expect = 0.45
 Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTC--PKTGETLPDLTITPNNL 294
            PD FK P+   LM DPVV+ SG   +R  I R      N+C  P   + L +  +  N  
Sbjct: 890  PDEFKDPLMDTLMSDPVVLPSGTVMDRAIITRHL---LNSCTDPFNRQPLTEDMLVANIE 946

Query: 293  LKGLILKWCAEQ 258
            LK  I  W  EQ
Sbjct: 947  LKQRIDAWRKEQ 958



>gb:AE014134_1128972 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003638_1219079 Drosophila melanogaster
            chromosome 2L, section 47 of 83 of the complete
            sequence.>gb:AY094803_1297977 Drosophila melanogaster
            LD24832 full insert cDNA.
          Length = 1217

 Score = 37.0 bits (84), Expect = 0.45
 Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTC--PKTGETLPDLTITPNNL 294
            PD FK P+   LM DPVV+ SG   +R  I R      N+C  P   + L +  +  N  
Sbjct: 1142 PDEFKDPLMDTLMSDPVVLPSGTVMDRAIITRHL---LNSCTDPFNRQPLTEDMLVANIE 1198

Query: 293  LKGLILKWCAEQ 258
            LK  I  W  EQ
Sbjct: 1199 LKQRIDAWRKEQ 1210



>gb:AP004864_1846196 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0048K16.
          Length = 586

 Score = 36.2 bits (82), Expect = 0.76
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 2/64 (3%)
 Frame = -3

Query: 446 ISSRLMYDPVVIASGETFERMWI--QRWFDAGHNTCPKTGETLPDLTITPNNLLKGLILK 273
           + + +M DPV++ SG + ++ +   Q+  +   NT   T  +LP     PN+LL+ +I  
Sbjct: 191 LQAEVMRDPVILPSGYSVDQTYQNNQKRQNPWTNTSTFTDHSLPYSLSVPNHLLRDMISA 250

Query: 272 WCAE 261
           WC +
Sbjct: 251 WCLD 254



>gb:BC052391_2101069 Mus musculus G protein-coupled receptor 125, mRNA
            (cDNA clone IMAGE:5718990), partial cds.
          Length = 1383

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 28/92 (30%), Positives = 38/92 (41%), Gaps = 11/92 (11%)
 Frame = +3

Query: 159  HITVQACNGSR*SFP*MRNCIIYTGGRIRTSNSLFCTP----LQYQTLQQVVW------- 305
            H+ V  C      F  +  C+++ GG  +T N+  C      L Y TL  V+W       
Sbjct: 858  HMLVNLC------FHILLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWVGVTARN 911

Query: 306  CYCQVGKRLPGLWTRVVACVEPPLNPHPLERF 401
             Y QV K+      R     EPP  P P+ RF
Sbjct: 912  IYKQVTKKA----KRCQDPDEPPAPPRPMLRF 939



>gb:BC019649_2093040 Mus musculus G protein-coupled receptor 125,
           mRNA (cDNA clone IMAGE:3994416), partial cds.
          Length = 662

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 28/92 (30%), Positives = 38/92 (41%), Gaps = 11/92 (11%)
 Frame = +3

Query: 159 HITVQACNGSR*SFP*MRNCIIYTGGRIRTSNSLFCTP----LQYQTLQQVVW------- 305
           H+ V  C      F  +  C+++ GG  +T N+  C      L Y TL  V+W       
Sbjct: 234 HMLVNLC------FHILLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWVGVTARN 287

Query: 306 CYCQVGKRLPGLWTRVVACVEPPLNPHPLERF 401
            Y QV K+      R     EPP  P P+ RF
Sbjct: 288 IYKQVTKKA----KRCQDPDEPPAPPRPMLRF 315



>gb:AK172893_2069827 Mus musculus mRNA for mKIAA0126 protein.
          Length = 1030

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 28/70 (40%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464  DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            D F  PI S LM DPVV+ S   T +R  I R       T P     L    I PN  LK
Sbjct: 954  DEFLDPIMSTLMSDPVVLPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNTELK 1012

Query: 287  GLILKWCAEQ 258
              I +W AE+
Sbjct: 1013 EKIQRWLAER 1022



>gb:D50916_1994781 Homo sapiens mRNA for KIAA0126 gene, partial cds.
          Length = 1075

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 28/70 (40%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464  DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            D F  PI S LM DPVV+ S   T +R  I R       T P     L    I PN  LK
Sbjct: 999  DEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNTELK 1057

Query: 287  GLILKWCAEQ 258
              I +W AE+
Sbjct: 1058 EKIQRWLAER 1067



>gb:AF091093_1882515 Homo sapiens clone 686 unknown mRNA, complete
           sequence.
          Length = 186

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/70 (34%), Positives = 32/70 (45%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD F+ P+   LM DPV + SG   +R  I R       T P   +TL +  + P   LK
Sbjct: 113 PDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHL-LNSPTDPFNRQTLTESMLEPVPELK 171

Query: 287 GLILKWCAEQ 258
             I  W  E+
Sbjct: 172 EQIQAWMREK 181



>gb:AB028839_1865785 Homo sapiens HDNB1(homzygously deleted in
            neuroblastoma-1)/UFD2 mRNA, complete
            cds.>gb:AF331520_1897029 Homo sapiens ubiquitin-fusion
            degradation protein 2 mRNA, complete
            cds.>gb:AL590639_1929752 Human DNA sequence from clone
            RP11-496H15 on chromosome 1 Contains the 3' end of the
            gene for retinoid binding protein 7 (CRBPIV), the 5' end
            of the UBE4B gene for ubiquitination factor E4B (UFD2
            homolog, yeast), a pseudogene similar to part of
            ribosomal protein L21 (RPL21) and a pseudogene similar to
            part of phosphoglycerate mutase, complete
            sequence.>gb:HSJ575L21_2016267 Human DNA sequence from
            clone RP4-575L21 on chromosome 1p36.13-36.31 Contains the
            3' end of the UBE4B gene for ubiquitination factor E4B
            (UFD2 homolog, yeast), complete sequence.
          Length = 1173

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/70 (34%), Positives = 32/70 (45%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   +TL +  + P   LK
Sbjct: 1100 PDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHL-LNSPTDPFNRQTLTESMLEPVPELK 1158

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1159 EQIQAWMREK 1168



>gb:AB014584_1864613 Homo sapiens mRNA for KIAA0684 protein, partial
            cds.
          Length = 1218

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/70 (34%), Positives = 32/70 (45%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   +TL +  + P   LK
Sbjct: 1145 PDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHL-LNSPTDPFNRQTLTESMLEPVPELK 1203

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1204 EQIQAWMREK 1213



>gb:AF539857_1280296 Trypanosoma cruzi putative splicing factor XB2
           gene, complete cds.
          Length = 505

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 3/60 (5%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIA-SGETFERMWIQRWFDAGHNTCPKTGETL--PDLTITPNNLLKGL 282
           C IS+R+ ++PVV   SG  +ER  I+++  A H  CP TGE L   DL      +LK +
Sbjct: 3   CCISNRVPHEPVVSRLSGCLYERSLIEQYI-AEHGRCPVTGEALQKDDLIAVRPTVLKSV 61



>gb:PFMAL7P1_1191794 Plasmodium falciparum 3D7 chromosome 7, ***
            SEQUENCING IN PROGRESS ***, 12 ordered pieces.
          Length = 961

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 21/87 (24%), Positives = 37/87 (42%)
 Frame = -3

Query: 548  NTENGYNNLQRDHLFPARANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRW 369
            N E      Q + +F    +   +   PD   C IS  LM +PV+  SG T++++++   
Sbjct: 859  NEEKSLRIQQTEGIFKELLDSFQKKQVPDYLCCKISMCLMNEPVITPSGMTYDKIFLYEH 918

Query: 368  FDAGHNTCPKTGETLPDLTITPNNLLK 288
                 +  P + E      + PN  +K
Sbjct: 919  VKHNGSFDPVSREQFSIREVIPNYAIK 945



>gb:CR859425_1183542 Pongo pygmaeus mRNA; cDNA DKFZp469M236 (from
            clone DKFZp469M236).
          Length = 1066

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 28/70 (40%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464  DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            D F  PI S LM DPVV+ S   T +R  I R       T P     L    I PN  LK
Sbjct: 990  DEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNTELK 1048

Query: 287  GLILKWCAEQ 258
              I +W AE+
Sbjct: 1049 EKIQRWLAER 1058



>gb:CR858257_1182442 Pongo pygmaeus mRNA; cDNA DKFZp469M224 (from
            clone DKFZp469M224).
          Length = 1066

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 28/70 (40%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464  DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            D F  PI S LM DPVV+ S   T +R  I R       T P     L    I PN  LK
Sbjct: 990  DEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNTELK 1048

Query: 287  GLILKWCAEQ 258
              I +W AE+
Sbjct: 1049 EKIQRWLAER 1058



>gb:AY325198_1177867 Rattus norvegicus Ab2-232 mRNA, complete cds.
          Length = 1085

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 28/70 (40%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464  DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            D F  PI S LM DPVV+ S   T +R  I R       T P     L    I PN  LK
Sbjct: 1009 DEFLDPIMSTLMSDPVVLPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNTELK 1067

Query: 287  GLILKWCAEQ 258
              I +W AE+
Sbjct: 1068 EKIQRWLAER 1077



>gb:AK037131_1164760 Mus musculus adult female vagina cDNA, RIKEN
           full-length enriched library, clone:9930123J21
           product:SIMILAR TO UBIQUITINATION FACTOR E4A (UFD2
           HOMOLOG, YEAST) homolog [Mus musculus], full insert
           sequence.
          Length = 206

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 28/70 (40%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464 DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           D F  PI S LM DPVV+ S   T +R  I R       T P     L    I PN  LK
Sbjct: 130 DEFLDPIMSTLMSDPVVLPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNTELK 188

Query: 287 GLILKWCAEQ 258
             I +W AE+
Sbjct: 189 EKIQRWLAER 198



>sp|O95155|UB4B_HUMAN Ubiquitin conjugation factor E4 B
            (Ubiquitin-fusion degradation protein 2) (Homozygously
            deleted in neuroblastoma-1).>gb:AF043117_1878518 Homo
            sapiens ubiquitin-fusion degradation protein 2 (UFD2)
            mRNA, complete cds.>gb:AL590639_1929751 Human DNA
            sequence from clone RP11-496H15 on chromosome 1 Contains
            the 3' end of the gene for retinoid binding protein 7
            (CRBPIV), the 5' end of the UBE4B gene for ubiquitination
            factor E4B (UFD2 homolog, yeast), a pseudogene similar to
            part of ribosomal protein L21 (RPL21) and a pseudogene
            similar to part of phosphoglycerate mutase, complete
            sequence.>gb:HSJ575L21_2016266 Human DNA sequence from
            clone RP4-575L21 on chromosome 1p36.13-36.31 Contains the
            3' end of the UBE4B gene for ubiquitination factor E4B
            (UFD2 homolog, yeast), complete sequence.
          Length = 1302

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 24/70 (34%), Positives = 32/70 (45%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   +TL +  + P   LK
Sbjct: 1229 PDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHL-LNSPTDPFNRQTLTESMLEPVPELK 1287

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1288 EQIQAWMREK 1297



>sp|Q14139|UB4A_HUMAN Ubiquitin conjugation factor E4 A.
          Length = 1073

 Score = 35.0 bits (79), Expect = 1.7
 Identities = 28/70 (40%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464  DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            D F  PI S LM DPVV+ S   T +R  I R       T P     L    I PN  LK
Sbjct: 997  DEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNTELK 1055

Query: 287  GLILKWCAEQ 258
              I +W AE+
Sbjct: 1056 EKIQRWLAER 1065



>gb:AY029484_2508654 Danio rerio ubiquitination factor E4/UFD2 mRNA,
            complete cds.
          Length = 1183

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 24/70 (34%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD FK P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1110 PDEFKDPLMDTLMTDPVQLPSGNIMDRSIILRHL-LNSPTDPFNRQPLTESMLEPVPELK 1168

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1169 ERIQAWMREK 1178



>gb:AB080911_1524017 Arabis gemmifera gene for similar to A.
           thaliana AT4g08590, complete cds, 5' flanking region.
          Length = 434

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 14/46 (30%), Positives = 22/46 (47%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDL 315
           C + ++L   PV    G  F     ++W D G+ TC K    +PD+
Sbjct: 109 CSLCNQLPDKPVTTQCGHNFCLKCFEKWIDRGNETCAKCRSPIPDI 154



>gb:AE017354_461164 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 246

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETL 324
           PD+F CPIS  L+  PV+ A G+ +++  +  +  A  N   +TG+ L
Sbjct: 133 PDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNK-DETGKKL 179



 Score = 33.1 bits (74), Expect = 6.5
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 7/76 (9%)
 Frame = -3

Query: 494 ANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDA----GHNTCPKTGET 327
           AN+ +    P +  CPI S  + DPV+   G  + +  I +W +       +  P T + 
Sbjct: 29  ANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKD 88

Query: 326 L---PDLTITPNNLLK 288
           L   P+L I  N  ++
Sbjct: 89  LQPFPELLIIVNRFVE 104



>gb:CR628336_113004 Legionella pneumophila str. Paris complete
           genome.
          Length = 240

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 17/48 (35%), Positives = 28/48 (58%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETL 324
           PD+F CPIS  L+  PV+ A G+ +++  +  +  A  N   +TG+ L
Sbjct: 127 PDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNK-DETGKKL 173



 Score = 33.1 bits (74), Expect = 6.5
 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 7/76 (9%)
 Frame = -3

Query: 494 ANILNRPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDA----GHNTCPKTGET 327
           AN+ +    P +  CPI S  + DPV+   G  + +  I +W +       +  P T + 
Sbjct: 23  ANLSHPETTPTMLTCPIDSGFLKDPVITPEGFVYNKSSILKWLETKKEDPQSRKPLTAKD 82

Query: 326 L---PDLTITPNNLLK 288
           L   P+L I  N  ++
Sbjct: 83  LQPFPELLIIVNRFVE 98



>gb:AJ720127_2502314 Gallus gallus mRNA for hypothetical protein,
            clone 11c15.
          Length = 1074

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 27/70 (38%), Positives = 32/70 (45%), Gaps = 1/70 (1%)
 Frame = -3

Query: 464  DVFKCPISSRLMYDPVVIASGE-TFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            D F  PI S LM DPV++ S   T +R  I R       T P     L    I PN  LK
Sbjct: 994  DEFLDPIMSTLMSDPVILPSSRVTVDRSTIARHL-LSDQTDPFNRSPLTMDQIRPNRELK 1052

Query: 287  GLILKWCAEQ 258
              I +W AE+
Sbjct: 1053 EKIQQWLAER 1062



>gb:BC035645_1981641 Homo sapiens, Similar to RIKEN cDNA 3830613O22
            gene, clone IMAGE:5551209, mRNA, partial cds.
          Length = 1266

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 28/92 (30%), Positives = 37/92 (40%), Gaps = 11/92 (11%)
 Frame = +3

Query: 159  HITVQACNGSR*SFP*MRNCIIYTGGRIRTSNSLFCTP----LQYQTLQQVVW------- 305
            H+ V  C      F     C+++ GG  +T N+  C      L Y TL  V+W       
Sbjct: 796  HMLVNLC------FHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATVLWVGVTARN 849

Query: 306  CYCQVGKRLPGLWTRVVACVEPPLNPHPLERF 401
             Y QV K+      R     EPP  P P+ RF
Sbjct: 850  IYKQVTKKA----KRCQDPDEPPPPPRPMLRF 877



>gb:AY181243_1937956 Homo sapiens G protein-coupled receptor 125
           (GPR125) mRNA, partial cds.
          Length = 1178

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 28/92 (30%), Positives = 37/92 (40%), Gaps = 11/92 (11%)
 Frame = +3

Query: 159 HITVQACNGSR*SFP*MRNCIIYTGGRIRTSNSLFCTP----LQYQTLQQVVW------- 305
           H+ V  C      F     C+++ GG  +T N+  C      L Y TL  V+W       
Sbjct: 653 HMLVNLC------FHIFLTCVVFVGGITQTRNASICQAVGIILHYSTLATVLWVGVTARN 706

Query: 306 CYCQVGKRLPGLWTRVVACVEPPLNPHPLERF 401
            Y QV K+      R     EPP  P P+ RF
Sbjct: 707 IYKQVTKKA----KRCQDPDEPPPPPRPMLRF 734



>gb:BX908808_1644509 Neurospora crassa DNA linkage group IV Cosmid
           contig G21B4.
          Length = 326

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 26/77 (33%), Positives = 37/77 (48%)
 Frame = -3

Query: 479 RPIPPDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPN 300
           RP PPD     IS ++M DPV+  +G+++ER  I+        T P T   L    + PN
Sbjct: 248 RPNPPDWAIDDISFQVMVDPVMTKTGKSYERASIEEHLRRS-ETDPLTRTPLTIKDLLPN 306

Query: 299 NLLKGLILKWCAEQGVA 249
             LK    ++  E G A
Sbjct: 307 IDLKHACEEFLNENGWA 323



>gb:BC065969_2554223 Danio rerio tnf receptor-associated factor 4,
           like, mRNA (cDNA clone MGC:77418 IMAGE:6970326),
           complete cds.>gb:DRE556548_2571163 Danio rerio mRNA for
           TRAF4 protein, splice variant 1.
          Length = 470

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 14/101 (13%)
 Frame = -3

Query: 470 PPDVFKCPISSRLMYDPVVIAS-GETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNL 294
           P   F+CP+ S+ M +PV +++ G  F    +Q +   G   CP+    L    I P+  
Sbjct: 12  PKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPE 71

Query: 293 LKGLIL-------------KWCAEQGVACSDPTTCIYDAVP 210
           L+  IL             +W  +     S  +TC ++ +P
Sbjct: 72  LEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIP 112



>gb:AF483536_2497122 Oncorhynchus mykiss clone B32 VHSV-induced
           protein mRNA, complete cds.
          Length = 201

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 5/86 (5%)
 Frame = -3

Query: 464 DVFKCPISSRLMYDPVVIASGETFERMWIQRWFD----AGHNTCPKTGETL-PDLTITPN 300
           D F C +   L+ +PV I  G ++ R  I+  +D     G  +CP+  ET  P   +  N
Sbjct: 11  DQFCCSVCLDLLKEPVTIPCGHSYCRSCIEGCWDQDDLKGVYSCPQCRETFTPRPNLRKN 70

Query: 299 NLLKGLILKWCAEQGVACSDPTTCIY 222
           N+L  L+ K   + G+  + P    Y
Sbjct: 71  NMLAELVEK-LKKTGLQAAPPPALCY 95



>gb:AX247824_1464740 Sequence 65 from Patent WO0166748.
          Length = 469

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 24/73 (32%), Positives = 32/73 (43%), Gaps = 11/73 (15%)
 Frame = +3

Query: 216 CIIYTGGRIRTSNSLFCTP----LQYQTLQQVVW-------CYCQVGKRLPGLWTRVVAC 362
           C+++ GG  +T N+  C      L Y TL  V+W        Y QV K+      R    
Sbjct: 13  CVVFVGGITQTRNASICQAVGIILHYSTLATVLWVGVTARNIYKQVTKKA----KRCQDP 68

Query: 363 VEPPLNPHPLERF 401
            EPP  P P+ RF
Sbjct: 69  DEPPPPPRPMLRF 81



>gb:BC021259_1977458 Homo sapiens tripartite motif-containing 65,
           mRNA (cDNA clone MGC:29759 IMAGE:4128330), complete cds.
          Length = 517

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 16/45 (35%), Positives = 20/45 (44%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPD 318
           C I   L  DPV +  G  F    I+ W+D     CP+  E  PD
Sbjct: 12  CAICLGLYQDPVTLPCGHNFCGACIRDWWDRCGKACPECREPFPD 56



>gb:AY358401_1947280 Homo sapiens clone DNA50988 MYL5 (UNQ385) mRNA,
           complete cds.
          Length = 560

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 13/48 (27%), Positives = 29/48 (60%)
 Frame = -3

Query: 257 GVACSDPTTCIYDAVPHSWEASSASIASLNSYMDGLSLPIGFNNLSIV 114
           GV C   T C++++VP +  ++ A+ ++   ++DGL L + +N   ++
Sbjct: 204 GVVCLLSTICLWESVPPTPPSAGAASSTSEKFLDGLKLQLMWNKAYVI 251



>gb:AK175637_1817625 Arabidopsis thaliana mRNA for putative zinc
           finger protein, complete cds, clone: RAFL22-12-H04.
          Length = 465

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 7/111 (6%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPD-LTITP--NNLLKGL 282
           C + ++L   PV I  G  F      +W D G+  C     T+PD +   P  N+ L  +
Sbjct: 109 CSLCNQLPDRPVTILCGHNFCLKCFDKWIDQGNQICATCRSTIPDKMAANPRVNSSLVSV 168

Query: 281 I--LKWCAEQGVACSD--PTTCIYDAVPHSWEASSASIASLNSYMDGLSLP 141
           I  +K     GV  ++  P T   D   +++    A I   N+    +++P
Sbjct: 169 IRYVKVAKTAGVGTANFFPFTSNQDGPENAFRTKRAKIGEENAARIYVTVP 219



>pir|T00949|T00949 hypothetical protein T3F12.10 - Arabidopsis
           thaliana>gb:AC002983_1530912 Arabidopsis thaliana BAC
           T3F12 from chromosome IV near 24 cM, complete
           sequence.>gb:ATCHRIV24_1544575 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 24.
          Length = 432

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 7/111 (6%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPD-LTITP--NNLLKGL 282
           C + ++L   PV I  G  F      +W D G+  C     T+PD +   P  N+ L  +
Sbjct: 109 CSLCNQLPDRPVTILCGHNFCLKCFDKWIDQGNQICATCRSTIPDKMAANPRVNSSLVSV 168

Query: 281 I--LKWCAEQGVACSD--PTTCIYDAVPHSWEASSASIASLNSYMDGLSLP 141
           I  +K     GV  ++  P T   D   +++    A I   N+    +++P
Sbjct: 169 IRYVKVAKTAGVGTANFFPFTSNQDGPENAFRTKRAKIGEENAARIYVTVP 219



>pir|T01825|T01825 hypothetical protein T15F16.7 - Arabidopsis
           thaliana>gb:T15F16_1723483 Arabidopsis thaliana BAC
           T15F16.
          Length = 461

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 28/111 (25%), Positives = 47/111 (42%), Gaps = 7/111 (6%)
 Frame = -3

Query: 452 CPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPD-LTITP--NNLLKGL 282
           C + ++L   PV I  G  F      +W D G+  C     T+PD +   P  N+ L  +
Sbjct: 109 CSLCNQLPDRPVTILCGHNFCLKCFDKWIDQGNQICATCRSTIPDKMAANPRVNSSLVSV 168

Query: 281 I--LKWCAEQGVACSD--PTTCIYDAVPHSWEASSASIASLNSYMDGLSLP 141
           I  +K     GV  ++  P T   D   +++    A I   N+    +++P
Sbjct: 169 IRYVKVAKTAGVGTANFFPFTSNQDGPENAFRTKRAKIGEENAARIYVTVP 219



>gb:BC075620_2106664 Mus musculus ubiquitination factor E4B, UFD2
            homolog (S. cerevisiae), mRNA (cDNA clone MGC:95730
            IMAGE:6405514), complete cds.
          Length = 1173

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/70 (32%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1100 PDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHL-LNSPTDPFNRQMLTESMLEPVPELK 1158

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1159 EQIQAWMREK 1168



>gb:BC067402_2105982 Mus musculus ubiquitination factor E4B, UFD2
            homolog (S. cerevisiae), mRNA (cDNA clone MGC:76634
            IMAGE:30099547), complete cds.
          Length = 1173

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/70 (32%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1100 PDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHL-LNSPTDPFNRQMLTESMLEPVPELK 1158

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1159 EQIQAWMREK 1168



>gb:AK122345_2069010 Mus musculus mRNA for mKIAA0684 protein.
          Length = 1186

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/70 (32%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1113 PDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHL-LNSPTDPFNRQMLTESMLEPVPELK 1171

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1172 EQIQAWMREK 1181



>gb:AF260926_2060830 Mus musculus ubiquitin fusion degradation protein
            2 (Ufd2) mRNA, complete cds.
          Length = 1173

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/70 (32%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1100 PDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHL-LNSPTDPFNRQMLTESMLEPVPELK 1158

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1159 EQIQAWMREK 1168



>gb:AB08324S27_2047736 Mus musculus gene for U-box-type ubiquitin
            ligase UFD2a, complete cds and exon 27.
          Length = 1173

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/70 (32%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1100 PDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHL-LNSPTDPFNRQMLTESMLEPVPELK 1158

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1159 EQIQAWMREK 1168



>gb:ATAC009853_1543044 Arabidopsis thaliana chromosome III BAC F21O3
           genomic sequence, complete sequence.>gb:AY042807_1560872
           Arabidopsis thaliana Unknown protein (F21O3.8) mRNA,
           complete cds.>gb:AY064647_1566096 Arabidopsis thaliana
           unknown protein (At3g07370; F21O3.8) mRNA, complete cds.
          Length = 278

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 19/60 (31%), Positives = 26/60 (43%)
 Frame = -3

Query: 467 PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
           PD   C I+  +  DPV+  SG T+ER  I           P T E +    + PN  +K
Sbjct: 201 PDYLCCNITLEIFRDPVISPSGVTYERAAILEHLKKVGKFDPITREKIDPANLVPNLAIK 260



>gb:AY427787_1430147 Bos taurus paternally expressed gene 3 (Peg3)
            mRNA, complete cds.
          Length = 2387

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 5/66 (7%)
 Frame = +2

Query: 572  TCSEDPARTTESSSFDRRLHQRCPAAF*CTVSPSRVRLAR*CLASTSQPEQT-----PAR 736
            +C+E+PA+T+ +    +  + + PA   CT  P++        + T +P QT     PA+
Sbjct: 1275 SCTEEPAQTSCTEEPAQTSYTQEPAQTSCTEEPAQT-------SCTEEPAQTSYTQEPAQ 1327

Query: 737  SSCTEK 754
            +SCTE+
Sbjct: 1328 TSCTEE 1333



>gb:AK029914_1161715 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4931439M19
            product:ubiquitination factor E4B, UFD2 homolog (S.
            cerevisiae), full insert sequence.
          Length = 1173

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/70 (32%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1100 PDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHL-LNSPTDPFNRQMLTESMLEPVPELK 1158

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1159 EQIQAWMREK 1168



>sp|Q9ES00|UB4B_MOUSE Ubiquitin conjugation factor E4 B
            (Ubiquitin-fusion degradation protein 2) (Ufd2a).
          Length = 1173

 Score = 33.1 bits (74), Expect = 6.5
 Identities = 23/70 (32%), Positives = 31/70 (44%)
 Frame = -3

Query: 467  PDVFKCPISSRLMYDPVVIASGETFERMWIQRWFDAGHNTCPKTGETLPDLTITPNNLLK 288
            PD F+ P+   LM DPV + SG   +R  I R       T P   + L +  + P   LK
Sbjct: 1100 PDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHL-LNSPTDPFNRQMLTESMLEPVPELK 1158

Query: 287  GLILKWCAEQ 258
              I  W  E+
Sbjct: 1159 EQIQAWMREK 1168


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 910,624,181
Number of Sequences: 1806583
Number of extensions: 20700476
Number of successful extensions: 58258
Number of sequences better than 10.0: 203
Number of HSP's better than 10.0 without gapping: 56346
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 58197
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 53956239900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)