BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13121
         (891 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF487527_1804290 Nicotiana plumbaginifolia D1 protease-like p...   273   5e-74   
gb:AF487526_1804289 Triticum aestivum D1 protease-like protein p...   231   2e-60   
gb:AB010698_1511230 Arabidopsis thaliana genomic DNA, chromosome...   223   6e-58   
gb:HVPEPD1PR_1682490 H.vulgare mRNA for peptidase of D1 protein.      209   5e-54   
pir|T05975|T05975 probable carboxy-terminal proteinase (EC 3.4.2...   209   5e-54   Hordeum vulgare [barley]
gb:AP003222_1825521 Oryza sativa (japonica cultivar-group) genom...   195   1e-49   
gb:AP008231_581467 Synechococcus elongatus PCC 6301 DNA, complet...   150   2e-35   
pir|AE2233|AE2233 carboxyl-terminal processing proteinase [impor...   148   2e-34   Nostoc sp. PCC 7120
pir|S26195|S26195 probable carboxyl-terminal processing proteina...   147   2e-34   Synechococcus sp.
sp|P42784|YPEB_SYNP2|YPEB_SYNP2 Hypothetical protein in PETB 5'region (Frag...   147   2e-34   Synechococcus sp.
gb:BA000039_727391 Thermosynechococcus elongatus BP-1 DNA, compl...   141   1e-32   
sp|Q55669|CTPA_SYNY3|CTPA_SYNY3 Carboxyl-terminal processing protease precu...   140   3e-32   Synechocystis sp.
gb:BA000045_743177 Gloeobacter violaceus PCC 7421 DNA, complete ...   134   2e-30   
gb:BA000045_740142 Gloeobacter violaceus PCC 7421 DNA, complete ...   133   4e-30   
pir|S65146|JH0263 carboxy-terminal proteinase (EC 3.4.21.-) D1 p...   133   5e-30   
gb:AP003507_1830058 Oryza sativa (japonica cultivar-group) genom...   131   2e-29   
gb:BX572097_798118 Prochlorococcus marinus MIT9313 complete geno...   130   3e-29   
gb:SOD1CTPA_1715665 S.oleracea mRNA for D1 protein C-terminal pr...   130   3e-29   
pir|AE2118|AE2118 carboxyl-terminal proteinase [imported] - Nost...   129   1e-28   Nostoc sp. PCC 7120
gb:AF487528_1804291 Nicotiana plumbaginifolia D1 protease precur...   128   1e-28   
gb:AF487525_1804288 Triticum aestivum D1 protease precursor (ctp...   124   2e-27   
gb:BX569692_776077 Synechococcus sp. WH8102 complete genome; seg...   122   7e-27   
pir|T06752|T06752 carboxy-terminal proteinase homolog F15B8.130 ...   122   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP008231_580699 Synechococcus elongatus PCC 6301 DNA, complet...   122   1e-26   
pir|AD2023|AD2023 carboxyl-terminal proteinase [imported] - Nost...   122   1e-26   Nostoc sp. PCC 7120
pir|S77395|S77395 carboxyl-terminal proteinase prc - Synechocyst...   122   1e-26   Synechocystis sp. PCC 6803
gb:ATH132544_1552012 Arabidopsis thaliana mRNA for D1-processing...   121   2e-26   
pir|E71447|E71447 probable PSII D1 protein processing enzyme - A...   121   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:BA000039_727190 Thermosynechococcus elongatus BP-1 DNA, compl...   120   4e-26   
pir|T10500|T10500 carboxy-terminal proteinase (EC 3.4.21.-) - gr...   119   8e-26   Tetradesmus obliquus
gb:AF022823_469973 Nostoc punctiforme carboxyl terminal protease...   117   2e-25   
gb:AE017162_394824 Prochlorococcus marinus subsp. marinus str. C...   117   2e-25   
gb:BX572100_798992 Prochlorococcus marinus MIT9313 complete geno...   115   1e-24   
gb:BX572091_796303 Prochlorococcus marinus MED4 complete genome;...   115   1e-24   
gb:BA000045_740194 Gloeobacter violaceus PCC 7421 DNA, complete ...   114   2e-24   
gb:BX842646_823207 Bdellovibrio bacteriovorus complete genome, s...   114   3e-24   
pir|S74579|S74579 carboxyl-terminal proteinase ctpB - Synechocys...   114   3e-24   Synechocystis sp. PCC 6803
gb:BX569694_776870 Synechococcus sp. WH8102 complete genome; seg...   114   3e-24   
gb:AP008231_580513 Synechococcus elongatus PCC 6301 DNA, complet...   113   4e-24   
gb:AE017317_440581 Desulfovibrio vulgaris subsp. vulgaris str. H...   112   1e-23   
gb:BA000039_728109 Thermosynechococcus elongatus BP-1 DNA, compl...   111   2e-23   
gb:AE010626_265102 Fusobacterium nucleatum subsp. nucleatum ATCC...   110   3e-23   
pir|F70369|F70369 carboxyl-terminal proteinase - Aquifex aeolicu...   110   4e-23   Aquifex aeolicus
gb:BX572090_795950 Prochlorococcus marinus MED4 complete genome;...   110   5e-23   
gb:AE013149_289578 Thermoanaerobacter tengcongensis MB4, section...   107   3e-22   
gb:AP006840_567331 Symbiobacterium thermophilum DNA, complete ge...   107   4e-22   
gb:AE017164_395470 Prochlorococcus marinus subsp. marinus str. C...   106   5e-22   
gb:BA000040_733082 Bradyrhizobium japonicum USDA 110 DNA, comple...   106   7e-22   
pir|H71342|H71342 probable carboxyl-terminal proteinase (ctp) - ...   106   7e-22   Treponema pallidum
pir|AE2917|AE2917 carboxy-terminal proteinase [imported] - Agrob...   105   2e-21   Agrobacterium tumefaciens
pir|H97691|H97691 carboxy-terminal proteinase (AF110497) [import...   105   2e-21   Agrobacterium tumefaciens
gb:BA000045_741384 Gloeobacter violaceus PCC 7421 DNA, complete ...   103   3e-21   
gb:AE017149_391371 Helicobacter hepaticus ATCC 51449 section 6 o...   103   3e-21   
gb:BX572593_799785 Rhodopseudomonas palustris CGA009 complete ge...   102   1e-20   
gb:AY204462_597146 Myxococcus xanthus clone C1121 adventurous gl...   102   1e-20   
pir|G75383|G75383 probable carboxyl-terminal proteinase - Deinoc...   102   1e-20   Deinococcus radiodurans
gb:AX930254_1483907 Sequence 19 from Patent WO03087149.               101   2e-20   
gb:BX294138_766708 Pirellula sp. strain 1 complete genome; segme...   101   2e-20   
gb:BA000040_728694 Bradyrhizobium japonicum USDA 110 DNA, comple...   101   2e-20   
gb:AE017333_448123 Bacillus licheniformis DSM 13, complete genom...   101   2e-20   
gb:AE017180_399269 Geobacter sulfurreducens PCA, complete genome.     101   2e-20   
gb:SCO939114_176640 Streptomyces coelicolor A3(2) complete genom...   101   2e-20   
gb:BX640437_812952 Bordetella bronchiseptica strain RB50, comple...   100   3e-20   
gb:BX640412_805048 Bordetella pertussis strain Tohama I, complet...   100   3e-20   
gb:SME591793_187184 Sinorhizobium meliloti 1021 complete chromos...   100   4e-20   
pir|F97738|F97738 tail-specific proteinase precursor (EC 3.4.21....   100   5e-20   Rickettsia conorii
gb:BX571658_777994 Wolinella succinogenes, complete genome; segm...   100   6e-20   
gb:AE016922_358315 Chromobacterium violaceum ATCC 12472 section ...   100   6e-20   
pir|AI3278|AI3278 tail-specific proteinase (EC 3.4.21.-) [import...   100   6e-20   Brucella melitensis
gb:BX640423_808551 Bordetella parapertussis strain 12822, comple...    99   8e-20   
pir|B69610|B69610 carboxy-terminal processing proteinase ctpA (E...    99   8e-20   Bacillus subtilis
gb:AE015944_321531 Clostridium tetani E88, section 9 of 10 of th...    99   1e-19   
gb:AE017197_402207 Rickettsia typhi str. Wilmington complete gen...    99   1e-19   
gb:AE016937_362165 Bacteroides thetaiotaomicron VPI-5482, sectio...    99   1e-19   
gb:AE014291_309246 Brucella suis 1330 chromosome I, complete seq...    99   1e-19   
pir|A71677|A71677 tail-specific proteinase precursor (ctp) RP228...    99   1e-19   Rickettsia prowazekii
pir|D96961|D96961 carboxyl-terminal protease [imported] - Clostr...    99   1e-19   Clostridium acetobutylicum
gb:AE016952_365718 Enterococcus faecalis V583, section 6 of 11 o...    98   2e-19   
gb:BX321862_774110 Nitrosomonas europaea ATCC 19718, complete ge...    98   2e-19   
gb:AE017282_429241 Methylococcus capsulatus str. Bath, complete ...    98   2e-19   
gb:AE011325_271686 Leptospira interrogans serovar lai str. 56601...    98   2e-19   
gb:CR543861_102319 Acinetobacter sp. ADP1 complete genome.             97   3e-19   
gb:CP000031_87798 Silicibacter pomeroyi DSS-3, complete genome.        97   3e-19   
gb:CR628336_110673 Legionella pneumophila str. Paris complete ge...    97   4e-19   
gb:AE017180_400068 Geobacter sulfurreducens PCA, complete genome.      97   5e-19   
gb:AE016793_334437 Pseudomonas putida KT2440 section 20 of 21 of...    96   7e-19   
pir|B83005|B83005 probable carboxyl-terminal proteinase PA5134 [...    96   7e-19   Pseudomonas aeruginosa
gb:AE015456_314473 Shewanella oneidensis MR-1 section 5 of 457 o...    96   9e-19   
pir|E81846|E81846 probable carboxy-terminal processing proteinas...    96   9e-19   Neisseria meningitidis serogroup A
gb:AP008226_578753 Thermus thermophilus HB8 genomic DNA, complet...    96   1e-18   
gb:AL646058_545280 Ralstonia solanacearum GMI1000 chromosome, co...    96   1e-18   
gb:AE017304_436565 Thermus thermophilus HB27 section 4 of 7 of t...    96   1e-18   
gb:AE004969_60334 Neisseria gonorrhoeae FA 1090, complete genome.      96   1e-18   
pir|G81095|G81095 carboxy-terminal peptidase NMB1332 [imported] ...    96   1e-18   Neisseria meningitidis serogroup B
gb:AL935257_551606 Lactobacillus plantarum strain WCFS1 complete...    95   2e-18   
gb:AE016875_354667 Pseudomonas syringae pv. tomato str. DC3000 s...    95   2e-18   
gb:AE013598_298287 Xanthomonas oryzae pv. oryzae KACC10331, comp...    95   2e-18   
gb:AE017175_397315 Porphyromonas gingivalis W83 section 4 of 8 o...    94   3e-18   
gb:AE017172_396604 Porphyromonas gingivalis W83 section 1 of 8 o...    94   3e-18   
gb:BX897699_826795 Bartonella henselae strain Houston-1, complet...    94   4e-18   
gb:BA000030_702993 Streptomyces avermitilis MA-4680 genomic DNA,...    94   4e-18   
gb:AE011625_274986 Xanthomonas axonopodis pv. citri str. 306, se...    94   4e-18   
gb:AE008692_241405 Zymomonas mobilis subsp. mobilis ZM4, complet...    94   4e-18   
gb:CR555306_105959 Azoarcus sp. EbN1 complete genome.                  94   4e-18   
gb:BA000012_669052 Mesorhizobium loti MAFF303099 DNA, complete g...    94   5e-18   
gb:CR522870_101401 Desulfotalea psychrophila LSv54 chromosome.         93   6e-18   
gb:AP006841_574889 Bacteroides fragilis YCH46 DNA, complete genome.    93   8e-18   
gb:AP006841_571490 Bacteroides fragilis YCH46 DNA, complete genome.    93   8e-18   
pir|F64688|F64688 proteinase (EC 3.4.-.-) - Helicobacter pylori ...    93   8e-18   Helicobacter pylori
gb:BX294146_769140 Pirellula sp. strain 1 complete genome; segme...    92   1e-17   
gb:AF110497_479883 Bartonella quintana filament-A precursor (fil...    92   1e-17   
pir|D71827|D71827 carboxyl-terminal proteinase - Helicobacter py...    92   1e-17   Helicobacter pylori J99
sp|Q44879|CTPA_BARBA|CTPA_BARBA Carboxy-terminal processing protease precur...    92   1e-17   Bartonella bacilliformis
gb:AY062767_1565423 Arabidopsis thaliana carboxy-terminal protei...    89   1e-17   
gb:AY056397_1563705 Arabidopsis thaliana AT5g46390/MPL12_19 mRNA...    89   1e-17   
gb:AE012095_279296 Xanthomonas campestris pv. campestris str. AT...    92   1e-17   
gb:AP006840_567249 Symbiobacterium thermophilum DNA, complete ge...    92   2e-17   
gb:AE016938_362402 Bacteroides thetaiotaomicron VPI-5482, sectio...    92   2e-17   
gb:CP000027_79371 Dehalococcoides ethenogenes 195, complete genome.    92   2e-17   
gb:CP000009_862359 Gluconobacter oxydans 621H, complete genome.        91   2e-17   
gb:AE016944_363625 Bacteroides thetaiotaomicron VPI-5482, sectio...    91   2e-17   
pir|D89919|D89919 hypothetical protein ctpA [imported] - Staphyl...    91   2e-17   Staphylococcus aureus subsp. aureus N315
gb:BX571856_780873 Staphylococcus aureus subsp. aureus strain MR...    91   3e-17   
gb:BA000033_711602 Staphylococcus aureus subsp. aureus MW2 DNA, ...    91   3e-17   
gb:CP000046_91585 Staphylococcus aureus subsp. aureus COL, compl...    91   3e-17   
gb:CP000029_81601 Staphylococcus epidermidis RP62A, complete gen...    91   3e-17   
pir|A87675|A87675 carboxyl-terminal proteinase [imported] - Caul...    91   3e-17   Caulobacter vibrioides
gb:BA000043_739749 Geobacillus kaustophilus HTA426 DNA, complete...    91   4e-17   
gb:AP006841_575061 Bacteroides fragilis YCH46 DNA, complete genome.    90   5e-17   
gb:AE016747_322763 Staphylococcus epidermidis ATCC 12228, sectio...    90   5e-17   
gb:BSORFRM1_750751 B.subtilis orfRM1 DNA.                              90   7e-17   
pir|A82525|A82525 carboxyl-terminal proteinase XF2704 [imported]...    90   7e-17   Xylella fastidiosa
gb:AE017178_397984 Porphyromonas gingivalis W83 section 7 of 8 o...    89   9e-17   
gb:AE012561_285429 Xylella fastidiosa Temecula1, section 9 of 9 ...    89   1e-16   
pir|F72340|F72340 probable carboxyl-terminal processing proteina...    89   1e-16   Thermotoga maritima
pir|G84099|G84099 carboxy-terminal processing proteinase BH3599 ...    87   3e-16   Bacillus halodurans
gb:AE016964_368725 Coxiella burnetii strain RSA 493, section 5 o...    87   4e-16   
pir|AC1678|AC1678 carboxy-terminal processing proteinase homolog...    87   4e-16   Listeria innocua
gb:CP000009_863267 Gluconobacter oxydans 621H, complete genome.        87   6e-16   
gb:AE013202_290162 Thermoanaerobacter tengcongensis MB4, section...    86   1e-15   
gb:CP000013_869592 Borrelia garinii PBi, complete genome.              84   3e-15   
gb:CP000010_867299 Burkholderia mallei ATCC 23344 chromosome 1, ...    84   3e-15   
gb:BX571965_790218 Burkholderia pseudomallei strain K96243, chro...    84   3e-15   
gb:BX572594_800206 Rhodopseudomonas palustris CGA009 complete ge...    84   4e-15   
gb:AE017295_434431 Leptospira interrogans serovar Copenhageni st...    84   5e-15   
gb:AE011330_271749 Leptospira interrogans serovar lai str. 56601...    84   5e-15   
pir|F70144|F70144 carboxyl-terminal processing proteinase (ctp) ...    84   5e-15   Borreliella burgdorferi
gb:BA000016_673341 Clostridium perfringens str. 13 DNA, complete...    83   6e-15   
gb:CP000025_878386 Campylobacter jejuni RM1221, complete genome.       83   8e-15   
gb:AE012970_287715 Chlorobium tepidum TLS section 191 of 194 of ...    83   8e-15   
pir|H81396|H81396 probable secreted proteinase Cj0511 [imported]...    83   8e-15   Campylobacter jejuni
gb:AE017328_444300 Listeria monocytogenes str. 4b F2365, section...    82   1e-14   
gb:AE015939_320038 Clostridium tetani E88, section 4 of 10 of th...    82   1e-14   
pir|AC1306|AC1306 carboxy-terminal processing proteinase homolog...    82   1e-14   Listeria monocytogenes
gb:AE012878_286646 Chlorobium tepidum TLS section 99 of 194 of t...    82   2e-14   
gb:BA000043_739669 Geobacillus kaustophilus HTA426 DNA, complete...    80   4e-14   
gb:BX908798_829770 Parachlamydia-related symbiont UWE25, complet...    80   7e-14   
gb:NGU11547_152693 Neisseria gonorrhoeae MS11 UvrB (uvrB) gene, ...    79   2e-13   
gb:BX842648_823934 Bdellovibrio bacteriovorus complete genome, s...    78   2e-13   
gb:AP006627_565380 Bacillus clausii KSM-K16 DNA, complete genome.      77   4e-13   
gb:AE017203_404315 Lactobacillus johnsonii NCC 533, section 4 of...    77   6e-13   
pir|C83238|C83238 periplasmic tail-specific proteinase PA3257 [i...    76   1e-12   Pseudomonas aeruginosa
gb:AX930250_1483905 Sequence 15 from Patent WO03087149.>gb:AX954...    75   2e-12   
gb:AE017333_449543 Bacillus licheniformis DSM 13, complete genom...    75   2e-12   
pir|E70042|E70042 carboxy-terminal processing proteinase homolog...    75   2e-12   Bacillus subtilis
gb:CR522870_101922 Desulfotalea psychrophila LSv54 chromosome.         74   3e-12   
gb:BX842655_826289 Bdellovibrio bacteriovorus complete genome, s...    74   4e-12   
gb:AE016780_331154 Pseudomonas putida KT2440 section 7 of 21 of ...    74   5e-12   
gb:AE016994_374253 Chlamydophila caviae GPIC section 1 of 4 of t...    72   1e-11   
gb:AE016870_353263 Pseudomonas syringae pv. tomato str. DC3000 s...    72   1e-11   
gb:AE017159_393918 Chlamydophila pneumoniae TW-183, section 3 of...    72   2e-11   
gb:AE016827_342450 Mannheimia succiniciproducens MBEL55E, comple...    72   2e-11   
gb:AE012868_286529 Chlorobium tepidum TLS section 89 of 194 of t...    72   2e-11   
pir|G86559|G86559 tail-specific proteinase [imported] - Chlamydo...    72   2e-11   Chlamydia pneumoniae
pir|B81673|B81673 tail specific proteinase precursor, probable T...    70   4e-11   Chlamydia muridarum [agent of mouse pneumonitis]
pir|B71515|B71515 probable tail-specific proteinase - Chlamydia ...    70   5e-11   Chlamydia trachomatis
gb:AE017153_392493 Haemophilus ducreyi strain 35000HP section 3 ...    69   9e-11   
gb:CP000001_855467 Bacillus cereus ZK, complete genome.                68   2e-10   
gb:BX908798_829802 Parachlamydia-related symbiont UWE25, complet...    68   3e-10   
gb:AE017280_426488 Bacillus cereus ATCC 10987, section 17 of 18 ...    67   4e-10   
gb:AE017225_410398 Bacillus anthracis str. Sterne, complete geno...    67   4e-10   
gb:AE017040_385313 Bacillus anthracis str. Ames section 17 of 18...    67   4e-10   
gb:AE012464_282676 Xanthomonas campestris pv. campestris str. AT...    67   4e-10   
gb:AE011695_275629 Xanthomonas axonopodis pv. citri str. 306, se...    67   4e-10   
gb:AE006061_215157 Pasteurella multocida subsp. multocida str. P...    67   5e-10   
gb:BA000028_696877 Oceanobacillus iheyensis HTE831 DNA, complete...    67   6e-10   
gb:AE017340_457036 Idiomarina loihiensis L2TR, complete genome.        66   8e-10   
gb:AE013598_297651 Xanthomonas oryzae pv. oryzae KACC10331, comp...    66   8e-10   
gb:AE016761_326245 Escherichia coli CFT073 section 7 of 18 of th...    66   1e-09   
gb:CP000026_75883 Salmonella enterica subsp. enterica serovar Pa...    66   1e-09   
sp|P43669|PRC_SALTY|PRC_SALTY Tail-specific protease precursor (EC 3.4.21....    66   1e-09   Salmonella enterica subsp. enterica serovar Typhimurium
gb:CP000020_871456 Vibrio fischeri ES114 chromosome I, complete ...    65   1e-09   
gb:AE016983_371339 Shigella flexneri 2a str. 2457T section 6 of ...    65   1e-09   
gb:ECOPRC_129848 Escherichia coli prc gene involved in the C-ter...    65   1e-09   
gb:ECOPRC_129847 Escherichia coli prc gene involved in the C-ter...    65   1e-09   
gb:D90827_123074 E.coli genomic DNA, Kohara clone #336(41.2-41.6...    65   1e-09   
gb:AE005674_70977 Shigella flexneri 2a str. 301, complete genome.      65   1e-09   
pir|D90946|D90946 hypothetical protein ECs2540 [imported] - Esch...    65   1e-09   Escherichia coli O157:H7
sp|P23865|PRC_ECOLI|PRC_ECOLI Tail-specific protease precursor (EC 3.4.21....    65   1e-09   Escherichia coli [E. coli]
gb:BX936398_837019 Yersinia pseudotuberculosis IP32953 genome, c...    65   2e-09   
gb:BA000031_707066 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    65   2e-09   
gb:AE013790_300176 Yersinia pestis KIM section 190 of 415 of the...    65   2e-09   
pir|AI0207|AI0207 tail-specific proteinase precursor (EC 3.4.21....    65   2e-09   Yersinia pestis Nepal516
gb:AE017014_380005 Bacillus cereus ATCC 14579 section 17 of 18 o...    65   2e-09   
gb:BX950851_841197 Erwinia carotovora subsp. atroseptica SCRI104...    64   3e-09   
gb:AE016805_337244 Vibrio vulnificus CMCP6 chromosome I section ...    64   3e-09   
gb:BA000037_722473 Vibrio vulnificus YJ016 DNA, chromosome I, co...    64   4e-09   
pir|AE0728|AE0728 tail-specific protease precursor [imported] - ...    64   4e-09   Salmonella enterica subsp. enterica serovar Typhi
gb:BX571868_787539 Photorhabdus luminescens subsp. laumondii TTO...    62   1e-08   
gb:AE012557_284450 Xylella fastidiosa Temecula1, section 5 of 9 ...    62   1e-08   
pir|F82634|F82634 tail-specific proteinase XF1823 [imported] - X...    62   1e-08   Xylella fastidiosa
gb:CR378669_95302 Photobacterium profundum SS9; segment 7/12.          61   3e-08   
sp|P45306|PRC_HAEIN|PRC_HAEIN Tail-specific protease precursor (EC 3.4.21....    60   4e-08   Haemophilus influenzae
pir|C82192|C82192 tail-specific proteinase VC1496 [imported] - V...    60   6e-08   Vibrio cholerae
gb:AE015702_316970 Shewanella oneidensis MR-1 section 251 of 457...    59   1e-07   
gb:BX294154_771684 Pirellula sp. strain 1 complete genome; segme...    57   6e-07   
gb:BA000045_741600 Gloeobacter violaceus PCC 7421 DNA, complete ...    55   1e-06   
gb:AE012556_284361 Xylella fastidiosa Temecula1, section 4 of 9 ...    55   1e-06   
pir|F82630|F82630 hypothetical protein XF1854 [imported] - Xylel...    54   5e-06   Xylella fastidiosa
gb:AE012556_284360 Xylella fastidiosa Temecula1, section 4 of 9 ...    52   1e-05   
gb:NMY14299_155995 Neisseria meningitidis uvrB gene.                   52   2e-05   
gb:CR543861_102573 Acinetobacter sp. ADP1 complete genome.             50   6e-05   
pir|AC2317|AC2317 hypothetical protein all4090 [imported] - Nost...    50   6e-05   Nostoc sp. PCC 7120
gb:AB032855_2044844 Apodemus argenteus irbp gene for interphotor...    49   1e-04   
gb:AY326093_2083571 Mastomys natalensis interphotoreceptor retin...    48   2e-04   
gb:AY227616_2080022 Sciurillus pusillus kuhlii isolate Spu3 inte...    48   3e-04   
gb:AY163591_2077337 Mesocricetus auratus interphotoreceptor reti...    48   3e-04   
gb:AB164047_2049514 Mesocricetus auratus irbp gene for interphot...    48   3e-04   
gb:AB096854_2048195 Apodemus wardi irbp gene for interphotorecep...    48   3e-04   
gb:AF025390_1411928 Erinaceus europaeus interphotoreceptor retin...    48   3e-04   
gb:AB125811_2048909 Mus terricolor irbp gene for interphotorecep...    47   4e-04   
gb:AB032863_2044852 Apodemus sylvaticus irbp gene for interphoto...    47   4e-04   
gb:AB125803_2048901 Mus cookii irbp gene for interphotoreceptor ...    47   5e-04   
gb:AB096853_2048194 Apodemus uralensis irbp gene for interphotor...    47   5e-04   
gb:AB032861_2044850 Apodemus alpicola irbp gene for interphotore...    47   5e-04   
gb:AY227607_2080013 Ratufa affinis isolate Raf interphotorecepto...    47   6e-04   
gb:TSP427231_2140125 Tachyoryctes sp. partial irbp gene for inte...    46   8e-04   
gb:AY326103_2083581 Phloeomys cumingi interphotoreceptor retinoi...    46   8e-04   
gb:AY326088_2083566 Hylomyscus denniae interphotoreceptor retino...    46   8e-04   
gb:AY227592_2079998 Protoxerus stangeri isolate Pst1 interphotor...    46   8e-04   
gb:AY227589_2079995 Epixerus wilsoni isolate Ewi interphotorecep...    46   8e-04   
gb:AY227586_2079992 Spermophilus lateralis isolate Sla1 interpho...    46   8e-04   
gb:AB125816_2048914 Mus platythrix irbp gene for interphotorecep...    46   8e-04   
gb:AB125813_2048911 Mus fragilicauda irbp gene for interphotorec...    46   8e-04   
gb:AB125804_2048902 Mus cookii irbp gene for interphotoreceptor ...    46   8e-04   
gb:AB125802_2048900 Mus cookii irbp gene for interphotoreceptor ...    46   8e-04   
gb:AB125801_2048899 Mus cervicolor irbp gene for interphotorecep...    46   8e-04   
gb:AB125800_2048898 Mus cervicolor irbp gene for interphotorecep...    46   8e-04   
gb:AB125799_2048897 Mus cervicolor irbp gene for interphotorecep...    46   8e-04   
gb:AB125798_2048896 Mus caroli irbp gene for interphotoreceptor ...    46   8e-04   
gb:AB125797_2048895 Mus caroli irbp gene for interphotoreceptor ...    46   8e-04   
gb:AB125795_2048893 Mus booduga irbp gene for interphotoreceptor...    46   8e-04   
gb:AF271423_1894075 Tarsius bancanus interphotoreceptor retinoid...    46   8e-04   
gb:RNO429134_2135974 Rattus norvegicus partial irbp gene for int...    46   0.001   
gb:DSA427232_2112772 Dipus sagitta partial irbp gene for interph...    46   0.001   
gb:AY326112_2083590 Tachyoryctes splendens interphotoreceptor re...    46   0.001   
gb:AY326105_2083583 Rattus exulans interphotoreceptor retinoid-b...    46   0.001   
gb:AY326104_2083582 Praomys delectorum interphotoreceptor retino...    46   0.001   
gb:AY326094_2083572 Maxomys whiteheadi interphotoreceptor retino...    46   0.001   
gb:AY326086_2083564 Grammomys macmillani interphotoreceptor reti...    46   0.001   
gb:AY326084_2083562 Deomys ferrugineus interphotoreceptor retino...    46   0.001   
gb:AY326075_2083553 Aethomys chrysophilus interphotoreceptor ret...    46   0.001   
gb:AY277416_2081462 Scotinomys xerampelinus voucher MVZ 192158 i...    46   0.001   
gb:AY277414_2081460 Reithrodontomys megalotis voucher MVZ 148519...    46   0.001   
gb:AY227617_2080023 Sciurillus pusillus isolate Spu4 interphotor...    46   0.001   
gb:AY227594_2080000 Aeromys tephromelas isolate Ate interphotore...    46   0.001   
gb:AY227575_2079981 Rhinosciurus laticaudatus isolate Rla interp...    46   0.001   
gb:AY227572_2079978 Menetes berdmorei isolate Mbe interphotorece...    46   0.001   
gb:AMY311158_2073216 Apodemus mystacinus partial irbp gene for I...    46   0.001   
gb:AF297285_2061957 Dipus sagitta interphotoreceptor binding pro...    46   0.001   
gb:AB096856_2048197 Rattus tanezumi irbp gene for interphotorece...    46   0.001   
gb:AB096846_2048187 Apodemus chevrieri irbp gene for interphotor...    46   0.001   
gb:AB033714_2044900 Rattus norvegicus gene for interphotorecepto...    46   0.001   
gb:AB033712_2044898 Tokudaia osimensis irbp gene for interphotor...    46   0.001   
gb:AB032859_2044848 Apodemus gurkha irbp gene for interphotorece...    46   0.001   
gb:AB032857_2044846 Apodemus peninsulae irbp gene for interphoto...    46   0.001   
gb:DMA313468_1995575 Daubentonia madagascariensis partial irbp g...    46   0.001   
gb:AF271422_1894074 Daubentonia madagascariensis interphotorecep...    46   0.001   
gb:GGL427235_2112907 Glis glis partial irbp gene for interphotor...    45   0.001   
gb:AY326095_2083573 Meriones unguiculatus interphotoreceptor ret...    45   0.001   
gb:AY326082_2083560 Cricetulus longicaudatus interphotoreceptor ...    45   0.001   
gb:AY277417_2081463 Tylomys sp. USNM 464887 interphotoreceptor r...    45   0.001   
gb:AY277408_2081454 Baiomys taylori voucher NK 3696 interphotore...    45   0.001   
gb:AY227608_2080014 Ratufa bicolor isolate Rbi interphotorecepto...    45   0.001   
gb:AY227584_2079990 Cynomys leucurus isolate Clu1 interphotorece...    45   0.001   
gb:AY227583_2079989 Ammospermophilus harrisii isolate Aha interp...    45   0.001   
gb:AY227577_2079983 Sundasciurus brookei isolate Sbr interphotor...    45   0.001   
gb:AY227570_2079976 Hyosciurus heinrichi isolate Hhe2 interphoto...    45   0.001   
gb:AY227567_2079973 Dremomys rufigenis isolate Dru1 interphotore...    45   0.001   
gb:AF297278_2061950 Spermophilus tridecemlineatus interphotorece...    45   0.001   
gb:AB033710_2044896 Micromys minutus irbp gene for interphotorec...    45   0.001   
gb:AB032860_2044849 Apodemus flavicollis irbp gene for interphot...    45   0.001   
gb:AY434088_1950614 Gorilla gorilla voucher 98-2156 interphotore...    45   0.001   
gb:AY532669_1431163 Dasykaluta rosamondae interphotoreceptor bin...    45   0.001   
gb:MMZ427242_2124607 Massoutiera mzabi partial irbp gene for int...    45   0.002   
gb:AY326098_2083576 Napaeozapus insignis interphotoreceptor reti...    45   0.002   
gb:AY303220_2081901 Pedetes capensis interphotoreceptor-binding ...    45   0.002   
gb:AY277411_2081457 Neotoma albigula voucher MVZ 147667 interpho...    45   0.002   
gb:AY277410_2081456 Cricetus cricetus voucher MVZ 155880 interph...    45   0.002   
gb:AY227576_2079982 Rubrisciurus rubriventer isolate Rru2 interp...    45   0.002   
gb:AY227571_2079977 Lariscus insignis isolate Lin interphotorece...    45   0.002   
gb:AY163643_2077389 Tylomys nudicaudus interphotoreceptor retino...    45   0.002   
gb:AY163599_2077345 Neotoma lepida interphotoreceptor retinoid b...    45   0.002   
gb:ASP427230_2073248 Anomalurus sp. partial irbp gene for interp...    45   0.002   
gb:AB125815_2048913 Mus mattheyi irbp gene for interphotorecepto...    45   0.002   
gb:AB096848_2048189 Apodemus chevrieri irbp gene for interphotor...    45   0.002   
gb:AB096847_2048188 Apodemus chevrieri irbp gene for interphotor...    45   0.002   
gb:AB096845_2048186 Apodemus agrarius irbp gene for interphotore...    45   0.002   
gb:AB096843_2048184 Apodemus agrarius irbp gene for interphotore...    45   0.002   
gb:AB096842_2048183 Apodemus agrarius irbp gene for interphotore...    45   0.002   
gb:AB032858_2044847 Apodemus agrarius irbp gene for interphotore...    45   0.002   
gb:AY434081_1950607 Lepilemur ruficaudatus voucher SMG7395M inte...    45   0.002   
gb:AF081065_1881491 Eulemur rubriventer interphotoreceptor retin...    45   0.002   
gb:AF081063_1881489 Eulemur macaco flavifrons interphotoreceptor...    45   0.002   
gb:AF081062_1881488 Eulemur macaco macaco interphotoreceptor ret...    45   0.002   
gb:AF081060_1881486 Eulemur fulvus rufus interphotoreceptor reti...    45   0.002   
gb:AF081059_1881485 Eulemur fulvus collaris interphotoreceptor r...    45   0.002   
gb:BAU50820_1434915 Balaenoptera acutorostrata interphotorecepto...    45   0.002   
gb:AF304081_1417986 Pontoporia blainvillei interphotoreceptor re...    45   0.002   
gb:AF108837_1414275 Hippopotamus amphibius interphotoreceptor re...    45   0.002   
gb:AY326074_2083552 Acomys spinosissimus interphotoreceptor reti...    45   0.002   
gb:AY227578_2079984 Tamiops swinhoei isolate Tsw interphotorecep...    45   0.002   
gb:AY163603_2077349 Nyctomys sumichrasti interphotoreceptor reti...    45   0.002   
gb:AB125812_2048910 Mus fragilicauda irbp gene for interphotorec...    45   0.002   
gb:AB096851_2048192 Apodemus latronum irbp gene for interphotore...    45   0.002   
gb:LCA313470_2038450 Lemur catta partial irbp gene for interphot...    45   0.002   
gb:HUMIRBPG_2033811 Homo sapiens interstitial retinol-binding pr...    45   0.002   
gb:HSIRBPG_2015516 Human gene for interphotoreceptor retinoid-bi...    45   0.002   
gb:HLA313478_1996198 Hylobates lar partial irbp gene for interph...    45   0.002   
gb:BC039844_1982651 Homo sapiens retinol binding protein 3, inte...    45   0.002   
gb:AY434085_1950611 Macaca fuscata voucher AGR-22 interphotorece...    45   0.002   
gb:AF081064_1881490 Eulemur mongoz interphotoreceptor retinoid b...    45   0.002   
gb:AF081061_1881487 Eulemur fulvus albifrons interphotoreceptor ...    45   0.002   
gb:AF081058_1881484 Lemur catta interphotoreceptor retinoid bind...    45   0.002   
gb:AF081057_1881483 Hapalemur griseus interphotoreceptor retinoi...    45   0.002   
gb:LCR427250_1440599 Lepus crawshayi partial irbp gene for inter...    45   0.002   
gb:AY532686_1431180 Phascolosorex dorsalis interphotoreceptor bi...    45   0.002   
gb:AF231342_1416488 Phocoenoides dalli interphotoreceptor retino...    45   0.002   
gb:AF231340_1416486 Phocoena phocoena interphotoreceptor retinoi...    45   0.002   
gb:AF025386_1411924 Vombatus ursinus interphotoreceptor retinoid...    45   0.002   
gb:AB109331_1410628 Mephitis mephitis IRBP gene for interphotore...    45   0.002   
sp|P10745|IRBP_HUMAN|IRBP_HUMAN Interphotoreceptor retinoid-binding protein...    45   0.002   
gb:AY682090_2087647 Mus musculus strain 129/Sv interphotorecepto...    44   0.003   
gb:AY326111_2083589 Sundamys muelleri interphotoreceptor retinoi...    44   0.003   
gb:AY326108_2083586 Rhynchomys isarogensis interphotoreceptor re...    44   0.003   
gb:AY277415_2081461 Scotinomys teguina voucher MVZ 191230 interp...    44   0.003   
gb:AY227603_2080009 Pteromyscus pulverulentus isolate Ppu3 inter...    44   0.003   
gb:AY227580_2079986 Funambulus pennanti isolate Fpe1 interphotor...    44   0.003   
gb:AY227579_2079985 Funambulus palmarum isolate Fpa interphotore...    44   0.003   
gb:AY163640_2077386 Sigmodon alstoni interphotoreceptor retinoid...    44   0.003   
gb:AY163639_2077385 Scotinomys teguina interphotoreceptor retino...    44   0.003   
gb:AY163581_2077327 Calomyscus baluchi interphotoreceptor retino...    44   0.003   
gb:AY163580_2077326 Calomys lepidus interphotoreceptor retinoid ...    44   0.003   
gb:AF297287_2061959 Zapus princeps interphotoreceptor binding pr...    44   0.003   
gb:AF297283_2061955 Rhizomys pruinosus interphotoreceptor bindin...    44   0.003   
gb:AB125805_2048903 Mus macedonicus irbp gene for interphotorece...    44   0.003   
gb:AB033711_2044897 Mus musculus irbp gene for interphotorecepto...    44   0.003   
gb:MMU313476_2039401 Macaca mulatta partial irbp gene for interp...    44   0.003   
gb:AF271418_1894070 Loris tardigradus interphotoreceptor retinoi...    44   0.003   
gb:GMU50821_1440240 Globicephala macrorhynchus interphotorecepto...    44   0.003   
gb:ERU50649_1439938 Eschrichtius robustus interphotoreceptor ret...    44   0.003   
gb:AY532673_1431167 Pseudantechinus roryi interphotoreceptor bin...    44   0.003   
gb:AF304087_1417992 Balaena mysticetus interphotoreceptor retino...    44   0.003   
gb:AF304086_1417991 Megaptera novaeangliae interphotoreceptor re...    44   0.003   
gb:AF304085_1417990 Mesoplodon peruvianus interphotoreceptor ret...    44   0.003   
gb:AF304083_1417988 Lipotes vexillifer interphotoreceptor retino...    44   0.003   
gb:AF304080_1417985 Inia geoffrensis interphotoreceptor retinoid...    44   0.003   
gb:AF304079_1417984 Sotalia fluviatilis interphotoreceptor retin...    44   0.003   
gb:AF304077_1417982 Delphinus delphis interphotoreceptor retinoi...    44   0.003   
gb:AF231343_1416489 Ziphius cavirostris interphotoreceptor retin...    44   0.003   
gb:AF231341_1416487 Delphinapterus leucas interphotoreceptor ret...    44   0.003   
sp|P49194|IRBP_MOUSE|IRBP_MOUSE Interphotoreceptor retinoid-binding protein...    44   0.003   
gb:AY326107_2083585 Rhizomys pruinosus interphotoreceptor retino...    44   0.004   
gb:AY326100_2083578 Niviventer confucianus interphotoreceptor re...    44   0.004   
gb:AY326090_2083568 Lophiomys imhausi interphotoreceptor retinoi...    44   0.004   
gb:AY303219_2081900 Graphiurus murinus interphotoreceptor-bindin...    44   0.004   
gb:AY277443_2081489 Delomys sublineatus voucher MVZ 183075 inter...    44   0.004   
gb:AY277413_2081459 Peromyscus truei voucher MVZ 157329 interpho...    44   0.004   
gb:AY227620_2080026 Sciurus vulgaris isolate Svu interphotorecep...    44   0.004   
gb:AY227619_2080025 Sciurus variegatoides isolate Sva1 interphot...    44   0.004   
gb:AY227615_2080021 Sciurus ignitus argentinius isolate Sin5 int...    44   0.004   
gb:AY227614_2080020 Sciurus griseus isolate Sgs interphotorecept...    44   0.004   
gb:AY227611_2080017 Rheithrosciurus macrotis isolate Rma3 interp...    44   0.004   
gb:AY227610_2080016 Microsciurus flaviventer sabanillae isolate ...    44   0.004   
gb:AY227609_2080015 Microsciurus alfari isolate Mal2 interphotor...    44   0.004   
gb:AY227587_2079993 Tamias sibiricus isolate Tsb2 interphotorece...    44   0.004   
gb:AY227574_2079980 Prosciurillus murinus isolate Pmu4 interphot...    44   0.004   
gb:AY227565_2079971 Graphiurus murinus isolate Gmu interphotorec...    44   0.004   
gb:AB125796_2048894 Mus booduga irbp gene for interphotoreceptor...    44   0.004   
gb:AF081056_1881482 Varecia variegata variegata interphotorecept...    44   0.004   
gb:AF081055_1881481 Varecia variegata rubra interphotoreceptor r...    44   0.004   
gb:ECU48710_1439777 Equus caballus interphotoreceptor retinoid b...    44   0.004   
gb:CSU48709_1439045 Cynopterus sphinx interphotoreceptor retinoi...    44   0.004   
gb:AY525044_1431070 Canis lupus interphotoreceptor retinoid-bind...    44   0.004   
gb:AY525043_1431069 Zalophus californianus interphotoreceptor re...    44   0.004   
gb:AY170077_1426120 Erignathus barbatus specimen-voucher AF-1417...    44   0.004   
gb:AY170074_1426117 Canis lupus specimen-voucher LSUMZ-28905 int...    44   0.004   
gb:AF179293_1415594 Vulpes velox interphotoreceptor retinoid bin...    44   0.004   
gb:PTY427244_2131242 Petromus typicus partial irbp gene for inte...    44   0.005   
gb:DNI427236_2112764 Dryomys nitedula partial irbp gene for inte...    44   0.005   
gb:AY277479_2081525 Sigmodon hispidus voucher NK 27055 interphot...    44   0.005   
gb:AY277412_2081458 Onychomys torridus voucher MVZ 196051 interp...    44   0.005   
gb:AY227591_2079997 Myosciurus pumilio isolate Mpu4 interphotore...    44   0.005   
gb:AY227590_2079996 Heliosciurus ruwenzorii isolate Hrw interpho...    44   0.005   
gb:AY227581_2079987 Funisciurus pyrropus isolate Fpy1 interphoto...    44   0.005   
gb:AY227568_2079974 Exilisciurus concinnus isolate Eco interphot...    44   0.005   
gb:AY227564_2079970 Aplodontia rufa isolate Aru1 interphotorecep...    44   0.005   
gb:AY163630_2077376 Peromyscus maniculatus interphotoreceptor re...    44   0.005   
gb:ARU427238_2073227 Aplodontia rufa partial irbp gene for inter...    44   0.005   
gb:AF297286_2061958 Dryomys nitedula interphotoreceptor binding ...    44   0.005   
gb:AF297284_2061956 Aplodontia rufa interphotoreceptor binding p...    44   0.005   
gb:AB109398_2048414 Apodemus draco IRBP gene for interphotorecep...    44   0.005   
gb:AB096850_2048191 Apodemus draco irbp gene for interphotorecep...    44   0.005   
gb:AB032862_2044851 Apodemus semotus irbp gene for interphotorec...    44   0.005   
gb:AB032856_2044845 Apodemus speciosus irbp gene for interphotor...    44   0.005   
gb:NCO313467_2039693 Nycticebus coucang partial irbp gene for in...    44   0.005   
gb:MMU313469_2039400 Microcebus murinus partial irbp gene for in...    44   0.005   
gb:AY434084_1950610 Colobus guereza voucher 9641 interphotorecep...    44   0.005   
gb:AY532687_1431181 Neophascogale lorentzii interphotoreceptor b...    44   0.005   
gb:AY525041_1431067 Panthera pardus interphotoreceptor retinoid-...    44   0.005   
gb:AY525039_1431065 Otocolobus manul interphotoreceptor retinoid...    44   0.005   
gb:AY525037_1431063 Panthera tigris interphotoreceptor retinoid-...    44   0.005   
gb:AY525036_1431062 Panthera leo interphotoreceptor retinoid-bin...    44   0.005   
gb:AY525034_1431060 Catopuma temminckii interphotoreceptor retin...    44   0.005   
gb:AY525033_1431059 Felis bieti interphotoreceptor retinoid-bind...    44   0.005   
gb:AY525032_1431058 Neofelis nebulosa interphotoreceptor retinoi...    44   0.005   
gb:AY243436_1427855 Phalanger orientalis interphotoreceptor reti...    44   0.005   
gb:AY233769_1427506 Marmosa lepida FC4928 interphotoreceptor ret...    44   0.005   
gb:AY170087_1426130 Crocuta crocuta specimen-voucher LF-Sargent ...    44   0.005   
gb:AY170073_1426116 Panthera leo specimen-voucher SDZ-31694 inte...    44   0.005   
gb:AY170072_1426115 Felis silvestris specimen-voucher SDZ-32188 ...    44   0.005   
gb:AF304084_1417989 Kogia simus interphotoreceptor retinoid-bind...    44   0.005   
gb:AF257699_1416966 Marmosops noctivagus specimen-voucher RSV222...    44   0.005   
gb:AB109338_1410635 Panthera tigris IRBP gene for interphotorece...    44   0.005   
gb:AB109337_1410634 Panthera pardus IRBP gene for interphotorece...    44   0.005   
gb:AB109336_1410633 Panthera leo IRBP gene for interphotorecepte...    44   0.005   
gb:AB109335_1410632 Leopardus pardalis IRBP gene for interphotor...    44   0.005   
sp|P12661|IRBP_BOVIN|IRBP_BOVIN Interphotoreceptor retinoid-binding protein...    44   0.005   
gb:AY326089_2083567 Hypogeomys antimena interphotoreceptor retin...    43   0.007   
gb:AY326087_2083565 Gymnuromys roberti interphotoreceptor retino...    43   0.007   
gb:AY326080_2083558 Clethrionomys gapperi interphotoreceptor ret...    43   0.007   
gb:AY277483_2081529 Thomasomys aureus voucher MVZ 170076 interph...    43   0.007   
gb:AY277454_2081500 Kunsia tomentosus voucher LHE 1619 interphot...    43   0.007   
gb:AY227621_2080027 Sciurotamias davidianus isolate Sda interpho...    43   0.007   
gb:AY227582_2079988 Paraxerus alexandri isolate Pax interphotore...    43   0.007   
gb:AY163635_2077381 Rheomys raptor interphotoreceptor retinoid b...    43   0.007   
gb:AY163593_2077339 Microtus sikimensis interphotoreceptor retin...    43   0.007   
gb:AY163583_2077329 Eothenomys melanogaster interphotoreceptor r...    43   0.007   
gb:AY163582_2077328 Delomys sublineatus interphotoreceptor retin...    43   0.007   
gb:AB125810_2048908 Mus terricolor irbp gene for interphotorecep...    43   0.007   
gb:AB125809_2048907 Mus spicilegus irbp gene for interphotorecep...    43   0.007   
gb:AB096855_2048196 Mus pahari irbp gene for interphotoreceptor ...    43   0.007   
gb:AB096852_2048193 Apodemus latronum irbp gene for interphotore...    43   0.007   
gb:CAP313473_1992034 Cebus apella partial irbp gene for interpho...    43   0.007   
gb:AY434080_1950606 Mirza coquereli voucher DUPC384F interphotor...    43   0.007   
gb:APA313474_1933568 Ateles paniscus partial irbp gene for inter...    43   0.007   
gb:AF271419_1894071 Nycticebus coucang interphotoreceptor retino...    43   0.007   
gb:AF081054_1881480 Microcebus murinus interphotoreceptor retino...    43   0.007   
gb:KBU50819_1440515 Kogia breviceps interphotoreceptor retinoid-...    43   0.007   
gb:AY532685_1431179 Sarcophilus harrisii interphotoreceptor bind...    43   0.007   
gb:AY525045_1431071 Ailurus fulgens interphotoreceptor retinoid-...    43   0.007   
gb:AY525040_1431066 Paguma larvata interphotoreceptor retinoid-b...    43   0.007   
gb:AY233783_1427520 Monodelphis theresa MAM160 interphotorecepto...    43   0.007   
gb:AY233776_1427513 Marmosa rubra JLP6930 interphotoreceptor ret...    43   0.007   
gb:AY233775_1427512 Marmosa robinsoni TK22555 interphotoreceptor...    43   0.007   
gb:AY233774_1427511 Marmosa robinsoni TK22552 interphotoreceptor...    43   0.007   
gb:AY233773_1427510 Marmosa murina TK17387 interphotoreceptor re...    43   0.007   
gb:AY233771_1427508 Marmosa mexicana FN34135 interphotoreceptor ...    43   0.007   
gb:AY233770_1427507 Marmosa mexicana FN32277 interphotoreceptor ...    43   0.007   
gb:AY170088_1426131 Genetta servalina specimen-voucher JCK-2229 ...    43   0.007   
gb:AY170086_1426129 Paradoxurus hermaphroditus specimen-voucher ...    43   0.007   
gb:AY170085_1426128 Viverra tangalunga specimen-voucher LRH-4121...    43   0.007   
gb:AY170083_1426126 Nandinia binotata specimen-voucher JCK-2623 ...    43   0.007   
gb:AY170082_1426125 Hemigalus derbyanus specimen-voucher C59 int...    43   0.007   
gb:AY170078_1426121 Civettictis civetta specimen-voucher SDZ-312...    43   0.007   
gb:AY170067_1426110 Fossa fossana specimen-voucher SMG-7539 inte...    43   0.007   
gb:AY170066_1426109 Cryptoprocta ferox specimen-voucher CH-25 in...    43   0.007   
gb:AF257710_1416977 Lestodelphys halli specimen-voucher UWZ22422...    43   0.007   
gb:AF257709_1416976 Marmosa murina specimen-voucher RSV2413 inte...    43   0.007   
gb:AF257686_1416953 Gracilinanus microtarsus specimen-voucher MA...    43   0.007   
gb:AB109339_1410636 Paguma larvata IRBP gene for interphotorecep...    43   0.007   
gb:AB082969_1409252 Mustela erminea irbp gene for interphotorece...    43   0.007   
pir|C75413|C75413 probable proteinase - Deinococcus radiodurans ...    43   0.007   
gb:EDO427249_2112798 Erethizon dorsatum partial irbp gene for in...    43   0.009   
gb:AY326110_2083588 Steatomys parvus interphotoreceptor retinoid...    43   0.009   
gb:AY326109_2083587 Saccostomus campestris interphotoreceptor re...    43   0.009   
gb:AY326101_2083579 Otomys anchietae interphotoreceptor retinoid...    43   0.009   
gb:AY326099_2083577 Nesomys rufus interphotoreceptor retinoid-bi...    43   0.009   
gb:AY326083_2083561 Dendromus nyikae interphotoreceptor retinoid...    43   0.009   
gb:AY326078_2083556 Brachytarsomys albicauda interphotoreceptor ...    43   0.009   
gb:AY277450_2081496 Irenomys tarsalis voucher MVZ 155869 interph...    43   0.009   
gb:AY227606_2080012 Trogopterus xanthipes isolate Txa3 interphot...    43   0.009   
gb:AY227601_2080007 Petaurista alborufus isolate Pal1 interphoto...    43   0.009   
gb:AY227597_2080003 Eoglaucomys fimbriatus isolate Efi1 interpho...    43   0.009   
gb:AY227596_2080002 Eupetaurus cinereus isolate Eci1 interphotor...    43   0.009   
gb:AY227595_2080001 Belomys pearsonii isolate Bpe interphotorece...    43   0.009   
gb:AY227593_2079999 Aeretes melanopterus isolate Ame interphotor...    43   0.009   
gb:AY227566_2079972 Callosciurus notatus isolate Cno1 interphoto...    43   0.009   
gb:AY163594_2077340 Mystromys albicaudatus interphotoreceptor re...    43   0.009   
gb:PVE313471_2040169 Propithecus verreauxi partial irbp gene for...    43   0.009   


>gb:AF487527_1804290 Nicotiana plumbaginifolia D1 protease-like
           protein precursor, mRNA, complete cds.
          Length = 467

 Score =  273 bits (698), Expect(2) = 5e-74
 Identities = 132/156 (84%), Positives = 144/156 (92%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GASSFVLDLRDN GGLVQAG+EIAKLFLNEG+TV  TVGRDPQY R+IVAEAPPLIT PV
Sbjct: 312 GASSFVLDLRDNLGGLVQAGIEIAKLFLNEGDTVISTVGRDPQYRRNIVAEAPPLITAPV 371

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           I+LVNK TASASEIVATALHDNCRAVLVGD+TYGKGLIQS FEL DGSGVVVTIGKYVTP
Sbjct: 372 IVLVNKKTASASEIVATALHDNCRAVLVGDKTYGKGLIQSVFELPDGSGVVVTIGKYVTP 431

Query: 468 NHMDINGNGIEPDFRNLPAWNEVSKHLSKCHKPKDG 361
           N++DINGNG++PDFRN PAW+EV+  LSKCHKP+ G
Sbjct: 432 NNLDINGNGVDPDFRNFPAWSEVTNRLSKCHKPQGG 467



 Score = 28.1 bits (61), Expect(2) = 5e-74
 Identities = 12/20 (60%), Positives = 15/20 (75%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRLQG 831
           K    +AR DLVTA+KRL+G
Sbjct: 291 KEFNALARKDLVTAIKRLEG 310



>gb:AF487526_1804289 Triticum aestivum D1 protease-like protein
           precursor, mRNA, partial cds.
          Length = 400

 Score =  231 bits (588), Expect(2) = 2e-60
 Identities = 111/154 (72%), Positives = 130/154 (84%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GAS FVLDLRDN GGLVQAG+EIAKLFLN+G+TV YT GRD Q   +IVA++ PL+TTPV
Sbjct: 245 GASYFVLDLRDNLGGLVQAGIEIAKLFLNKGDTVIYTTGRDRQVQNTIVADSGPLVTTPV 304

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN  TASASEIVA+ALHDNC+AVLVG+RT+GKGLIQS FEL DGSG+VVT+GKYVTP
Sbjct: 305 MVLVNNRTASASEIVASALHDNCKAVLVGERTFGKGLIQSVFELHDGSGIVVTVGKYVTP 364

Query: 468 NHMDINGNGIEPDFRNLPAWNEVSKHLSKCHKPK 367
           NH DING+GIEPD+R LP  NE   +L +C   K
Sbjct: 365 NHKDINGDGIEPDYRRLPDLNEARDYLMRCQSKK 398



 Score = 25.0 bits (53), Expect(2) = 2e-60
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRLQ 834
           K    +A+ DLV+A+KRLQ
Sbjct: 224 KEFNAVAKKDLVSALKRLQ 242



>gb:AB010698_1511230 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPL12.
          Length = 488

 Score =  223 bits (569), Expect(2) = 6e-58
 Identities = 106/138 (76%), Positives = 124/138 (89%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GAS FV+DLRDN GGLVQAG+E AKLFL+EG+TV YT GRDP+  +++V++  PLIT P+
Sbjct: 334 GASYFVMDLRDNLGGLVQAGIETAKLFLDEGDTVIYTAGRDPEAQKTVVSDKKPLITAPL 393

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           I++VN  TASASEIVA+ALHDNC+AVLVG+RTYGKGLIQS +EL+DGSGVVVTIGKYVTP
Sbjct: 394 IVMVNNRTASASEIVASALHDNCKAVLVGERTYGKGLIQSVYELRDGSGVVVTIGKYVTP 453

Query: 468 NHMDINGNGIEPDFRNLP 415
           NHMDING GIEPDFRNLP
Sbjct: 454 NHMDINGGGIEPDFRNLP 471



 Score = 24.3 bits (51), Expect(2) = 6e-58
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRL 837
           K    +AR DLV AMKRL
Sbjct: 313 KEFNALARKDLVIAMKRL 330



>gb:HVPEPD1PR_1682490 H.vulgare mRNA for peptidase of D1 protein.
          Length = 354

 Score =  209 bits (533), Expect(2) = 5e-54
 Identities = 104/155 (67%), Positives = 124/155 (80%), Gaps = 1/155 (0%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GAS FVLDLRDN GGLVQAG+EIAKLFLN+G+TV YT   D Q   +IVA++ PL+TTPV
Sbjct: 198 GASYFVLDLRDNLGGLVQAGIEIAKLFLNKGDTVIYTTAGDRQVQNTIVADSGPLVTTPV 257

Query: 648 IILVNKNTASASEIVATALHDNCRA-VLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVT 472
           ++LVN  TASASEIVA+ALHDNC++ V    RT+GKGLIQS FEL DGSG+VVT+GKYVT
Sbjct: 258 MVLVNNRTASASEIVASALHDNCKSCVSSARRTFGKGLIQSVFELHDGSGIVVTVGKYVT 317

Query: 471 PNHMDINGNGIEPDFRNLPAWNEVSKHLSKCHKPK 367
           PNH DING+GI+PD+R LP  NE   +L +C   K
Sbjct: 318 PNHKDINGDGIKPDYRRLPDLNEARDYLLRCQSKK 352



 Score = 25.0 bits (53), Expect(2) = 5e-54
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRLQ 834
           K    +A+ DLV+A+KRLQ
Sbjct: 177 KEFNAVAKKDLVSALKRLQ 195



>pir|T05975|T05975 probable carboxy-terminal proteinase (EC
           3.4.21.-) D1 - barley (fragment)
          Length = 354

 Score =  209 bits (533), Expect(2) = 5e-54
 Identities = 104/155 (67%), Positives = 124/155 (80%), Gaps = 1/155 (0%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GAS FVLDLRDN GGLVQAG+EIAKLFLN+G+TV YT   D Q   +IVA++ PL+TTPV
Sbjct: 198 GASYFVLDLRDNLGGLVQAGIEIAKLFLNKGDTVIYTTAGDRQVQNTIVADSGPLVTTPV 257

Query: 648 IILVNKNTASASEIVATALHDNCRA-VLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVT 472
           ++LVN  TASASEIVA+ALHDNC++ V    RT+GKGLIQS FEL DGSG+VVT+GKYVT
Sbjct: 258 MVLVNNRTASASEIVASALHDNCKSCVSSARRTFGKGLIQSVFELHDGSGIVVTVGKYVT 317

Query: 471 PNHMDINGNGIEPDFRNLPAWNEVSKHLSKCHKPK 367
           PNH DING+GI+PD+R LP  NE   +L +C   K
Sbjct: 318 PNHKDINGDGIKPDYRRLPDLNEARDYLLRCQSKK 352



 Score = 25.0 bits (53), Expect(2) = 5e-54
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRLQ 834
           K    +A+ DLV+A+KRLQ
Sbjct: 177 KEFNAVAKKDLVSALKRLQ 195



>gb:AP003222_1825521 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0003E08.
          Length = 461

 Score =  195 bits (495), Expect(2) = 1e-49
 Identities = 99/163 (60%), Positives = 120/163 (73%), Gaps = 13/163 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGET-------------VTYTVGRDPQYTRS 688
           GAS FVLDLRDN GGLVQAG+E AKLFLN+G+T             V YT GRD Q   +
Sbjct: 306 GASYFVLDLRDNLGGLVQAGIETAKLFLNKGDTLKVTVHGYYIKMKVIYTAGRDRQVQNT 365

Query: 687 IVAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDG 508
           IVAE  PL+TTP++             VA+ALHDNC+AVLVG++T+GKGLIQS FEL DG
Sbjct: 366 IVAEREPLVTTPLM-------------VASALHDNCKAVLVGEKTFGKGLIQSVFELHDG 412

Query: 507 SGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNEVSKHLSKC 379
           SG+VVT+GKYVTPNH DINGNGIEPD+R +P +NE +++LS+C
Sbjct: 413 SGIVVTVGKYVTPNHKDINGNGIEPDYRRIPDFNEATEYLSRC 455



 Score = 25.0 bits (53), Expect(2) = 1e-49
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRLQ 834
           K    +A+ DLV+A+KRLQ
Sbjct: 285 KEFNAVAKKDLVSALKRLQ 303



>gb:AP008231_581467 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 407

 Score =  150 bits (380), Expect = 2e-35
 Identities = 79/133 (59%), Positives = 97/133 (72%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA +FVLDLR+N GGL+ AG+EIA+ +LNEG  + YTV R      S  A    L   P+
Sbjct: 240 GAEAFVLDLRNNSGGLLTAGIEIAREWLNEG-AIVYTVNRQGVLD-SFAANGQALTDKPL 297

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
            +LVN+ TASASEI+A AL DN RA+LVGDRT+GKGLIQS FEL DG+G+ VT+ +Y TP
Sbjct: 298 ALLVNRGTASASEILAGALQDNERAILVGDRTFGKGLIQSLFELSDGAGLAVTVAEYETP 357

Query: 468 NHMDINGNGIEPD 430
           NH DIN  GI+PD
Sbjct: 358 NHNDINKQGIQPD 370



>pir|AE2233|AE2233 carboxyl-terminal processing proteinase
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_684409 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 417

 Score =  148 bits (373), Expect = 2e-34
 Identities = 80/135 (59%), Positives = 100/135 (74%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           + GA++++LDLR+N GGL+QAG+EIA+ +L+ G T+ YTV R      S  A  P L   
Sbjct: 244 KKGAAAYILDLRNNPGGLLQAGIEIARQWLDSG-TIVYTVNRQG-IQGSFEAFGPALTDD 301

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+IILVN+ TASASEI+A AL DN RA LVG+ T+GKGLIQS FEL DGSG+ VTI KY 
Sbjct: 302 PLIILVNQGTASASEILAGALQDNGRAQLVGETTFGKGLIQSLFELSDGSGLAVTIAKYE 361

Query: 474 TPNHMDINGNGIEPD 430
           TPNH DIN  GI+P+
Sbjct: 362 TPNHRDINKLGIKPN 376



>pir|S26195|S26195 probable carboxyl-terminal processing proteinase
           - Synechococcus sp. (PCC 7002) (fragment)
          Length = 411

 Score =  147 bits (372), Expect = 2e-34
 Identities = 78/135 (57%), Positives = 101/135 (74%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           + GA  +VLDLR+N GGL+QAG+EIA+L+L++ ET+ YTV R   +  S  A   PL   
Sbjct: 241 KQGADRYVLDLRNNPGGLLQAGIEIARLWLDQ-ETIVYTVNRQGIF-ESYSAVGQPLTDA 298

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++LVN+ TASASEI+A AL DN RA+LVG++T+GKGLIQS FEL DG+G+ VT+ KY 
Sbjct: 299 PLVVLVNQATASASEILAGALQDNGRAMLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYE 358

Query: 474 TPNHMDINGNGIEPD 430
           TP H DIN  GI PD
Sbjct: 359 TPLHHDINKLGIMPD 373



>sp|P42784|YPEB_SYNP2 Hypothetical protein in PETB 5'region
           (Fragment).>gb:AQPETBDOP_582475 A.quadruplicatum petBD
           operon.
          Length = 411

 Score =  147 bits (372), Expect = 2e-34
 Identities = 78/135 (57%), Positives = 101/135 (74%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           + GA  +VLDLR+N GGL+QAG+EIA+L+L++ ET+ YTV R   +  S  A   PL   
Sbjct: 241 KQGADRYVLDLRNNPGGLLQAGIEIARLWLDQ-ETIVYTVNRQGIF-ESYSAVGQPLTDA 298

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++LVN+ TASASEI+A AL DN RA+LVG++T+GKGLIQS FEL DG+G+ VT+ KY 
Sbjct: 299 PLVVLVNQATASASEILAGALQDNGRAMLVGEKTFGKGLIQSLFELPDGAGMAVTVAKYE 358

Query: 474 TPNHMDINGNGIEPD 430
           TP H DIN  GI PD
Sbjct: 359 TPLHHDINKLGIMPD 373



>gb:BA000039_727391 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 412

 Score =  141 bits (356), Expect = 1e-32
 Identities = 80/139 (57%), Positives = 97/139 (69%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA  ++LDLR+N GGL+QAGVEIA+L+L+ G  + YTV R      S+ A    L   P+
Sbjct: 243 GAEEYILDLRNNPGGLLQAGVEIAQLWLDSG-AIVYTVDRQG-IVDSLNASGGALTHDPL 300

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN  TASASEI+A AL D+ RA LVGDRT+GKG IQS F L DGSG+ VTI  Y TP
Sbjct: 301 VVLVNGGTASASEILAGALQDHGRARLVGDRTFGKGSIQSLFHLSDGSGLAVTIAHYETP 360

Query: 468 NHMDINGNGIEPDFRNLPA 412
           NH +IN  GIEPD R L A
Sbjct: 361 NHHNINKVGIEPDRRVLDA 379



>sp|Q55669|CTPA_SYNY3 Carboxyl-terminal processing protease
           precursor (EC 3.4.21.102).>pir|A53964|A53964
           carboxyl-terminal processing proteinase precursor -
           Synechocystis sp. (strain PCC 6803)>gb:SYCCTPA_195441
           Synechocystis sp. protease (ctpA) gene, complete
           cds.>gb:BA000022_689578 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 427

 Score =  140 bits (354), Expect = 3e-32
 Identities = 73/133 (54%), Positives = 94/133 (70%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA  ++LDLR+N GGL+QAG++IA+L+L E  T+ YTV R      S  A        P+
Sbjct: 246 GADGYILDLRNNPGGLLQAGIDIARLWLPES-TIVYTVNRQGTQ-ESFTANGEAATDRPL 303

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN+ TASASEI+A AL DN RA LVG++T+GKGLIQS FEL DG+G+ VT+ KY TP
Sbjct: 304 VVLVNQGTASASEILAGALQDNQRATLVGEKTFGKGLIQSLFELSDGAGIAVTVAKYETP 363

Query: 468 NHMDINGNGIEPD 430
            H DI+  GI PD
Sbjct: 364 QHHDIHKLGIMPD 376



>gb:BA000045_743177 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 445

 Score =  134 bits (338), Expect = 2e-30
 Identities = 76/149 (51%), Positives = 100/149 (67%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           R  A  F+LDLR N GGL+ A  +IA+L+L+EG T+  TV RD Q   SI    P + + 
Sbjct: 242 REQADGFILDLRSNPGGLLYASADIARLWLSEG-TIVSTVDRDGQ-RESITVSRPAMTSK 299

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++LV+  +ASASEI+  AL D+ RAVLVG RTYGKGL+QS   L DGSGV VTI  Y 
Sbjct: 300 PLVVLVDGASASASEILGGALQDHHRAVLVGTRTYGKGLVQSVHSLSDGSGVAVTIAHYQ 359

Query: 474 TPNHMDINGNGIEPDFRNLPAWNEVSKHL 388
           TP+  DIN  GI+PD + +    E++K+L
Sbjct: 360 TPSGRDINKKGIDPDIK-VELTKEMAKNL 387



>gb:BA000045_740142 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 423

 Score =  133 bits (335), Expect = 4e-30
 Identities = 67/134 (50%), Positives = 97/134 (72%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVI 646
           A+ ++LDLR N GGL++AGVEIA+ +L  G+TV YTV R  +  ++  A+  PL   P++
Sbjct: 256 AAGYILDLRSNPGGLLEAGVEIARYWLTPGQTVVYTVNRQGERDQAR-AQRAPLTARPLV 314

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +L++  +ASASEI+A AL DN RA LVG +++GKGLIQ+   L+DGSG+ V+I +Y TP+
Sbjct: 315 VLIDGGSASASEILAGALQDNRRAQLVGTKSFGKGLIQAIHPLKDGSGLAVSIARYQTPS 374

Query: 465 HMDINGNGIEPDFR 424
             DI+  GIEPD +
Sbjct: 375 RRDIHKQGIEPDVK 388



>pir|S65146|JH0263 carboxy-terminal proteinase (EC 3.4.21.-) D1
           precursor - spinach>gb:SPICTPP_1721856 Spinacia oleracea
           mRNA for C-terminal processing protease for D1 precursor
           protein, complete cds.
          Length = 539

 Score =  133 bits (334), Expect = 5e-30
 Identities = 73/145 (50%), Positives = 94/145 (64%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           E       ++FVLDLRDN GGL   G+EIAK++LN+G  V     R  +    +   +  
Sbjct: 366 ETLRSNNVNAFVLDLRDNSGGLFPEGIEIAKIWLNKGVIVYICDSRGVRDIYDVEGSSAV 425

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
             + P+++LVNK TASASEI+A AL DN RAV+ G+ TYGKG IQS FEL DGSG+ VT+
Sbjct: 426 AGSEPLVVLVNKGTASASEILAGALKDNKRAVVFGEPTYGKGKIQSVFELSDGSGLAVTV 485

Query: 486 GKYVTPNHMDINGNGIEPDFRNLPA 412
            +Y TP H DI+  GI+PD   LPA
Sbjct: 486 ARYETPAHTDIDKVGIKPD-HPLPA 509



>gb:AP003507_1830058 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0468A12.>gb:AP003543_1830676 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0592B08.
          Length = 468

 Score =  131 bits (330), Expect = 2e-29
 Identities = 66/138 (47%), Positives = 97/138 (70%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           G  S++LDLR+N GGLV+AG+++A+++L+  ET+  TV R+       +A    L   P+
Sbjct: 288 GVQSYILDLRNNPGGLVKAGLDVAQMWLDGNETLVNTVDREGNVLPINMARGHSLTHDPL 347

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN+ +ASASEI+A ALHDN RA+LVG RT+GKG IQS  EL DGS + +T+ KY++P
Sbjct: 348 VVLVNEGSASASEILAGALHDNGRAILVGHRTFGKGKIQSVTELDDGSALFITVAKYLSP 407

Query: 468 NHMDINGNGIEPDFRNLP 415
              +I+  GI+PD +  P
Sbjct: 408 ALHEIDQVGIQPDIQCTP 425



>gb:BX572097_798118 Prochlorococcus marinus MIT9313 complete genome;
           segment 3/7.
          Length = 453

 Score =  130 bits (328), Expect = 3e-29
 Identities = 74/161 (45%), Positives = 104/161 (64%), Gaps = 1/161 (0%)
 Frame = -1

Query: 876 HCQXGFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDP-Q 700
           H   G     +   + GA  +VLDLR N GGL++A ++IA+ +L+EG T+  T  RD  Q
Sbjct: 246 HAAKGMRSAIKNLEKEGAQGYVLDLRSNPGGLLEASIDIARQWLDEG-TIVRTKTRDGIQ 304

Query: 699 YTRSIVAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFE 520
             R   A    L   PV++LVN+ +ASASEI++ AL DN R VLVG +T+GKGL+QS   
Sbjct: 305 DVRR--ANGSALTQRPVVVLVNEGSASASEILSGALQDNHRGVLVGQKTFGKGLVQSVRG 362

Query: 519 LQDGSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNEVS 397
           L DGSG+ VTI KY+TP+  DI+ NGI+PD + + +  E++
Sbjct: 363 LSDGSGLTVTIAKYLTPSGTDIHKNGIKPDIKAVMSEKEIN 403



>gb:SOD1CTPA_1715665 S.oleracea mRNA for D1 protein C-terminal
           processing protease.
          Length = 539

 Score =  130 bits (327), Expect = 3e-29
 Identities = 72/145 (49%), Positives = 92/145 (63%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           E       ++FVLDLRDN GGL   G+EIAK++LN+G  V     R  +    +   +  
Sbjct: 366 ETLRSNNVNAFVLDLRDNSGGLFPEGIEIAKIWLNKGVIVYICDSRGVRDIYDVEGSSAV 425

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
             + P+++LVNK TASASEI+A AL D  RAV+ G+ TYGKG IQS FEL DGSG+ VT+
Sbjct: 426 AGSEPLVVLVNKGTASASEILAGALKDKKRAVVFGEPTYGKGKIQSVFELSDGSGLAVTV 485

Query: 486 GKYVTPNHMDINGNGIEPDFRNLPA 412
            +Y TP H DI   GI+PD   LPA
Sbjct: 486 ARYETPAHTDIGKVGIKPD-HPLPA 509



>pir|AE2118|AE2118 carboxyl-terminal proteinase [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_683489 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 428

 Score =  129 bits (323), Expect = 1e-28
 Identities = 68/133 (51%), Positives = 96/133 (72%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVII 643
           + ++LDLR N GGL+ + VEIA++++++G T+  TV R  +  R  VA    L   P++I
Sbjct: 249 AGYILDLRGNPGGLLFSSVEIARMWMDKG-TIVSTVDRQGERERE-VANGRALTNKPLVI 306

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           LV+K +ASASEI++ AL DN RAV+VG +T+GKGL+QS   L DGSG+ VTI KY+TPN 
Sbjct: 307 LVDKGSASASEILSGALQDNKRAVIVGTQTFGKGLVQSVRPLDDGSGLAVTIAKYLTPND 366

Query: 462 MDINGNGIEPDFR 424
            DIN +GI+PD +
Sbjct: 367 RDINKHGIDPDVK 379



>gb:AF487528_1804291 Nicotiana plumbaginifolia D1 protease precursor
           (ctpA) mRNA, complete cds.
          Length = 473

 Score =  128 bits (322), Expect = 1e-28
 Identities = 73/145 (50%), Positives = 91/145 (62%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           EA  +   ++FVLDLRDN GGL   GVEIAK++LN+G  V     R  +           
Sbjct: 300 EALRKNNVNAFVLDLRDNSGGLFPEGVEIAKIWLNKGVIVYICDSRGVRDIYDTDGSNVV 359

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
             + P+ +LVNK TASASEI+A AL DN RA L G+ TYGKG IQS F+L DGSG+ VT+
Sbjct: 360 AASEPLAVLVNKGTASASEILAGALKDNTRAQLFGEPTYGKGKIQSVFQLSDGSGLAVTV 419

Query: 486 GKYVTPNHMDINGNGIEPDFRNLPA 412
            +Y TP H DI+  G+ PD   LPA
Sbjct: 420 ARYETPAHNDIDKVGVIPD-HPLPA 443



>gb:AF487525_1804288 Triticum aestivum D1 protease precursor (ctpA)
           mRNA, partial cds.
          Length = 389

 Score =  124 bits (312), Expect = 2e-27
 Identities = 68/136 (50%), Positives = 90/136 (66%)
 Frame = -1

Query: 819 SFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIIL 640
           +FVLDLR+N GGL   G+EIAK+++++G  V     R  +        +    + P+++L
Sbjct: 225 AFVLDLRNNSGGLFPEGIEIAKIWMDKGVIVYICDSRGVRDIYEADGASTIAASEPLVVL 284

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           VNK TASASEI+A AL DN RAV+ G+ TYGKG IQS F L DGSG+ VT+ +Y TP H 
Sbjct: 285 VNKGTASASEILAGALKDNKRAVVYGEPTYGKGKIQSVFALSDGSGLAVTVARYETPAHT 344

Query: 459 DINGNGIEPDFRNLPA 412
           DI+  G+ PD R LPA
Sbjct: 345 DIDKVGVTPD-RPLPA 359



>gb:BX569692_776077 Synechococcus sp. WH8102 complete genome;
           segment 4/7.
          Length = 445

 Score =  122 bits (307), Expect = 7e-27
 Identities = 63/133 (47%), Positives = 91/133 (68%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA  +VLDLR N GGL++A ++IA+ +LNEG  V+       +  R     A  +   P+
Sbjct: 259 GAQGYVLDLRSNPGGLLEASIDIARQWLNEGTIVSTRTREGIRDVRRATGSA--ITDKPM 316

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++L+++ +ASASEI++ AL +N RA LVG +T+GKGL+Q+   L DGSG+ VTI KY+TP
Sbjct: 317 VVLIDQGSASASEILSGALQENKRAQLVGQKTFGKGLVQAVRGLSDGSGMTVTIAKYLTP 376

Query: 468 NHMDINGNGIEPD 430
           N  DI+ NGI+PD
Sbjct: 377 NGTDIHKNGIKPD 389



>pir|T06752|T06752 carboxy-terminal proteinase homolog F15B8.130 -
           Arabidopsis thaliana>gb:ATF15B8_1548676 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F15B8.
          Length = 519

 Score =  122 bits (307), Expect = 7e-27
 Identities = 64/137 (46%), Positives = 96/137 (70%), Gaps = 7/137 (5%)
 Frame = -1

Query: 819 SFVLDLRDN-------XGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLI 661
           S++LDLR+N        GGLV+AG+++A+L+L+  ET+ YT+ R+   +   +     + 
Sbjct: 334 SYILDLRNNPLLAIPYQGGLVRAGLDVAQLWLDGDETLVYTIDREGVTSPINMINGHAVT 393

Query: 660 TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGK 481
             P+++LVN+ +ASASEI+A ALHDN RA+LVG+RT+GKG IQS  EL DGS + VT+ K
Sbjct: 394 HDPLVVLVNEGSASASEILAGALHDNGRAILVGNRTFGKGKIQSITELNDGSALFVTVAK 453

Query: 480 YVTPNHMDINGNGIEPD 430
           Y++P+  +I+  GI PD
Sbjct: 454 YLSPSLHEIDQVGIAPD 470



>gb:AP008231_580699 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 440

 Score =  122 bits (305), Expect = 1e-26
 Identities = 63/133 (47%), Positives = 93/133 (69%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA+S+VLDLR N GGL+ + +EIA+++LN G T+  TV R+ + + +I A    +   P+
Sbjct: 249 GATSYVLDLRGNPGGLLYSSIEIARMWLNNG-TIVKTVDRNGK-SETINANNSAITNKPL 306

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
            +LV++N+AS+SEI+  AL DN RAV++G +T+GK L+QS   L DGSG+ VT+  Y TP
Sbjct: 307 AVLVDQNSASSSEILVGALKDNNRAVVIGRQTFGKALVQSVHTLADGSGLAVTVAHYYTP 366

Query: 468 NHMDINGNGIEPD 430
           N  D+   GI+PD
Sbjct: 367 NGTDLGNRGIQPD 379



>pir|AD2023|AD2023 carboxyl-terminal proteinase [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_682727 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 445

 Score =  122 bits (305), Expect = 1e-26
 Identities = 67/132 (50%), Positives = 88/132 (66%)
 Frame = -1

Query: 819 SFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIIL 640
           S+VLDLR N GGL+QA +EIA+++L++G  V  TV R   +     A    L   P+ +L
Sbjct: 257 SYVLDLRGNPGGLLQASIEIARMWLDDGGIVR-TVNRQG-FNEDTKANRTALTKLPLAVL 314

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           V+ N+ASASEI+  AL DN RAV++G +T+GK L+QS  EL DGSG+ VTI  Y TPN  
Sbjct: 315 VDGNSASASEILTGALKDNKRAVVIGGQTFGKALVQSVHELPDGSGLAVTIAHYYTPNGT 374

Query: 459 DINGNGIEPDFR 424
           DIN  GI PD +
Sbjct: 375 DINHKGITPDIK 386



>pir|S77395|S77395 carboxyl-terminal proteinase prc - Synechocystis
           sp. (strain PCC 6803)>gb:BA000022_688277 Synechocystis
           sp. PCC 6803 DNA, complete genome.
          Length = 423

 Score =  122 bits (305), Expect = 1e-26
 Identities = 66/129 (51%), Positives = 92/129 (71%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILV 637
           ++ DLR N GGL+ + V+IA+++L+EG  V+ TV R  +  +   A    L   P+++LV
Sbjct: 252 YIFDLRSNPGGLLYSSVDIARIWLDEGGIVS-TVDRRGEVEQQS-ANKRQLSNRPLVVLV 309

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           +  +ASASEIV+ AL DN RAV+VG +T+GKGL+QS  EL DGSG+ VTI KY+TPN  D
Sbjct: 310 DGGSASASEIVSGALQDNQRAVIVGTKTFGKGLVQSVRELGDGSGMAVTIAKYLTPNGRD 369

Query: 456 INGNGIEPD 430
           IN +GI+PD
Sbjct: 370 INKHGIDPD 378



>gb:ATH132544_1552012 Arabidopsis thaliana mRNA for D1-processing
           protease, partial.
          Length = 500

 Score =  121 bits (303), Expect = 2e-26
 Identities = 65/131 (49%), Positives = 84/131 (64%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVII 643
           ++FVLDLRDN GG    G+EIAK +L++G  V     R  +             + P+ +
Sbjct: 335 NAFVLDLRDNSGGSFPEGIEIAKFWLDKGVIVYICDSRGVRDIYDTDGSNAIATSEPLAV 394

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           LVNK TASASEI+A AL DN RA++ G+ TYGKG IQS FEL DGSG+ VT+ +Y TP H
Sbjct: 395 LVNKGTASASEILAGALKDNKRALVYGEPTYGKGKIQSVFELSDGSGLAVTVARYETPAH 454

Query: 462 MDINGNGIEPD 430
            DI+  G+ PD
Sbjct: 455 TDIDKVGVTPD 465



>pir|E71447|E71447 probable PSII D1 protein processing enzyme -
           Arabidopsis thaliana>gb:ATCHRIV47_1545576 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           47.>gb:ATFCA9_1551824 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No.
           9.>gb:AY054171_1562993 Arabidopsis thaliana
           AT4g17740/dl4905c mRNA, complete
           cds.>gb:BT006343_1639230 Arabidopsis thaliana
           At4g17740/dl4905c gene, complete
           cds.>gb:AF424602_1798941 Arabidopsis thaliana
           AT4g17740/dl4905c mRNA, complete cds.
          Length = 515

 Score =  121 bits (303), Expect = 2e-26
 Identities = 65/131 (49%), Positives = 84/131 (64%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVII 643
           ++FVLDLRDN GG    G+EIAK +L++G  V     R  +             + P+ +
Sbjct: 350 NAFVLDLRDNSGGSFPEGIEIAKFWLDKGVIVYICDSRGVRDIYDTDGSNAIATSEPLAV 409

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           LVNK TASASEI+A AL DN RA++ G+ TYGKG IQS FEL DGSG+ VT+ +Y TP H
Sbjct: 410 LVNKGTASASEILAGALKDNKRALVYGEPTYGKGKIQSVFELSDGSGLAVTVARYETPAH 469

Query: 462 MDINGNGIEPD 430
            DI+  G+ PD
Sbjct: 470 TDIDKVGVTPD 480



>gb:BA000039_727190 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 433

 Score =  120 bits (301), Expect = 4e-26
 Identities = 65/135 (48%), Positives = 92/135 (68%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           + G   +VLDLR N GGL+ A  EIA++FL +G+ V+ TV R  +  R + A    L   
Sbjct: 246 KQGVEGYVLDLRSNPGGLLFASAEIARMFLKQGDIVS-TVNRQGEAER-LRAGRGFLTDK 303

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++L++  +ASASEI+A AL DN RA+LVG +++GKGL+QS   + +G+G+ VTI KY 
Sbjct: 304 PLVVLIDGGSASASEILAGALQDNNRAILVGTKSFGKGLVQSVQPVGEGAGIAVTIAKYF 363

Query: 474 TPNHMDINGNGIEPD 430
           TP+  DIN  GIEPD
Sbjct: 364 TPSGRDINKKGIEPD 378



>pir|T10500|T10500 carboxy-terminal proteinase (EC 3.4.21.-) - green
           alga  (Scenedesmus obliquus)>gb:SOU85200_1715941
           Scenedesmus obliquus photosystem II D1 protease mRNA,
           complete cds.
          Length = 464

 Score =  119 bits (298), Expect = 8e-26
 Identities = 62/138 (44%), Positives = 91/138 (65%), Gaps = 2/138 (1%)
 Frame = -1

Query: 837 ARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLI- 661
           ++ G +  VLD+R+N GGL  AGV +A++ ++ G+ V      D Q  R I +     I 
Sbjct: 301 SKQGVAGLVLDIRNNGGGLFPAGVNVARMLVDRGDLVLIA---DSQGIRDIYSADGNSID 357

Query: 660 -TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIG 484
             TP+++LVN+ TASASE++A AL D+ R ++ G+RT+GKGLIQ+  +L DGSGV VT+ 
Sbjct: 358 SATPLVVLVNRGTASASEVLAGALKDSKRGLIAGERTFGKGLIQTVVDLSDGSGVAVTVA 417

Query: 483 KYVTPNHMDINGNGIEPD 430
           +Y TP  +DIN  G+ PD
Sbjct: 418 RYQTPAGVDINKIGVSPD 435



>gb:AF022823_469973 Nostoc punctiforme carboxyl terminal protease
           (ctpH) gene, complete cds.
          Length = 424

 Score =  117 bits (294), Expect = 2e-25
 Identities = 67/139 (48%), Positives = 90/139 (64%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           EA  +     +VLDLR + GGL+ A ++IA ++L +G  V+  V RD +   S  A   P
Sbjct: 239 EALEKQQVQGYVLDLRSDPGGLLDASLQIASMWLKQGAIVSL-VNRD-RVKDSYNASGHP 296

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
           L   P++ILV+K +ASASEI++ AL D+ RA LVG RT+GKGL+Q+   L DGSG+ +TI
Sbjct: 297 LTNKPLVILVDKGSASASEILSGALQDDNRATLVGTRTFGKGLVQAVEPLDDGSGLKLTI 356

Query: 486 GKYVTPNHMDINGNGIEPD 430
            KY TP   DIN  GI PD
Sbjct: 357 AKYYTPKGRDINHVGIAPD 375



>gb:AE017162_394824 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030493 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 459

 Score =  117 bits (294), Expect = 2e-25
 Identities = 68/132 (51%), Positives = 89/132 (67%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           VLDLR+N GGLV +G+ +A  FL+E + +  T  R+ +    I +    L   P+I LVN
Sbjct: 259 VLDLRNNSGGLVSSGLAVADAFLSE-KPIVETKNRN-EINDPIPSGKETLFDGPLITLVN 316

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
           + TASASEI+A AL DN R++L+G RT+GKGLIQS   L DGSG+ VT+  Y+TP+  DI
Sbjct: 317 EGTASASEILAGALQDNQRSLLLGKRTFGKGLIQSLTNLSDGSGLAVTVASYLTPSGRDI 376

Query: 453 NGNGIEPDFRNL 418
              GIEPD RNL
Sbjct: 377 QNLGIEPD-RNL 387



>gb:BX572100_798992 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 446

 Score =  115 bits (288), Expect = 1e-24
 Identities = 63/128 (49%), Positives = 84/128 (65%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           VLDLR+N GGLV +G+ +A  FL+ G  +  T  R+ +   +I +    L   P++ LVN
Sbjct: 258 VLDLRNNSGGLVSSGLAVADAFLS-GSPIVETRNRE-RINEAIPSAIETLYDGPMVTLVN 315

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             TASASEI+A AL DN R+ L+G RT+GKGLIQ+   L DGSG+ VT+  Y+TP+  DI
Sbjct: 316 GGTASASEILAGALQDNSRSQLLGSRTFGKGLIQTLTNLSDGSGLAVTVAGYMTPSGRDI 375

Query: 453 NGNGIEPD 430
              GIEPD
Sbjct: 376 QNQGIEPD 383



>gb:BX572091_796303 Prochlorococcus marinus MED4 complete genome;
           segment 2/5.
          Length = 429

 Score =  115 bits (288), Expect = 1e-24
 Identities = 62/131 (47%), Positives = 89/131 (67%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVII 643
           S +VLDLR N GGL+++ ++I++ F+++G  V+ T+ +D     +       L   P+I+
Sbjct: 235 SGYVLDLRSNPGGLLESSIDISRQFIDKGIIVS-TLSKDG-LRETKRGNGKALTKKPLIV 292

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           LVN+ +ASASEIV+ A+ DN R  LVG +T+GKGL+QS   L DGSG+ VT+ KY+TPN 
Sbjct: 293 LVNEGSASASEIVSGAIRDNNRGKLVGKKTFGKGLVQSMRTLVDGSGLTVTVAKYLTPNG 352

Query: 462 MDINGNGIEPD 430
            DIN  GI PD
Sbjct: 353 TDINKFGITPD 363



>gb:BA000045_740194 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 428

 Score =  114 bits (286), Expect = 2e-24
 Identities = 66/147 (44%), Positives = 93/147 (63%)
 Frame = -1

Query: 870 QXGFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTR 691
           Q  F+  +EA    G   +VLDLR N GGL+ A   +A L L++G T+  TV R     +
Sbjct: 243 QRAFAKLSEA----GVQGWVLDLRGNPGGLLDAATRVASLVLDQG-TIVSTVDRAGTQDQ 297

Query: 690 SIVAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD 511
            + A+  P+   P+++LV++ +ASASEI+A A+ DN R  LVG +T+GKG+IQ    L D
Sbjct: 298 -LTADRHPVTNLPLVVLVDQGSASASEILAGAIQDNRRGTLVGMKTFGKGVIQQVNALSD 356

Query: 510 GSGVVVTIGKYVTPNHMDINGNGIEPD 430
           GSGV VTI  Y+TP+  DI+  GI+PD
Sbjct: 357 GSGVNVTIAHYLTPSGNDIHKKGIQPD 383



>gb:BX842646_823207 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 1/11.
          Length = 458

 Score =  114 bits (285), Expect = 3e-24
 Identities = 58/132 (43%), Positives = 86/132 (65%), Gaps = 1/132 (0%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT-PVI 646
           +  ++D+R N GGL+   ++++ +FL +G T+  T+GR+        A      T  P++
Sbjct: 231 AGLLIDMRRNPGGLLDQAIKVSDMFLKDG-TIVSTIGRNKNEKEVATASKKGQYTNFPIV 289

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           ILVN+ TASASEIV+ AL DN RA++VG RT+GKG +QS  +L DGSG+ +T+ +Y TPN
Sbjct: 290 ILVNEYTASASEIVSGALQDNKRALIVGQRTFGKGSVQSVIKLGDGSGLKLTVARYYTPN 349

Query: 465 HMDINGNGIEPD 430
            + I   GI PD
Sbjct: 350 GVSIQAEGIHPD 361



>pir|S74579|S74579 carboxyl-terminal proteinase ctpB - Synechocystis
           sp.  (strain PCC 6803)>gb:SSPCTPB_190927 Synechocystis
           sp. ctpB gene.>gb:BA000022_687510 Synechocystis sp. PCC
           6803 DNA, complete genome.
          Length = 462

 Score =  114 bits (285), Expect = 3e-24
 Identities = 63/131 (48%), Positives = 83/131 (63%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVII 643
           S +VLDLR N GGL+ + ++IA+L+LN GE V+    R     R   A    L   P+++
Sbjct: 274 SGYVLDLRGNPGGLLLSSIDIARLWLNRGEIVSTIDRRGGD--RHFSANGRSLTDLPLVV 331

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           LVN+ +ASASEI+A AL +  RA +VG  TYGKG +QS   L DGSG+ VTI +Y  P+ 
Sbjct: 332 LVNERSASASEILAGALKEQGRATVVGTATYGKGTVQSVNTLSDGSGLAVTIARYYPPSG 391

Query: 462 MDINGNGIEPD 430
            DIN  GI PD
Sbjct: 392 TDINRKGISPD 402



>gb:BX569694_776870 Synechococcus sp. WH8102 complete genome;
           segment 6/7.
          Length = 425

 Score =  114 bits (284), Expect = 3e-24
 Identities = 66/128 (51%), Positives = 83/128 (64%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           VLDLR+N GGLV +G+ +A  FL  G T+  T  RD     +I A    L   P++ LVN
Sbjct: 261 VLDLRNNSGGLVSSGLAVADDFLASG-TIVETRNRDG-IDDAINANPSTLYDGPMLTLVN 318

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             TASASEI+A AL DN R+ L+G +T+GKGLIQ+   L DGSG+ VT+  YVTP+  DI
Sbjct: 319 GGTASASEILAGALQDNERSTLLGHQTFGKGLIQTLTNLSDGSGLAVTVAGYVTPSGHDI 378

Query: 453 NGNGIEPD 430
            G GI PD
Sbjct: 379 QGEGIAPD 386



>gb:AP008231_580513 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 425

 Score =  113 bits (283), Expect = 4e-24
 Identities = 63/129 (48%), Positives = 88/129 (68%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILV 637
           +VLDLR N GGL+ A ++IA+++L +G  V+ T  R    +    A    L   P+++LV
Sbjct: 254 YVLDLRSNPGGLLYASIDIARMWLPKGVIVS-TKDRSG-ISEQASANNRALTDKPLVVLV 311

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           +  +ASASEI++ AL DN RAVL+G +T+GKGL+QS   L DGSG+ VTI KY+TP+  D
Sbjct: 312 DGGSASASEILSGALQDNNRAVLIGSKTFGKGLVQSVRPLGDGSGLAVTIAKYLTPSGRD 371

Query: 456 INGNGIEPD 430
           IN  GIEP+
Sbjct: 372 INKQGIEPN 380



>gb:AE017317_440581 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 9 of 12 of the complete
           genome.>gb:AE017285_1073742 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 428

 Score =  112 bits (280), Expect = 1e-23
 Identities = 61/140 (43%), Positives = 86/140 (61%), Gaps = 1/140 (0%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           EA  R      VLDLR+N GGL+   V ++ +FL +G  V+   GR     R   A+A  
Sbjct: 215 EANKRGPVKGVVLDLRNNPGGLLDQAVSVSDVFLRDGGIVSIR-GRGDDTGREYNAKAQS 273

Query: 666 L-ITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVT 490
             +T P+++L+N  +ASASEIVA AL D  RA+LVG+R++GKG +Q+   L DG+G+ +T
Sbjct: 274 TDVTAPMVVLINAGSASASEIVAGALRDQKRALLVGERSFGKGSVQNVIPLSDGAGLKLT 333

Query: 489 IGKYVTPNHMDINGNGIEPD 430
           +  Y TPN   I   GI+PD
Sbjct: 334 VALYYTPNGRSIQAEGIDPD 353



>gb:BA000039_728109 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 441

 Score =  111 bits (278), Expect = 2e-23
 Identities = 61/139 (43%), Positives = 86/139 (61%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           E   R     F+LDLR N GGL++AG+EI++ +L+ G  V     +  Q   +I A    
Sbjct: 260 EILQREKVQGFILDLRHNPGGLLEAGIEISRQWLDSGVIVRI---QQNQREETIRARQGA 316

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
           L   P+++LVN+ +ASASEI+A AL D  RA++VG  T+GK  +Q+  EL DGS +VVT+
Sbjct: 317 LSQLPLVVLVNQASASASEILAAALQDQGRAIVVGTPTFGKVRVQAVHELADGSALVVTV 376

Query: 486 GKYVTPNHMDINGNGIEPD 430
            +Y+TP   DI   GI PD
Sbjct: 377 ARYLTPKGRDIAAGGISPD 395



>gb:AE010626_265102 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 168 of 197 of the complete
           genome.>gb:AE009951_912270 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 427

 Score =  110 bits (276), Expect = 3e-23
 Identities = 57/135 (42%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVT--YTVGRDPQYTRSIVAEAPPLITT 655
           G    + DLR N GG +   ++IA +F+ +G+ V+     G +  YTR    E       
Sbjct: 231 GMKGLIFDLRSNPGGELGQSIKIASMFIEKGKIVSTRQKKGEESVYTR----EGKYFGNF 286

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++L+N  +ASASEIV+ AL D+ RA L+G++T+GKG +Q+   L DG G+ +TI KY 
Sbjct: 287 PMVVLINGGSASASEIVSGALKDHKRATLIGEKTFGKGSVQTLLPLPDGDGIKITIAKYY 346

Query: 474 TPNHMDINGNGIEPD 430
           TPN + I+G GIEPD
Sbjct: 347 TPNGISIDGTGIEPD 361



>pir|F70369|F70369 carboxyl-terminal proteinase - Aquifex
           aeolicus>gb:AE000708_26337 Aquifex aeolicus VF5 section
           40 of 109 of the complete genome.>gb:AE000657_976868
           Aquifex aeolicus VF5 complete genome.
          Length = 408

 Score =  110 bits (275), Expect = 4e-23
 Identities = 57/129 (44%), Positives = 80/129 (62%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILV 637
           F++DLR+N GGL+   V++  LF+ +G+ + YT GR  +  R      P     PV++LV
Sbjct: 224 FIIDLRNNPGGLLSEAVDVGDLFIPKGKLIVYTKGRKGELHRYFAEREPITQGLPVVLLV 283

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           NK +ASASEIVA AL D   A LVG++T+GK  +Q+   L DGS + +TI  Y TP    
Sbjct: 284 NKGSASASEIVAGALQDYHIATLVGEKTFGKASVQNLIPLSDGSAMKLTIAYYYTPKGRL 343

Query: 456 INGNGIEPD 430
           I+  GI+PD
Sbjct: 344 IHKKGIKPD 352



>gb:BX572090_795950 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 429

 Score =  110 bits (274), Expect = 5e-23
 Identities = 58/128 (45%), Positives = 85/128 (66%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           +LDLR+N GGLV +G+ +A  FL+E + +  T  R+     +I+++       P++ LVN
Sbjct: 255 ILDLRNNSGGLVSSGIAVADSFLSE-KPIVETKDRNG-IKDAIISQKNTSFEGPMVTLVN 312

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
           K TASASEI+A +L DN R+ L+G++TYGKGLIQS   L + SG+ +T+  Y+TP   +I
Sbjct: 313 KGTASASEILAGSLQDNNRSTLMGEQTYGKGLIQSLKSLGEDSGIAITVASYLTPQGNNI 372

Query: 453 NGNGIEPD 430
            G GI PD
Sbjct: 373 QGKGITPD 380



>gb:AE013149_289578 Thermoanaerobacter tengcongensis MB4, section
           176 of 244 of the complete genome.>gb:AE008691_1111643
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 398

 Score =  107 bits (267), Expect = 3e-22
 Identities = 62/145 (42%), Positives = 87/145 (60%)
 Frame = -1

Query: 861 FSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIV 682
           F    E   + G    ++DLRDN GGL++  V IA + L +G  VT T GR    ++   
Sbjct: 224 FKKALERLKKDGMKGLIIDLRDNPGGLLEECVNIADMLLPKGVIVT-TKGRAE--SQEFY 280

Query: 681 AEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSG 502
           ++   L   P+++LVNK +ASASEI+A A+ D    VLVG  T+GKGL+Q+     DG+G
Sbjct: 281 SKGTGL-GMPLVVLVNKGSASASEILAGAIKDRKAGVLVGTTTFGKGLVQTVVNFGDGTG 339

Query: 501 VVVTIGKYVTPNHMDINGNGIEPDF 427
           +  TI +Y TPN  DI G GIEP++
Sbjct: 340 LKYTIARYYTPNGTDIQGKGIEPNY 364



>gb:AP006840_567331 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 420

 Score =  107 bits (266), Expect = 4e-22
 Identities = 56/133 (42%), Positives = 84/133 (63%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           G +  + D+R N GGL+   VEIA  FL  G+ V + V R  +  R++ A+     T P+
Sbjct: 258 GMTRLIFDVRQNPGGLLDEVVEIASFFLPTGDPVVHIVERAKE-PRALTAKEAEKWTGPL 316

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LV+  +ASASEI+A A+ D     L+G +T+GKG +Q+F+ LQDGSG+ +T  KY+T 
Sbjct: 317 VVLVDGGSASASEILAGAVKDAGVGTLIGAKTFGKGSVQTFWRLQDGSGIKLTTAKYLTA 376

Query: 468 NHMDINGNGIEPD 430
               I+G G+EPD
Sbjct: 377 GGHSIDGQGVEPD 389



>gb:AE017164_395470 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031139 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 447

 Score =  106 bits (265), Expect = 5e-22
 Identities = 58/135 (42%), Positives = 88/135 (65%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           R    ++++D+R N GGL++A ++I++  L++G  V+ T  +D   T    A    L   
Sbjct: 255 RNDPDAYIIDVRGNPGGLLEASIDISRQLLDKGVIVS-TKTKDG-ITDVRRARGNALTHK 312

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+ ILVN+ +ASASEI++ A+ DN R +L+G +T+GKGL+QS   L DGSG+ VT+ KY+
Sbjct: 313 PIAILVNEGSASASEILSGAIQDNKRGILIGKKTFGKGLVQSVRPLVDGSGLTVTVAKYL 372

Query: 474 TPNHMDINGNGIEPD 430
           TP   DI+  GI PD
Sbjct: 373 TPRGTDIHKYGIVPD 387



>gb:BA000040_733082 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 445

 Score =  106 bits (264), Expect = 7e-22
 Identities = 58/137 (42%), Positives = 85/137 (62%), Gaps = 2/137 (1%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVI 646
           + +V+DLR+N GGL+   V ++  FL  GE V+ T GR+P+ T+   A    L    P++
Sbjct: 235 AGYVMDLRNNPGGLLDQAVSVSSAFLQRGEVVS-TRGRNPEETQRFTAHGGDLTKGKPLV 293

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSG-VVVTIGKYVTP 469
           +LVN  +ASASEIVA ALHD+ RA ++G R++GKG +Q+   L  G+G + +T  +Y TP
Sbjct: 294 VLVNGGSASASEIVAGALHDHKRATIIGTRSFGKGSVQTIIPLGAGNGALALTTARYYTP 353

Query: 468 NHMDINGNGIEPDFRNL 418
           +   I   GI PD   L
Sbjct: 354 SGRSIQAQGIAPDIEIL 370



>pir|H71342|H71342 probable carboxyl-terminal proteinase (ctp) -
           syphilis spirochete>gb:AE001209_33105 Treponema pallidum
           subsp. pallidum str. Nichols section 25 of 87 of the
           complete genome.>gb:AE000520_1049333 Treponema pallidum
           subsp. pallidum str. Nichols complete genome.
          Length = 448

 Score =  106 bits (264), Expect = 7e-22
 Identities = 61/138 (44%), Positives = 88/138 (63%), Gaps = 3/138 (2%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQY--TRSIVAEAPPLI 661
           R G    +LDLR+N GGL+ A V++   F+  G  VT T  R   +  T S+ A A  L 
Sbjct: 193 RQGCDRLILDLRNNPGGLITAAVDVTSSFIPSGTVVT-TKSRVQGHSITFSVNARAQKLP 251

Query: 660 TT-PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIG 484
            + PVI+L+N+++ASASEIV+ AL D+ RA LVG  TYGKG++Q  F+L +   + +TI 
Sbjct: 252 PSMPVIVLINRDSASASEIVSGALKDHKRAYLVGQTTYGKGVVQQVFDLNERESLKMTIS 311

Query: 483 KYVTPNHMDINGNGIEPD 430
           +Y TP+  +I+ +GI PD
Sbjct: 312 RYYTPSDANIDKSGIPPD 329



>pir|AE2917|AE2917 carboxy-terminal proteinase [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009225_249782 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 251 of 256 of the
           complete sequence.>gb:AE008688_1087625 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 442

 Score =  105 bits (261), Expect = 2e-21
 Identities = 61/132 (46%), Positives = 80/132 (60%), Gaps = 1/132 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           +VLDLR N GGL+   + ++  FL  GE V+ T GR+P  TR   A A  L    PVI+L
Sbjct: 233 YVLDLRLNPGGLLDQAINVSDAFLERGEVVS-TRGRNPDETRRFNATAGDLTDGKPVIVL 291

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           VN  +ASASEIVA AL D  RA +VG R++GKG +Q+   L +   + +T   Y TP+  
Sbjct: 292 VNGGSASASEIVAGALQDLRRATVVGTRSFGKGSVQTIIPLGEAGALRLTTALYYTPSGK 351

Query: 459 DINGNGIEPDFR 424
            I G GIEPD +
Sbjct: 352 SIQGTGIEPDIK 363



>pir|H97691|H97691 carboxy-terminal proteinase (AF110497) [imported]
           - Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008191_234430 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 249 of 254 of the
           complete sequence.>gb:AE007869_1084099 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 462

 Score =  105 bits (261), Expect = 2e-21
 Identities = 61/132 (46%), Positives = 80/132 (60%), Gaps = 1/132 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           +VLDLR N GGL+   + ++  FL  GE V+ T GR+P  TR   A A  L    PVI+L
Sbjct: 253 YVLDLRLNPGGLLDQAINVSDAFLERGEVVS-TRGRNPDETRRFNATAGDLTDGKPVIVL 311

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           VN  +ASASEIVA AL D  RA +VG R++GKG +Q+   L +   + +T   Y TP+  
Sbjct: 312 VNGGSASASEIVAGALQDLRRATVVGTRSFGKGSVQTIIPLGEAGALRLTTALYYTPSGK 371

Query: 459 DINGNGIEPDFR 424
            I G GIEPD +
Sbjct: 372 SIQGTGIEPDIK 383



>gb:BA000045_741384 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 433

 Score =  103 bits (258), Expect = 3e-21
 Identities = 61/133 (45%), Positives = 83/133 (62%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA  ++LDLR+N GG V A  E+  L L EG  V+  V R  +   +I A        P+
Sbjct: 254 GARGWILDLRNNPGGRVDAATEVTSLLLAEGAIVS-VVDRTGE-RETIRATGRARTDLPL 311

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           +++V++ +ASASEIVA AL D+ RA LVG  T+GKG+IQ    L DGSG+ VTI +Y TP
Sbjct: 312 VVMVDRGSASASEIVAGALQDHRRATLVGMPTFGKGVIQQINGLSDGSGLNVTIARYRTP 371

Query: 468 NHMDINGNGIEPD 430
           +  +I+  GI PD
Sbjct: 372 SGREIHKKGISPD 384



>gb:AE017149_391371 Helicobacter hepaticus ATCC 51449 section 6 of 6
           of the complete genome.>gb:AE017125_1025633 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 461

 Score =  103 bits (258), Expect = 3e-21
 Identities = 54/128 (42%), Positives = 79/128 (61%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           VLDLR+N GG +   V++++LF+  G  VT   GR+        A   P  + P+++LVN
Sbjct: 254 VLDLRNNPGGALDQAVDLSRLFIKNGVIVTQK-GRNKNDNVEYRATNAPYASVPIVVLVN 312

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASEIVA AL D+ RAVL+G++T+GKG +Q+F +L    G+ +T  KY  P+   I
Sbjct: 313 GGSASASEIVAGALQDHKRAVLIGEQTFGKGSVQTFMQLDQNEGLKLTTAKYYLPSGRTI 372

Query: 453 NGNGIEPD 430
              G+ PD
Sbjct: 373 QAVGVTPD 380



>gb:BX572593_799785 Rhodopseudomonas palustris CGA009 complete
           genome; segment 1/16.
          Length = 458

 Score =  102 bits (254), Expect = 1e-20
 Identities = 59/131 (45%), Positives = 84/131 (64%), Gaps = 2/131 (1%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           F+LDLR+N GGL++  V ++  FL+ GE V+ T GR+ + T+   A A  L    PVI+L
Sbjct: 238 FILDLRNNPGGLLEEAVTVSDAFLDRGEIVS-TRGRNAEETQRRSAHAGDLTKGKPVIVL 296

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVV-VTIGKYVTPNH 463
           +N  +ASASEIVA AL D+ RA +VG R++GKG +Q+   L  G+G + +T  +Y TP+ 
Sbjct: 297 INGGSASASEIVAGALQDHKRATVVGTRSFGKGSVQTIIPLGSGNGALRLTTARYYTPSG 356

Query: 462 MDINGNGIEPD 430
             I   GI PD
Sbjct: 357 KSIQAKGITPD 367



>gb:AY204462_597146 Myxococcus xanthus clone C1121 adventurous
           gliding motility protein W (aglW), TonB-like protein,
           adventurous gliding motility protein V (aglV),
           adventurous gliding motility protein X (aglX), glutamate
           racemase (murI), CarF (carF), cell division protein,
           cell division protein, metalloendopeptidase,
           hypothetical protein, and adventurous gliding motility
           protein W (agmW) genes, complete cds; and unknown genes.
          Length = 458

 Score =  102 bits (254), Expect = 1e-20
 Identities = 61/133 (45%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT----PVI 646
           VLDLR+N GGL+   V ++  FL     +  T GRD    RS   E      T    PV+
Sbjct: 245 VLDLRNNPGGLLDQAVAVSDRFLPGNLPIVSTRGRDG---RSATVERSKDRDTEKDYPVV 301

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +LVN  +ASASEIVA AL D+ RA ++G  T+GKG +Q+  EL+DGSG+ +TI +Y TP 
Sbjct: 302 VLVNAGSASASEIVAGALQDHGRATILGAPTFGKGSVQTVIELEDGSGLKLTIARYYTPK 361

Query: 465 HMDINGNGIEPDF 427
              I   GI PDF
Sbjct: 362 GRSIQERGITPDF 374



>pir|G75383|G75383 probable carboxyl-terminal proteinase -
           Deinococcus radiodurans (strain R1)>gb:AE001998_41813
           Deinococcus radiodurans R1 section 135 of 229 of the
           complete chromosome 1.>gb:AE000513_882708 Deinococcus
           radiodurans R1 complete chromosome 1.
          Length = 447

 Score =  102 bits (253), Expect = 1e-20
 Identities = 56/136 (41%), Positives = 80/136 (58%), Gaps = 1/136 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTV-GRDPQYTRSIVAEAPPLIT 658
           +      +LDLRDN GGL+ AGV++A  FL  G  V+    G  P+   S   +A    T
Sbjct: 233 KANVQKLILDLRDNGGGLLSAGVDVADQFLQSGPIVSLRERGGQPEVYGSARKQATDY-T 291

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
             +++LVNKN+ASASE+V  AL DN RA ++G++T+GKG+ Q    L DG  V +    +
Sbjct: 292 GKLVLLVNKNSASASEVVGGALQDNKRATIIGEQTFGKGVAQVPITLPDGGKVAIVNSAW 351

Query: 477 VTPNHMDINGNGIEPD 430
           +TP   +I+  GI PD
Sbjct: 352 ITPKGREIHKKGITPD 367



>gb:AX930254_1483907 Sequence 19 from Patent WO03087149.
          Length = 372

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/141 (38%), Positives = 87/141 (61%), Gaps = 1/141 (0%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA  FVLDLR N GGL+   + ++ +F+++G+T+     ++ +      AE    +  P 
Sbjct: 228 GAERFVLDLRGNPGGLMDQAIMMSNMFVDKGKTIMQVESKNGK-KEVYKAEKERKVNKPT 286

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN  TASA+EI+A ALH +    +VG+ T+GKG +Q+     DGS V +TI K++TP
Sbjct: 287 VVLVNGGTASAAEIMAAALHQSSGIPIVGENTFGKGTVQNAESFSDGSTVKLTIAKWLTP 346

Query: 468 NHMDINGNGIEPDFR-NLPAW 409
           N   I+  GI+P ++  LP++
Sbjct: 347 NGDWIHEKGIKPQYKAELPSY 367



>gb:BX294138_766708 Pirellula sp. strain 1 complete genome; segment
           6/24.
          Length = 609

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/146 (36%), Positives = 87/146 (59%), Gaps = 1/146 (0%)
 Frame = -1

Query: 843 ATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPL 664
           A +R G  S ++DLRDN GGL+ A VE+A  F++ G  +T T GR+ +      A     
Sbjct: 433 ALSRQGMRSLIIDLRDNPGGLLPASVEVADRFIDNGRILT-TRGRNARENFDYSAHRANT 491

Query: 663 ITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGS-GVVVTI 487
              P+ +L+++N+ASASEI + A+ D+ R  +VG+++YGKG +Q  F +Q    G+ +T 
Sbjct: 492 WNVPLAVLIDRNSASASEIFSGAIRDSNRGTVVGEKSYGKGSVQGIFRMQAAQFGLCLTT 551

Query: 486 GKYVTPNHMDINGNGIEPDFRNLPAW 409
            K+ +P+   I+ NG+EP     P +
Sbjct: 552 AKFYSPSGRAISRNGVEPHLSVPPTY 577



>gb:BA000040_728694 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 451

 Score =  101 bits (252), Expect = 2e-20
 Identities = 59/135 (43%), Positives = 85/135 (62%), Gaps = 2/135 (1%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           +++DLR+N GGL++  V ++  FL +GE V+ T GR+ + T+   A A  L    PVI+L
Sbjct: 237 YIIDLRNNPGGLLEEAVTVSDSFLEKGEIVS-TRGRNAEETQRRTAHAGDLTKGKPVIVL 295

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVV-VTIGKYVTPNH 463
           VN  +ASASEIVA AL D+ RA +VG R++GKG +Q+   L  G+G + +T  +Y TP+ 
Sbjct: 296 VNGGSASASEIVAGALQDHKRATIVGTRSFGKGSVQTIIPLGSGNGALRLTTARYYTPSG 355

Query: 462 MDINGNGIEPDFRNL 418
             I   GI PD   L
Sbjct: 356 KSIQAKGIVPDIEVL 370



>gb:AE017333_448123 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857931 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 465

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/141 (38%), Positives = 87/141 (61%), Gaps = 1/141 (0%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA  FVLDLR N GGL+   + ++ +F+++G+T+     ++ +      AE    +  P 
Sbjct: 228 GAERFVLDLRGNPGGLMDQAIMMSNMFVDKGKTIMQVESKNGK-KEVYKAEKERKVNKPT 286

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN  TASA+EI+A ALH +    +VG+ T+GKG +Q+     DGS V +TI K++TP
Sbjct: 287 VVLVNGGTASAAEIMAAALHQSSGIPIVGENTFGKGTVQNAESFSDGSTVKLTIAKWLTP 346

Query: 468 NHMDINGNGIEPDFR-NLPAW 409
           N   I+  GI+P ++  LP++
Sbjct: 347 NGDWIHEKGIKPQYKAELPSY 367



>gb:AE017180_399269 Geobacter sulfurreducens PCA, complete genome.
          Length = 450

 Score =  101 bits (251), Expect = 2e-20
 Identities = 61/146 (41%), Positives = 86/146 (58%), Gaps = 13/146 (8%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNE---GETVTYTVGRDPQYTRSI---VAEAPPLITTP 652
           VLDLR+N GGL+ A V +A  F+ E      + YT GR+    RS    + E  P    P
Sbjct: 234 VLDLRNNPGGLLDAAVAVAGRFVGERLDNGLIVYTEGREHFAKRSYSATIGEKEPRY--P 291

Query: 651 VIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVT 472
           +++L+N  +ASASEIVA AL D+ RAV++G  ++GKG +Q+   L+DG+G+ +T  +Y T
Sbjct: 292 LVVLINGGSASASEIVAGALQDHGRAVIMGTTSFGKGSVQTVVPLKDGAGLKLTTARYYT 351

Query: 471 PNHMDINGNGIEPD-------FRNLP 415
           P    I   GIEPD       F+ LP
Sbjct: 352 PKGRSIQARGIEPDIVVERAGFKELP 377



>gb:SCO939114_176640 Streptomyces coelicolor A3(2) complete genome;
           segment 11/29.
          Length = 374

 Score =  101 bits (251), Expect = 2e-20
 Identities = 63/146 (43%), Positives = 82/146 (56%), Gaps = 1/146 (0%)
 Frame = -1

Query: 846 EATARX-GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAP 670
           EA AR    +  VLDLR N GGLV   V  A  FL+ G   TY V  D    R++ AEA 
Sbjct: 213 EAVARVPSGAGVVLDLRGNSGGLVTEAVTAASAFLDGGLVATYDVDGDQ---RALHAEAG 269

Query: 669 PLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVT 490
              T P++ LV+  T SA+E++  AL D  RAV++G RT+GKG +Q    L  GS   +T
Sbjct: 270 GDTTRPLVALVDGGTMSAAELLTGALQDRGRAVVLGSRTFGKGSVQMPSRLPGGSVAELT 329

Query: 489 IGKYVTPNHMDINGNGIEPDFRNLPA 412
           +G Y TP+   ++G GI PD    PA
Sbjct: 330 VGHYRTPSGRGVDGTGITPDLEVDPA 355



>gb:BX640437_812952 Bordetella bronchiseptica strain RB50, complete
           genome; segment 1/16.
          Length = 483

 Score =  100 bits (250), Expect = 3e-20
 Identities = 65/187 (34%), Positives = 97/187 (51%), Gaps = 25/187 (13%)
 Frame = -1

Query: 855 YCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDP--------- 703
           +  E  A+    S VLDLR++ GGL+ + + +A  FL     V  T GR P         
Sbjct: 220 HLKELGAKGAPKSLVLDLRNDPGGLLTSAIGVAGAFLPPDALVVSTDGRTPDSRHKYRAT 279

Query: 702 --QYTR---SIVAEAPPLI-TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKG 541
             +Y R   + + + P  + T P+++LVN  +ASASEIVA AL D+ RA ++G+RT+GKG
Sbjct: 280 PSEYARGEGNYLNDLPGWVKTVPMVVLVNVGSASASEIVAGALQDHKRAKVLGNRTFGKG 339

Query: 540 LIQSFFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF----------RNLPAWNEVSKH 391
            +Q    L + + V +T  +Y TP+   I   GIEPD+            LP   ++ +H
Sbjct: 340 SVQVILPLSESTAVKLTTSRYFTPSGRSIQATGIEPDYVVADTADGDLFRLPREADLQRH 399

Query: 390 LSKCHKP 370
           LS    P
Sbjct: 400 LSNQQSP 406



>gb:BX640412_805048 Bordetella pertussis strain Tohama I, complete
           genome; segment 2/12.
          Length = 481

 Score =  100 bits (250), Expect = 3e-20
 Identities = 65/187 (34%), Positives = 97/187 (51%), Gaps = 25/187 (13%)
 Frame = -1

Query: 855 YCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDP--------- 703
           +  E  A+    S VLDLR++ GGL+ + + +A  FL     V  T GR P         
Sbjct: 218 HLKELGAKGAPKSLVLDLRNDPGGLLTSAIGVAGAFLPPDALVVSTDGRTPDSRHKYRAT 277

Query: 702 --QYTR---SIVAEAPPLI-TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKG 541
             +Y R   + + + P  + T P+++LVN  +ASASEIVA AL D+ RA ++G+RT+GKG
Sbjct: 278 PSEYARGEGNYLNDLPGWVKTVPMVVLVNVGSASASEIVAGALQDHKRAKVLGNRTFGKG 337

Query: 540 LIQSFFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF----------RNLPAWNEVSKH 391
            +Q    L + + V +T  +Y TP+   I   GIEPD+            LP   ++ +H
Sbjct: 338 SVQVILPLSESTAVKLTTSRYFTPSGRSIQATGIEPDYVVADTADGDLFRLPREADLQRH 397

Query: 390 LSKCHKP 370
           LS    P
Sbjct: 398 LSNQQSP 404



>gb:SME591793_187184 Sinorhizobium meliloti 1021 complete
           chromosome; segment 12/12.
          Length = 440

 Score =  100 bits (249), Expect = 4e-20
 Identities = 58/132 (43%), Positives = 78/132 (59%), Gaps = 1/132 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           +VLDLR N GGL+   + ++  FL  GE V+ T GR+P  TR   A    L    PV++L
Sbjct: 232 YVLDLRLNPGGLLDQAINVSDAFLERGEVVS-TRGRNPDETRRFNATPGDLAGGKPVVVL 290

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           VN  +ASASEIVA AL D  RA ++G R++GKG +Q+   L D   + +T   Y TP+  
Sbjct: 291 VNGGSASASEIVAGALQDLKRATVLGTRSFGKGSVQTIIPLGDAGALRLTTALYYTPSGK 350

Query: 459 DINGNGIEPDFR 424
            I G GI PD +
Sbjct: 351 SIQGTGITPDIK 362



>pir|F97738|F97738 tail-specific proteinase precursor (EC 3.4.21.-)
           [imported] - Rickettsia conorii (strain Malish
           7)>gb:AE008596_238674 Rickettsia conorii str. Malish 7,
           section 28 of 114 of the complete
           genome.>gb:AE006914_1120792 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 469

 Score =  100 bits (248), Expect = 5e-20
 Identities = 55/136 (40%), Positives = 82/136 (60%), Gaps = 2/136 (1%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT--TPVIIL 640
           +LDLR+N GG++   + ++  F++ G  VT T GR       I A    L     P+I+L
Sbjct: 242 ILDLRNNAGGILDQAIAVSDYFIDSGVIVT-TKGRTTSSNSEIKANEFSLKAPKVPMIVL 300

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           +N N+ASASEIVA AL D+ RA+++G +++GKG +Q+  ++   + V +TI KY TP+  
Sbjct: 301 INGNSASASEIVAGALQDHKRAIILGTKSFGKGSVQALTQINSRAAVKLTISKYYTPSGR 360

Query: 459 DINGNGIEPDFRNLPA 412
            I   GIEPD    PA
Sbjct: 361 SIQAEGIEPDILIEPA 376



>gb:BX571658_777994 Wolinella succinogenes, complete genome; segment
           2/7.
          Length = 439

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 54/132 (40%), Positives = 75/132 (56%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVI 646
           A   VLDLR+N GGL+   VE+  LF+NEG  V+       +      ++  P    P+ 
Sbjct: 225 AKGVVLDLRNNPGGLLNQAVELTDLFINEGVIVSQKGRISSEDAEFKASKNSPFAQIPLA 284

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +L+N  +ASASEIVA AL D+ RA+LVG+ T+GKG +Q    L    G+ +TI +Y  P+
Sbjct: 285 VLINNGSASASEIVAGALQDHKRAILVGENTFGKGSVQVVLPLDKNEGLRLTIARYYLPS 344

Query: 465 HMDINGNGIEPD 430
              I   GI PD
Sbjct: 345 GRTIQALGITPD 356



>gb:AE016922_358315 Chromobacterium violaceum ATCC 12472 section 13
           of 16 of the complete genome.>gb:AE016825_1043469
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 473

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 61/144 (42%), Positives = 78/144 (54%), Gaps = 16/144 (11%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAE---------APPLI 661
           VLDLRD+ GGL+   V +A  FL + + V YT GR P     + A          + PL 
Sbjct: 230 VLDLRDDPGGLLNGAVGVAAAFLPKDKLVVYTEGRTPDAKMRLTATLQNYARQNGSDPLA 289

Query: 660 TTPVII-------LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSG 502
             PV +       LVN  +ASASEIVA AL D+ RAVLVG +T+GKG +QS   L    G
Sbjct: 290 KLPVAVRSVPLAVLVNGGSASASEIVAGALQDHKRAVLVGTQTFGKGSVQSILPLGSQGG 349

Query: 501 VVVTIGKYVTPNHMDINGNGIEPD 430
           + +T  +Y TP+   I   GI PD
Sbjct: 350 IKLTTARYFTPSGRSIQAKGITPD 373



>pir|AI3278|AI3278 tail-specific proteinase (EC 3.4.21.-) [imported]
           - Brucella melitensis (strain 16M)>gb:AE009464_252133
           Brucella melitensis 16M chromosome I, section 21 of 195
           of the complete sequence.>gb:AE008917_978045 Brucella
           melitensis 16M chromosome I, complete sequence.
          Length = 442

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 57/132 (43%), Positives = 82/132 (62%), Gaps = 1/132 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQ-YTRSIVAEAPPLITTPVIIL 640
           +VLDLR N GGL+   V ++  FL++GE V+ T GRDPQ  TR  V +       P+I+L
Sbjct: 235 YVLDLRLNPGGLLDQAVAVSDAFLDKGEIVS-TRGRDPQDVTRFDVRKGDLTNGKPLIVL 293

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           +N  +ASASEIVA AL D+ RA ++G +++GKG +Q+   L +   + +T   Y TP+  
Sbjct: 294 INGGSASASEIVAGALQDHRRATVLGTQSFGKGSVQTIIPLGENGSLRLTTALYYTPSGK 353

Query: 459 DINGNGIEPDFR 424
            I G GI PD +
Sbjct: 354 SIQGKGITPDIK 365



>gb:BX640423_808551 Bordetella parapertussis strain 12822, complete
           genome; segment 1/14.
          Length = 495

 Score = 99.4 bits (246), Expect = 8e-20
 Identities = 65/187 (34%), Positives = 96/187 (51%), Gaps = 25/187 (13%)
 Frame = -1

Query: 855 YCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDP--------- 703
           +  E  A+    S VLDLR++ GGL+ + + +A  FL     V  T GR P         
Sbjct: 232 HLKELGAKGAPKSLVLDLRNDPGGLLTSAIGVAGAFLPPDALVVSTDGRTPDSRHKYRTT 291

Query: 702 --QYTR---SIVAEAPPLI-TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKG 541
             +Y R   + + + P  + T P+++LVN  +ASASEIVA AL D+ RA ++G RT+GKG
Sbjct: 292 PSEYARGEGNYLNDLPGWVKTVPMVVLVNVGSASASEIVAGALQDHKRAKVLGIRTFGKG 351

Query: 540 LIQSFFELQDGSGVVVTIGKYVTPNHMDINGNGIEPDF----------RNLPAWNEVSKH 391
            +Q    L + + V +T  +Y TP+   I   GIEPD+            LP   ++ +H
Sbjct: 352 SVQVILPLSESTAVKLTTSRYFTPSGRSIQATGIEPDYVVADTADGDLFRLPREADLQRH 411

Query: 390 LSKCHKP 370
           LS    P
Sbjct: 412 LSNQQSP 418



>pir|B69610|B69610 carboxy-terminal processing proteinase ctpA (EC
           3.4.99.-) - Bacillus subtilis>gb:AF006665_467759
           Bacillus subtilis 168 region at 182 min containing the
           cge gene cluster.>gb:AF015775_468970 Bacillus subtilis
           YodA (yodA), YodB (yodB), YodC (yodC), YodD (yodD),
           ABC-transporter (yodE), permease (yodF), proteinase
           (ctpA), YodH (yodH), YodI (yodI), carboxypeptidase
           (yodJ), purine nucleoside phosphorylase (deoD), YodL
           (yodL), YodM (yodM), YodN (yodN), YodO (yodO), YodP
           (yodP), acetylornitine deacetylase (argE),
           butirate-acetoacetate CoA transferase (yodR), butyrate
           acetoacetate-CoA transferase (yodS), YodT (yodT), CgeE
           (cgeE), CgeD (cgeD), CgeC (cgeC), CgeA (cgeA), CgeB
           (cgeB), YzxA (yzxA), UDP-glucose epimerase (yodU), YodV
           (yodV), and YodW (yodW) genes, complete cds; and YodZ
           (yodZ) gene, partial cds.>gb:BSUB0011_753924 Bacillus
           subtilis complete genome (section 11 of 21): from
           2014895 to 2207855.
          Length = 466

 Score = 99.4 bits (246), Expect = 8e-20
 Identities = 49/141 (34%), Positives = 87/141 (61%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           ++  + GA  ++LDLR N GGL++  + ++ LF+++G+ +     ++      + AE   
Sbjct: 223 DSLEKKGAKGYILDLRGNPGGLMEQAITMSNLFIDKGKNIMQVEYKNGS-KEVMKAEKER 281

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
            +T P ++LVN  TASA+EI+A ALH++    L+G+ T+GKG +Q+  E  DGS V +T+
Sbjct: 282 KVTKPTVVLVNDGTASAAEIMAAALHESSNVPLIGETTFGKGTVQTAKEYDDGSTVKLTV 341

Query: 486 GKYVTPNHMDINGNGIEPDFR 424
            K++T +   I+  GI+P  +
Sbjct: 342 AKWLTADGEWIHKKGIKPQVK 362



>gb:AE015944_321531 Clostridium tetani E88, section 9 of 10 of the
           complete genome.>gb:AE015927_964320 Clostridium tetani
           E88, complete genome.
          Length = 399

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 51/133 (38%), Positives = 82/133 (61%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           G    VLDLR N GG++   V++   F+ +G+T+  T+ +     R   ++    +  P+
Sbjct: 235 GMKGLVLDLRGNPGGVLDECVDMVSNFVPKGKTIVSTMDKYKS-ERKYKSKGGNYVGLPL 293

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++L N+ +ASASEI A A+ D     LVG++T+GKGL+Q+ +E  +G+ + +TI KY TP
Sbjct: 294 VVLTNEGSASASEIFAGAIRDYKIGTLVGEKTFGKGLVQTLYETGEGTALKITISKYYTP 353

Query: 468 NHMDINGNGIEPD 430
           N  +IN  GI+PD
Sbjct: 354 NGENINKIGIKPD 366



>gb:AE017197_402207 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 442

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 54/144 (37%), Positives = 83/144 (57%), Gaps = 2/144 (1%)
 Frame = -1

Query: 837 ARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT 658
           ++      +LDLR+N GG++   + ++  F++ G  VT T GR         A    L  
Sbjct: 217 SKDNLKGIILDLRNNAGGILDQAIAVSDYFIDSGVIVT-TKGRTTSSNSETKANEFSLKA 275

Query: 657 --TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIG 484
              P+I+L+N N+ASASEIVA AL D+ RA+++G +++GKG +Q+  ++   + V +TI 
Sbjct: 276 PRVPMIVLINGNSASASEIVAGALQDHKRAIILGTKSFGKGSVQALTQINSRAAVKLTIS 335

Query: 483 KYVTPNHMDINGNGIEPDFRNLPA 412
           KY TP+   I   GIEPD    PA
Sbjct: 336 KYYTPSGRSIQAEGIEPDILIEPA 359



>gb:AE016937_362165 Bacteroides thetaiotaomicron VPI-5482, section
           12 of 21 of the complete genome.>gb:AE015928_988653
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 565

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 55/124 (44%), Positives = 77/124 (62%), Gaps = 1/124 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPL-IT 658
           + GA+S V+DLR+N GGL+   VEIA  FL  G+ +  T G+  Q + +      PL + 
Sbjct: 228 KQGATSLVIDLRNNGGGLLDEAVEIANYFLPRGKVIVTTKGKTKQASNTYKTLREPLDLD 287

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
            P+ +LVN  TASASEI++ +L D  RAV+VG+RT+GKGL+Q    L  G  + VT  KY
Sbjct: 288 IPIAVLVNSGTASASEILSGSLQDLDRAVIVGNRTFGKGLVQVPRSLPYGGMMKVTTSKY 347

Query: 477 VTPN 466
             P+
Sbjct: 348 YIPS 351



>gb:AE014291_309246 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 424

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 56/132 (42%), Positives = 80/132 (60%), Gaps = 1/132 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           +VLDLR N GGL+   V ++  FL++GE V+ T GRDPQ      A    L    P+I+L
Sbjct: 217 YVLDLRLNPGGLLDQAVAVSDAFLDKGEIVS-TRGRDPQDVTRFDARKGDLTNGKPLIVL 275

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           +N  +ASASEIVA AL D+ RA ++G +++GKG +Q+   L +   + +T   Y TP+  
Sbjct: 276 INGGSASASEIVAGALQDHRRATVLGTQSFGKGSVQTIIPLGENGSLRLTTALYYTPSGK 335

Query: 459 DINGNGIEPDFR 424
            I G GI PD +
Sbjct: 336 SIQGKGITPDIK 347



>pir|A71677|A71677 tail-specific proteinase precursor (ctp) RP228 -
           Rickettsia prowazekii>gb:RPXX02_167025 Rickettsia
           prowazekii strain Madrid E, complete genome; segment
           2/4.
          Length = 441

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 54/144 (37%), Positives = 83/144 (57%), Gaps = 2/144 (1%)
 Frame = -1

Query: 837 ARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT 658
           ++      +LDLR+N GG++   + ++  F++ G  VT T GR         A    L  
Sbjct: 217 SKDNLKGIILDLRNNAGGILDQAIAVSDYFIDSGVIVT-TKGRTTSSNSETKANEFSLKA 275

Query: 657 --TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIG 484
              P+I+L+N N+ASASEIVA AL D+ RA+++G +++GKG +Q+  ++   + V +TI 
Sbjct: 276 PKVPMIVLINGNSASASEIVAGALQDHKRAIILGTKSFGKGSVQALTQINSRAAVKLTIS 335

Query: 483 KYVTPNHMDINGNGIEPDFRNLPA 412
           KY TP+   I   GIEPD    PA
Sbjct: 336 KYYTPSGRSIQAEGIEPDILIEPA 359



>pir|D96961|D96961 carboxyl-terminal protease [imported] -
           Clostridium acetobutylicum>gb:AE007564_227840
           Clostridium acetobutylicum ATCC 824 section 52 of 356 of
           the complete genome.>gb:AE001437_1090795 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 403

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 49/133 (36%), Positives = 82/133 (61%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           G    +LDLR N GGL+ A +++   F+ + + +  T+ +         ++    I  P+
Sbjct: 238 GMKGLILDLRSNPGGLLSACIQVTSNFVTKDKVIVSTIDKYNS-KEEYKSKGGNYIGLPL 296

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LV+ NTASASEI + A+ D     L+G++T+GKG++Q+ F+L DG+ + +TI KY TP
Sbjct: 297 VVLVDGNTASASEIFSGAIRDYKLGTLIGEKTFGKGVVQAPFDLNDGTQLKITISKYYTP 356

Query: 468 NHMDINGNGIEPD 430
           N  +I+  GI+PD
Sbjct: 357 NGENIHHKGIKPD 369



>gb:AE016952_365718 Enterococcus faecalis V583, section 6 of 11 of
           the complete genome.>gb:AE016830_992206 Enterococcus
           faecalis V583, complete genome.
          Length = 477

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 52/138 (37%), Positives = 81/138 (58%), Gaps = 3/138 (2%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY---TVGRDPQYTRSIVAEAPPLIT 658
           GA SFV+D+R N GGL+     +A +FL  GET+       GR  +   S   +    + 
Sbjct: 236 GAKSFVIDVRQNPGGLLDQAERMASMFLKNGETIVQFEDKKGRTMKEVASKELDGGFKVK 295

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
            PV ++++ N+ASASEI A ALH++    L+G +T+GKG +Q+  +L D + + +T+ K+
Sbjct: 296 EPVAVIIDGNSASASEIFAAALHESANVPLIGTKTFGKGTVQTVKDLNDQTEIKLTVLKW 355

Query: 477 VTPNHMDINGNGIEPDFR 424
           +TP    IN  GIEP  +
Sbjct: 356 LTPKGEWINEKGIEPTIK 373



>gb:BX321862_774110 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 7/10.
          Length = 476

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 60/173 (34%), Positives = 93/173 (53%), Gaps = 24/173 (13%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGR----------DPQYT-----RSIVA 679
           +LDLR++ GGL+ + V ++  FL     V YT GR          +P+Y      R  +A
Sbjct: 238 ILDLRNDPGGLLNSAVAVSAAFLPSNALVVYTEGRTNDAKMQLRANPEYYLRGSGRDFLA 297

Query: 678 EAPPLITT-PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSG 502
             P  I T P++ LVN  +ASASEIVA AL D+ R++++G +T+GKG +Q+   L + + 
Sbjct: 298 NLPQSIKTIPMVTLVNGGSASASEIVAGALQDHKRSIVMGSQTFGKGSVQTILPLSNNTA 357

Query: 501 VVVTIGKYVTPNHMDINGNGIEPDFRNLPAWN--------EVSKHLSKCHKPK 367
           + +T  +Y TPN   I   GI PD  +    N        ++++HLS   + K
Sbjct: 358 IKLTTARYFTPNGQSIQAKGITPDILDEETDNDSRLLREADLNRHLSNGQEEK 410



>gb:AE017282_429241 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 441

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 54/141 (38%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
 Frame = -1

Query: 849 NEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAP 670
           +E   +      VLDLR+N GG++ A V ++  FL  G  + YT GR         A   
Sbjct: 221 DEMKKKGALKGLVLDLRNNPGGVLNAAVAVSDAFLESG-LIVYTDGRVEDAKMRFSATPN 279

Query: 669 PLIT-TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVV 493
            +I   P+++L+N  +ASASEIVA AL D+ RAV++G++T+GKG +Q+     +G  V +
Sbjct: 280 DVIGGAPMVVLINGGSASASEIVAGALQDHKRAVIMGEKTFGKGSVQTILPTSNGGAVKL 339

Query: 492 TIGKYVTPNHMDINGNGIEPD 430
           T  +Y TP+   I   GI PD
Sbjct: 340 TTARYYTPSGRSIQAEGITPD 360



>gb:AE011325_271686 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 134 of 397 of the complete
           sequence.>gb:AE017296_434483 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 10 of 14 of the complete
           sequence.>gb:AE010300_1005085 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1067494 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 462

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 50/135 (37%), Positives = 79/135 (58%), Gaps = 2/135 (1%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAP--PLITT 655
           GA   +LDLR N GGL+   + ++ LFL     +    GR  +  R   + A     I  
Sbjct: 227 GAEGLILDLRMNPGGLLDLAIALSDLFLKPDLDIVSVRGRGGELVRVFRSTAANDKFINL 286

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++L+N+ +ASASEI A A+ D+ R  ++G  ++GKG +Q+ + L   +G+ +TI KY 
Sbjct: 287 PLVVLINEGSASASEIFAGAMQDHGRGKILGTVSFGKGSVQNIYSLSHNTGIALTIQKYY 346

Query: 474 TPNHMDINGNGIEPD 430
           TP+   I+G GI+PD
Sbjct: 347 TPSGKSIHGKGIQPD 361



>gb:CR543861_102319 Acinetobacter sp. ADP1 complete genome.
          Length = 393

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 54/135 (40%), Positives = 83/135 (61%), Gaps = 1/135 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           ++DLR+N GGL+ A VE A LFLN+G  V+ T  R     +     +   +   + IL+N
Sbjct: 239 IIDLRNNPGGLLSAAVESADLFLNQGIIVS-TKSRSEGNQQFQALPSSEFLRLKMGILIN 297

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASA+E+   A+ D+ RA ++G+++YGKG++Q  F L DGS + +T+  Y TP+   I
Sbjct: 298 HRSASAAEVFTAAMKDHQRAWVIGEKSYGKGVVQKLFPLPDGSALQMTVSHYYTPDGSMI 357

Query: 453 NGNGIEPDFR-NLPA 412
            G GI+P+ R  LPA
Sbjct: 358 EGKGIQPNQRYPLPA 372



>gb:CP000031_87798 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 443

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 53/132 (40%), Positives = 82/132 (62%), Gaps = 1/132 (0%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVI 646
           + FVLDLR+N GGL+   ++++  FL+ GE V+ T GR+P+      A    L    PV+
Sbjct: 232 NGFVLDLRNNPGGLLTQAIKVSDAFLDSGEIVS-TRGRNPEDGERFNATLGDLAQGKPVV 290

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +L+N  +ASASEIVA AL D+ RA++VG +++GKG +Q+   L+    + +T  +Y TP+
Sbjct: 291 VLINGGSASASEIVAGALQDHRRAIVVGTKSFGKGSVQTVMPLRGDGAMRLTTARYYTPS 350

Query: 465 HMDINGNGIEPD 430
              I   G+ PD
Sbjct: 351 GRSIQALGVSPD 362



>gb:CR628336_110673 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_113731 Legionella pneumophila str.
           Lens complete genome.>gb:AE017354_458882 Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1,
           complete genome.
          Length = 445

 Score = 97.1 bits (240), Expect = 4e-19
 Identities = 51/134 (38%), Positives = 81/134 (60%), Gaps = 6/134 (4%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEG-----ETVTYTVGRDPQYTRSIVAEAPPLI-TTP 652
           VLDLR+N GGL+ + ++++  FL        E + YT GR P    + +A    ++   P
Sbjct: 239 VLDLRNNPGGLLDSAIQVSDAFLGNDKAGKQEMIVYTEGRLPGSKFTALANPGDVLDNAP 298

Query: 651 VIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVT 472
           +++L+N  +ASASEIVA AL DN RA+++G +++GKG +Q+   L   +G+ +T   Y T
Sbjct: 299 IVVLINNGSASASEIVAGALKDNKRAIILGTKSFGKGSVQTVLPLDGKTGIKLTTALYYT 358

Query: 471 PNHMDINGNGIEPD 430
           P+ + I   GI PD
Sbjct: 359 PSGVSIQAKGIIPD 372



>gb:AE017180_400068 Geobacter sulfurreducens PCA, complete genome.
          Length = 443

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 52/129 (40%), Positives = 79/129 (61%), Gaps = 1/129 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT-PVIILV 637
           VLDLR++ GGL+   V++A  F+ +G  + YT GR+ +      A         P+++L+
Sbjct: 236 VLDLRNDPGGLLDQAVKVADHFVEDG-LIVYTEGREKESRMQFTARKSGTEPNYPMVVLI 294

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           N  +ASASEIVA AL D+ RAV++G +++GKG +Q+   L D SG+ +T  +Y TP+   
Sbjct: 295 NSGSASASEIVAGALQDHKRAVVMGTQSFGKGSVQTIIPLSDESGLRLTTARYFTPSGRS 354

Query: 456 INGNGIEPD 430
           I   GI PD
Sbjct: 355 IQAKGITPD 363



>gb:AE016793_334437 Pseudomonas putida KT2440 section 20 of 21 of
           the complete genome.>gb:AE015451_949514 Pseudomonas
           putida KT2440 complete genome.
          Length = 438

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 57/135 (42%), Positives = 78/135 (57%), Gaps = 1/135 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAE-APPLITTPVIILV 637
           VLDLR+N GG++Q+ VE+A  FL +G  + YT GR         A+ A      P+++L+
Sbjct: 242 VLDLRNNPGGVLQSAVEVADHFLTKG-LIVYTKGRIANSELRFSADPADASAGVPLVVLI 300

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           N  +ASASEIVA AL D  RAVL+G  ++GKG +Q+   L +   + +T   Y TPN   
Sbjct: 301 NGGSASASEIVAGALQDQKRAVLMGTDSFGKGSVQTVLPLANDRALKLTTALYYTPNGRS 360

Query: 456 INGNGIEPDFRNLPA 412
           I   GI PD    PA
Sbjct: 361 IQAQGIVPDIEVRPA 375



>pir|B83005|B83005 probable carboxyl-terminal proteinase PA5134
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004926_59366 Pseudomonas aeruginosa PAO1,
           section 487 of 529 of the complete
           genome.>gb:AE004091_973466 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 436

 Score = 96.3 bits (238), Expect = 7e-19
 Identities = 54/129 (41%), Positives = 77/129 (59%), Gaps = 1/129 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAE-APPLITTPVIILV 637
           VLDLR+N GG++Q+ VE+A  FL +G  + YT GR         A+ A P    P+++L+
Sbjct: 238 VLDLRNNPGGVLQSAVEVADAFLTKG-LIVYTKGRIANSELRFSADPADPSDKVPLVVLI 296

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           N  +ASA+EIVA AL D  RA+L+G  ++GKG +Q+   L +   + +T   Y TPN   
Sbjct: 297 NGGSASAAEIVAGALQDQKRAILMGTDSFGKGSVQTVLPLNNDRALKLTTALYYTPNGRS 356

Query: 456 INGNGIEPD 430
           I   GI PD
Sbjct: 357 IQAQGIVPD 365



>gb:AE015456_314473 Shewanella oneidensis MR-1 section 5 of 457 of
           the complete genome.>gb:AE014299_950070 Shewanella
           oneidensis MR-1 complete genome.
          Length = 402

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 54/135 (40%), Positives = 84/135 (62%), Gaps = 2/135 (1%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT-PVI 646
           +  +LDLR+N GGL+   + IA LFL +G  V+ T GR         A    ++   P++
Sbjct: 227 TGLILDLRNNPGGLLDQAINIADLFLAKGRIVS-TSGRFFDANSDYYASPQTMLANVPML 285

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFE-LQDGSGVVVTIGKYVTP 469
           +L+NK +ASASE++A AL +N RA L+G+ ++GKG +QS    L +G+ V +TI +Y TP
Sbjct: 286 VLINKGSASASEVLAAALQENGRAKLLGETSFGKGTVQSLIPILNNGNAVKLTIAQYNTP 345

Query: 468 NHMDINGNGIEPDFR 424
              +I+  GI+PD +
Sbjct: 346 KGENIHDIGIKPDIK 360



>pir|E81846|E81846 probable carboxy-terminal processing proteinase
           NMA1546 [imported] - Neisseria meningitidis (strain
           Z2491 serogroup A)>gb:NMA5Z2491_154429 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 5/7.
          Length = 494

 Score = 95.9 bits (237), Expect = 9e-19
 Identities = 59/145 (40%), Positives = 78/145 (53%), Gaps = 17/145 (11%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP----------- 667
           VLDLRD+ GGL+   V ++  FL     V  T GRD +  R ++   P            
Sbjct: 240 VLDLRDDPGGLLTGAVGVSAAFLPSEAVVVSTKGRDGK-DRMVLKAVPEDYVYGMGGDSL 298

Query: 666 ------LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGS 505
                 L T P+ +LVN  +ASASEIVA AL D+ RAV+VG +++GKG +Q+   L +GS
Sbjct: 299 AGIPAELKTIPMTVLVNSGSASASEIVAGALQDHKRAVIVGTQSFGKGSVQTLIPLSNGS 358

Query: 504 GVVVTIGKYVTPNHMDINGNGIEPD 430
            V +T   Y TPN   I   GI PD
Sbjct: 359 AVKLTTALYYTPNDRSIQAQGIVPD 383



>gb:AP008226_578753 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 439

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 57/134 (42%), Positives = 78/134 (58%), Gaps = 1/134 (0%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRS-IVAEAPPLITTP 652
           G    + DLRDN GGL+  G  +A  FL EG  V YT  R    TR    A    L   P
Sbjct: 228 GVKKLIFDLRDNGGGLLDQGCAVASAFLKEGPIV-YT--RTKNLTRVWCEATGQTLWDGP 284

Query: 651 VIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVT 472
           +++LVN N+ASASEIVA AL D  RA ++G++T+GKG+ Q+ + L +G  + +   +++T
Sbjct: 285 MVVLVNGNSASASEIVAGALQDYGRAKVIGEKTFGKGVGQTPYTLANGGELTLVTFEWLT 344

Query: 471 PNHMDINGNGIEPD 430
           P    IN  GI PD
Sbjct: 345 PKRRSINKEGITPD 358



>gb:AL646058_545280 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 2/19.
          Length = 549

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 56/145 (38%), Positives = 79/145 (54%), Gaps = 17/145 (11%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTR-----------------SI 685
           +LDLR+N GG++QA V ++  FL    TV  T G+ P   R                  +
Sbjct: 248 ILDLRNNGGGVLQAAVGVSAAFLPPDVTVVSTNGQVPDAKRVYKTSFANYRLSNFDTDPL 307

Query: 684 VAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGS 505
           V+  P   T P+++L N  TASASEIVA AL D+ RA ++G  T+GKG +Q+   L + +
Sbjct: 308 VSLDPEFKTVPIVVLTNAYTASASEIVAGALQDHHRAKVMGKTTFGKGSVQTVRPLSNDT 367

Query: 504 GVVVTIGKYVTPNHMDINGNGIEPD 430
           G+ +TI  Y TP+   I   GI PD
Sbjct: 368 GIKLTIAYYYTPSGKSIQAKGIRPD 392



>gb:AE017304_436565 Thermus thermophilus HB27 section 4 of 7 of the
           complete genome.>gb:AE017221_1078543 Thermus
           thermophilus HB27 complete genome.
          Length = 439

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 57/134 (42%), Positives = 78/134 (58%), Gaps = 1/134 (0%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRS-IVAEAPPLITTP 652
           G    + DLRDN GGL+  G  +A  FL EG  V YT  R    TR    A    L   P
Sbjct: 228 GVKKLIFDLRDNGGGLLDQGCAVASAFLKEGPIV-YT--RTKNLTRVWCEATGQTLWDGP 284

Query: 651 VIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVT 472
           +++LVN N+ASASEIVA AL D  RA ++G++T+GKG+ Q+ + L +G  + +   +++T
Sbjct: 285 MVVLVNGNSASASEIVAGALQDYGRAKVIGEKTFGKGVGQTPYTLANGGELTLVTFEWLT 344

Query: 471 PNHMDINGNGIEPD 430
           P    IN  GI PD
Sbjct: 345 PKRRSINKEGITPD 358



>gb:AE004969_60334 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 491

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 60/146 (41%), Positives = 79/146 (54%), Gaps = 18/146 (12%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP----------- 667
           VLDLRD+ GGL+   V ++  FL     V  T GRD +    +V +A P           
Sbjct: 240 VLDLRDDPGGLLTGAVGVSAAFLPSEAVVVSTKGRDGK--DGMVLKAVPEDYVYGMGGDP 297

Query: 666 -------LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDG 508
                  L T P+ +LVN  +ASASEIVA AL D+ RAV+VG +++GKG +Q+   L +G
Sbjct: 298 LAGIPAELKTIPMTVLVNSGSASASEIVAGALQDHKRAVIVGTQSFGKGSVQTLIPLSNG 357

Query: 507 SGVVVTIGKYVTPNHMDINGNGIEPD 430
           S V +T   Y TPN   I   GI PD
Sbjct: 358 SAVKLTTALYYTPNDRSIQAQGIVPD 383



>pir|G81095|G81095 carboxy-terminal peptidase NMB1332 [imported] -
           Neisseria meningitidis (strain MC58 serogroup
           B)>gb:AE002481_46752 Neisseria meningitidis serogroup B
           strain MC58 section 123 of 206 of the complete
           genome.>gb:AE002098_896865 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 494

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 59/145 (40%), Positives = 78/145 (53%), Gaps = 17/145 (11%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP----------- 667
           VLDLRD+ GGL+   V ++  FL     V  T GRD +  R ++   P            
Sbjct: 240 VLDLRDDPGGLLTGAVGVSAAFLPSEAVVVSTKGRDGK-DRMVLKAIPEDYVYGMGGDSL 298

Query: 666 ------LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGS 505
                 L T P+ +LVN  +ASASEIVA AL D+ RAV+VG +++GKG +Q+   L +GS
Sbjct: 299 AGIPAELKTIPMTVLVNSGSASASEIVAGALQDHKRAVIVGTQSFGKGSVQTLIPLSNGS 358

Query: 504 GVVVTIGKYVTPNHMDINGNGIEPD 430
            V +T   Y TPN   I   GI PD
Sbjct: 359 AVKLTTALYYTPNDRSIQAQGIVPD 383



>gb:AL935257_551606 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 6/11.
          Length = 492

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 51/149 (34%), Positives = 83/149 (55%), Gaps = 3/149 (2%)
 Frame = -1

Query: 861 FSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRD---PQYTR 691
           F    +A  + GA   V+D+R N GGL+ A +++A +FL  G+T+     RD    +YT 
Sbjct: 239 FKTALKALDKKGAKKLVIDMRGNPGGLMTAALKMASIFLKNGKTIMQVQARDGSTEKYTA 298

Query: 690 SIVAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD 511
           S   +     T    +L++  +ASA+EI + ALH +    LVG ++YGKG +Q+     D
Sbjct: 299 SKKYDGGFKETKSTTVLIDGGSASAAEIFSAALHQSAGVKLVGSQSYGKGTVQTVTTFND 358

Query: 510 GSGVVVTIGKYVTPNHMDINGNGIEPDFR 424
            + + +T+ K++TPN   IN  G+ PD +
Sbjct: 359 KTEMKITVAKWLTPNGTWINKKGLTPDVK 387



>gb:AE016875_354667 Pseudomonas syringae pv. tomato str. DC3000
           section 20 of 21 of the complete
           genome.>gb:AE016853_1039842 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 445

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 53/132 (40%), Positives = 76/132 (57%), Gaps = 1/132 (0%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAE-APPLITTPVI 646
           S  +LDLR+N GG++Q+ V++A  FL +G  + YT GR         A+ A      P++
Sbjct: 244 SGLILDLRNNPGGVLQSAVQVADHFLTKG-LIVYTKGRIANSELRFSADPADASEGVPLV 302

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +L+N  +ASASEIVA AL D  R +L+G  T+GKG +Q+   L +   + +T   Y TPN
Sbjct: 303 VLINGGSASASEIVAGALQDQKRGILMGTDTFGKGSVQTVLPLNNDRALKITTALYYTPN 362

Query: 465 HMDINGNGIEPD 430
              I   GI PD
Sbjct: 363 GRSIQAQGINPD 374



>gb:AE013598_298287 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 512

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 55/134 (41%), Positives = 79/134 (58%), Gaps = 1/134 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIILV 637
           VLDLR N GGL+ + V++A   L++G  V+ T GR         A    L+   PV++LV
Sbjct: 245 VLDLRSNPGGLLTSAVQVADDLLDKGNIVS-TRGRISISDAKFDATPGDLVNGAPVVVLV 303

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           +  +ASASE++A AL DN RA ++G RT+GKG +Q+   L +G  V +T  +Y TP+   
Sbjct: 304 DAGSASASEVLAGALRDNKRARIIGSRTFGKGSVQTVLPLDNGDSVKLTTARYYTPSGKS 363

Query: 456 INGNGIEPDFRNLP 415
           I  +GI PD    P
Sbjct: 364 IQASGIVPDVMLTP 377



>gb:AE017175_397315 Porphyromonas gingivalis W83 section 4 of 8 of
           the complete genome.>gb:AE015924_1032926 Porphyromonas
           gingivalis W83 complete genome.
          Length = 569

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 51/124 (41%), Positives = 76/124 (61%), Gaps = 1/124 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           + GA   +LDLR N GGL+QA +EI  LF+ +G+ V  T GR  +          P+ T 
Sbjct: 232 KQGAKGLILDLRGNGGGLMQAAIEIVNLFVPKGKEVVTTKGRIAESASVFRTLTEPIDTK 291

Query: 654 -PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
            P+++L++  +AS+SEIVA AL D  RAVL+G ++YGKGL+Q+  +L     + +T  KY
Sbjct: 292 LPIVVLIDGQSASSSEIVAGALQDMDRAVLMGQKSYGKGLVQTTRQLPYNGVIKLTTAKY 351

Query: 477 VTPN 466
             P+
Sbjct: 352 YIPS 355



>gb:AE017172_396604 Porphyromonas gingivalis W83 section 1 of 8 of
           the complete genome.>gb:AE015924_1032215 Porphyromonas
           gingivalis W83 complete genome.
          Length = 507

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 56/128 (43%), Positives = 79/128 (61%), Gaps = 3/128 (2%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETV-TYTVGRDPQYTRSIVAEAPPLITT- 655
           G    VLDLR N GG++   VE+A  FL EG TV T    R P+ +  + A +  L+   
Sbjct: 191 GMQQLVLDLRFNGGGILDQAVEMAGTFLPEGSTVLTVRNNRMPRISERMEATSNNLLPKD 250

Query: 654 -PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
            P+++LVN+ +ASASEI+A A+ D  R V++G RT+GKGL+Q     QDGS + +TI +Y
Sbjct: 251 LPLVVLVNEFSASASEILAGAIQDWDRGVVIGRRTFGKGLVQRPLPFQDGSMIRLTIARY 310

Query: 477 VTPNHMDI 454
            TP+   I
Sbjct: 311 YTPSGRSI 318



>gb:BX897699_826795 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 436

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 52/129 (40%), Positives = 74/129 (57%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILV 637
           +VLDLR N GGL+   V ++  FLN+GE V+    R    TR        +   P+I+L+
Sbjct: 229 YVLDLRLNPGGLLDQAVSVSGAFLNKGEIVSTRGRRKNDVTRFDAKPGDIIKGKPLIVLI 288

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           N  +ASASEIVA AL D+ RA ++G +++GKG +Q+   L +   + +T   Y TP    
Sbjct: 289 NGGSASASEIVAGALQDHRRATILGTQSFGKGSVQTIIPLGENGALRLTTALYYTPAGTS 348

Query: 456 INGNGIEPD 430
           I G GI PD
Sbjct: 349 IQGTGITPD 357



>gb:BA000030_702993 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 389

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 55/132 (41%), Positives = 75/132 (56%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVI 646
           A   VLDLR N GGLV   V  A  FL+ G   TY V  +     ++ A++    T P++
Sbjct: 239 ADGIVLDLRGNSGGLVTEAVTAASAFLDGGLVATYDVNGEQC---ALHADSGADTTRPLV 295

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
            LV+  T SA+E++  AL D  RAV+VG RT+GKG +Q    L  GS   +T+G Y TP+
Sbjct: 296 ALVDGGTMSAAELLTGALQDRGRAVVVGTRTFGKGSVQMPSRLPGGSVAELTVGHYRTPS 355

Query: 465 HMDINGNGIEPD 430
              ++G GI PD
Sbjct: 356 GHSVDGRGITPD 367



>gb:AE011625_274986 Xanthomonas axonopodis pv. citri str. 306,
           section 3 of 469 of the complete
           genome.>gb:AE008923_916761 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 508

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 54/129 (41%), Positives = 78/129 (60%), Gaps = 1/129 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIILV 637
           VLDLR N GGL+ + V++A   L++G  V+ T GR         A    L+   PV++LV
Sbjct: 240 VLDLRSNPGGLLTSAVQVADDLLDKGNIVS-TRGRISISDAKFDATPGDLLNGAPVVVLV 298

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           +  +ASASE++A AL DN RA ++G RT+GKG +Q+   L +G  V +T  +Y TP+   
Sbjct: 299 DAGSASASEVLAGALRDNKRARIIGSRTFGKGSVQTVLPLDNGDSVKLTTARYYTPSGKS 358

Query: 456 INGNGIEPD 430
           I  +GI PD
Sbjct: 359 IQASGIVPD 367



>gb:AE008692_241405 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 448

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 51/130 (39%), Positives = 81/130 (62%), Gaps = 1/130 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           ++LDLR N GGL+   V ++ +FL+ GE V+   GR+    R   ++   L    P+I+L
Sbjct: 222 YILDLRSNPGGLLDQAVALSDIFLDHGEVVSER-GREKTDIRRYFSKPGDLANGLPLIVL 280

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           V+  +ASASEIV+ AL D+ RA+++G R++GKG +Q+   L D + + +T  +Y TP+  
Sbjct: 281 VDGGSASASEIVSGALQDHHRALIMGTRSFGKGSVQTLLPLGDDTALRLTTARYYTPSGR 340

Query: 459 DINGNGIEPD 430
            +   GIEPD
Sbjct: 341 SVQEGGIEPD 350



>gb:CR555306_105959 Azoarcus sp. EbN1 complete genome.
          Length = 461

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 55/144 (38%), Positives = 76/144 (52%), Gaps = 16/144 (11%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLI--------- 661
           VLDLR++ GGL+   V +A  FL     V  T GR     R   A A   +         
Sbjct: 233 VLDLRNDPGGLLHGAVGVASAFLPANALVVSTDGRTDDAKREYRARADDYLRGSREDFLK 292

Query: 660 -------TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSG 502
                  T P+++LVN  +ASASEIVA AL D+ RAV++G +T+GKG +Q+   L   + 
Sbjct: 293 DLPAGARTLPMVVLVNAGSASASEIVAGALQDHRRAVVMGTQTFGKGSVQTILPLNSNTA 352

Query: 501 VVVTIGKYVTPNHMDINGNGIEPD 430
           + +T  +Y TP+   I   GIEPD
Sbjct: 353 IKLTTARYYTPSGRSIQAKGIEPD 376



>gb:BA000012_669052 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 443

 Score = 93.6 bits (231), Expect = 5e-18
 Identities = 55/134 (41%), Positives = 77/134 (57%), Gaps = 3/134 (2%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVA---EAPPLITTPVI 646
           +VLDLR N GGL+   V ++  FL  GE V+ T GRDP+      A   +   +   P+I
Sbjct: 233 YVLDLRLNPGGLLDQAVSVSDAFLKRGEIVS-TRGRDPKDVTRFDAKPKQTDDINGKPMI 291

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +LVN  +ASASEIVA AL D  R  +VG +++GKG +Q+   L +   + +T   Y TP+
Sbjct: 292 VLVNGGSASASEIVAGALQDLRRVTVVGTQSFGKGSVQTIIPLGENGALRLTTALYYTPS 351

Query: 465 HMDINGNGIEPDFR 424
              I G GI PD +
Sbjct: 352 GKSIQGKGITPDIK 365



>gb:CR522870_101401 Desulfotalea psychrophila LSv54 chromosome.
          Length = 438

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 51/131 (38%), Positives = 81/131 (61%), Gaps = 3/131 (2%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT---PVII 643
           +LDLR+N GGL+   + I+ LF++ G  + +T GR  +  +++  EA  L      P+++
Sbjct: 231 ILDLRNNPGGLLSQAISISDLFISSG-AIVHTRGRAAE--QNMTFEARDLGEDNDFPMLV 287

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           L+N  +ASASEIVA AL D  RA++VG  ++GKG +Q+   L +G+ + +T  +Y TP +
Sbjct: 288 LINGGSASASEIVAGALQDQGRAIIVGTDSFGKGSVQTIIPLPNGAALKITTAQYYTPKN 347

Query: 462 MDINGNGIEPD 430
             I   GI PD
Sbjct: 348 RSIQAQGIHPD 358



>gb:AP006841_574889 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 561

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 52/124 (41%), Positives = 74/124 (59%), Gaps = 1/124 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPL-IT 658
           + G +S V+DLR N GG ++  VEIA  FL  G+ +  T G+  Q + +      PL + 
Sbjct: 228 KEGITSLVIDLRGNGGGRLEEAVEIANFFLPRGKVIVTTKGKTKQASNTYKTLREPLDLD 287

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
            P+ +LVN  TASASEI++ A  D  RAV+VG RT+GKGL+Q+   L  G  + +T  KY
Sbjct: 288 IPITVLVNGATASASEILSGAFQDFDRAVIVGSRTFGKGLVQTTRPLPYGGVMKLTTSKY 347

Query: 477 VTPN 466
             P+
Sbjct: 348 YIPS 351



>gb:AP006841_571490 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 575

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 46/116 (39%), Positives = 69/116 (59%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           ++DLR N GG ++A V +   FL EG+ + YT GR                  PVI+L++
Sbjct: 237 IIDLRGNTGGYMEAAVRMVNEFLPEGKLIVYTEGRKYPRADEFANGTGSCQKMPVIVLID 296

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           + +ASASEI   A+ DN R ++VG R++GKGL+Q   +  DGS + +TI +Y TP+
Sbjct: 297 EGSASASEIFTGAIQDNDRGMVVGRRSFGKGLVQQPIDFSDGSAIRLTIARYYTPS 352



>pir|F64688|F64688 proteinase (EC 3.4.-.-) - Helicobacter pylori
           (strain 26695)>gb:AE000636_25513 Helicobacter pylori
           26695 section 114 of 134 of the complete
           genome.>gb:AE000511_880952 Helicobacter pylori 26695
           complete genome.
          Length = 459

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 51/133 (38%), Positives = 74/133 (55%), Gaps = 1/133 (0%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEA-PPLITTPV 649
           A   VLDLR N GGL+   V ++ LF+ EG  V+   G++ +      A    P    P+
Sbjct: 237 AKGIVLDLRGNPGGLLNQAVGLSNLFIKEGVLVSQK-GKNKEENLEYKANGRAPYTNLPI 295

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
            +LVN  +ASASEIVA AL D+ RAV++G++T+GKG +Q    +     + +T  +Y  P
Sbjct: 296 AVLVNGGSASASEIVAGALQDHKRAVIIGEKTFGKGSVQMLLPVNKDEAIKITTARYYLP 355

Query: 468 NHMDINGNGIEPD 430
           +   I   GI PD
Sbjct: 356 SGRTIQAKGITPD 368



>gb:BX294146_769140 Pirellula sp. strain 1 complete genome; segment
           14/24.
          Length = 495

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 55/127 (43%), Positives = 80/127 (62%), Gaps = 3/127 (2%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PV 649
           S FVLDLR N GGL+ A V++  +FL+ G  V+ T  R       + A A  L+    PV
Sbjct: 249 SGFVLDLRGNGGGLLTAAVDVCDMFLSSGRIVS-TKTRGGVVEDEVSATAGTLVPPDMPV 307

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDG-SGVVVTIGKYVT 472
            IL+++++ASASEIVA AL D+ RA +VG R+YGKG +Q+   L+ G S + +T+ KY  
Sbjct: 308 AILIDEHSASASEIVAAALQDHGRATIVGTRSYGKGTVQNILPLEYGRSALRLTVAKYYR 367

Query: 471 PNHMDIN 451
           P+  +I+
Sbjct: 368 PSDQNIH 374



>gb:AF110497_479883 Bartonella quintana filament-A precursor (filA)
           gene, partial cds; carboxy-terminal protease (ctpA)
           gene, complete cds; and invasion-associated locus A
           protein (ialA) gene, partial cds.>gb:BX897700_828397
           Bartonella quintana str. Toulouse, complete genome.
          Length = 441

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 54/130 (41%), Positives = 77/130 (59%), Gaps = 1/130 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIIL 640
           +VLDLR N GGL+   V ++  FLN+GE V+ T GR         A+   +I   P+I+L
Sbjct: 229 YVLDLRLNPGGLLNQAVNVSSAFLNKGEIVS-TRGRKKNDVVRFDAKPGDIINGKPLIVL 287

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           +N  +ASASEIVA AL D+ RA ++G +++GKG +Q+   L +   + +T   Y TP   
Sbjct: 288 INGGSASASEIVAGALQDHRRATILGTQSFGKGSVQTVIPLGENGALRLTTALYYTPAGT 347

Query: 459 DINGNGIEPD 430
            I G GI PD
Sbjct: 348 SIQGTGITPD 357



>pir|D71827|D71827 carboxyl-terminal proteinase - Helicobacter
           pylori (strain J99)>gb:AE001550_36260 Helicobacter
           pylori, strain J99 section 111 of 132 of the complete
           genome.>gb:AE001439_885030 Helicobacter pylori, strain
           J99 complete genome.
          Length = 459

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 50/129 (38%), Positives = 74/129 (57%), Gaps = 1/129 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEA-PPLITTPVIILV 637
           VLDLR N GGL+   V ++ LF+ EG  V+   G++ +      A    P    PV++LV
Sbjct: 241 VLDLRGNPGGLLNQAVGLSNLFIKEGVLVSQR-GKNKEENLEYKANGRAPYTNLPVVVLV 299

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           N  +ASASEIVA AL D+ RA+++G++T+GKG +Q    +     + +T  +Y  P+   
Sbjct: 300 NGGSASASEIVAGALQDHKRAIIIGEKTFGKGSVQVLLPVNKDEAIKITTARYYLPSGRT 359

Query: 456 INGNGIEPD 430
           I   GI PD
Sbjct: 360 IQAKGITPD 368



>sp|Q44879|CTPA_BARBA Carboxy-terminal processing protease precursor
           (EC 3.4.21.102) (C- terminal processing
           protease).>gb:BAOCTPA_746964 Bartonella bacilliformis
           C-terminal protease gene, complete cds.
          Length = 434

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 1/130 (0%)
 Frame = -1

Query: 816 FVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT-PVIIL 640
           +VLDLR N GGL+   + +   FLN+GE V+ T GR         A+   L    P+I+L
Sbjct: 229 YVLDLRLNPGGLLDQAISVTDAFLNKGEIVS-TRGRKQNDVMRFDAKLGDLTDEKPIIVL 287

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           +N  +ASASEIVA AL D+ RA ++G +++GKG +Q+   L +   + +T   Y TP+  
Sbjct: 288 INGGSASASEIVAGALQDHRRATIIGTQSFGKGSVQTIIPLGENGALRLTTALYYTPSGT 347

Query: 459 DINGNGIEPD 430
            I G GI PD
Sbjct: 348 SIQGIGITPD 357



>gb:AY062767_1565423 Arabidopsis thaliana carboxy-terminal
           proteinase D1-like protein (At5g46390; MPL12.19) mRNA,
           complete cds.>gb:AY081650_1568910 Arabidopsis thaliana
           carboxy-terminal proteinase D1-like protein (At5g46390)
           mRNA, complete cds.
          Length = 428

 Score = 88.6 bits (218), Expect(2) = 1e-17
 Identities = 40/62 (64%), Positives = 52/62 (83%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GAS FV+DLRDN GGLVQAG+E AKLFL+EG+TV YT GRDP+  +++V++  PLIT P+
Sbjct: 334 GASYFVMDLRDNLGGLVQAGIETAKLFLDEGDTVIYTAGRDPEAQKTVVSDKKPLITAPL 393

Query: 648 II 643
           I+
Sbjct: 394 IV 395



 Score = 24.3 bits (51), Expect(2) = 1e-17
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRL 837
           K    +AR DLV AMKRL
Sbjct: 313 KEFNALARKDLVIAMKRL 330



>gb:AY056397_1563705 Arabidopsis thaliana AT5g46390/MPL12_19 mRNA,
           complete cds.
          Length = 214

 Score = 88.6 bits (218), Expect(2) = 1e-17
 Identities = 40/62 (64%), Positives = 52/62 (83%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GAS FV+DLRDN GGLVQAG+E AKLFL+EG+TV YT GRDP+  +++V++  PLIT P+
Sbjct: 145 GASYFVMDLRDNLGGLVQAGIETAKLFLDEGDTVIYTAGRDPEAQKTVVSDKKPLITAPL 204

Query: 648 II 643
           I+
Sbjct: 205 IV 206



 Score = 24.3 bits (51), Expect(2) = 1e-17
 Identities = 11/18 (61%), Positives = 12/18 (66%)
 Frame = -2

Query: 890 KRIQCIARXDLVTAMKRL 837
           K    +AR DLV AMKRL
Sbjct: 124 KEFNALARKDLVIAMKRL 141



>gb:AE012095_279296 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 3 of 460 of the complete
           genome.>gb:AE008922_912578 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 526

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 54/134 (40%), Positives = 79/134 (58%), Gaps = 1/134 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIILV 637
           VLDLR N GGL+ + V++A   L++G  V+ T GR         A    L+   PV++LV
Sbjct: 271 VLDLRSNPGGLLTSAVQVADDLLDKGNIVS-TRGRISISDAKFDATPGDLLGGAPVVVLV 329

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           +  +ASASE++A AL DN RA ++G RT+GKG +Q+   L +G  V +T  +Y TP+   
Sbjct: 330 DAGSASASEVLAGALRDNQRARIIGSRTFGKGSVQTVLPLDNGDSVKLTTARYYTPSGKS 389

Query: 456 INGNGIEPDFRNLP 415
           I  +GI P+    P
Sbjct: 390 IQASGIVPEVMLTP 403



>gb:AP006840_567249 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 465

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           GA+  VLDLR N GG V + +EIA+ ++  GE + + + RD +  R   +E  PL   P 
Sbjct: 226 GATRLVLDLRYNSGGWVASALEIAEAYVPAGEPIMFEITRDER--RVYRSEGSPL-GLPT 282

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
            +LV++ TASA+EI+A A+ D    VL+G +T+GKG +Q   +L  G  V VT  +Y+T 
Sbjct: 283 AVLVSEYTASAAEILAGAVQDYGTGVLIGTQTFGKGTVQELVDLPGGGAVKVTTAEYLTG 342

Query: 468 NHMDINGNGIEPD 430
               ++  G+ PD
Sbjct: 343 RQRRVHQVGLTPD 355



>gb:AE016938_362402 Bacteroides thetaiotaomicron VPI-5482, section
           13 of 21 of the complete genome.>gb:AE015928_988890
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 529

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 48/122 (39%), Positives = 73/122 (59%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           + G    +LDL+ N GG + A +++A  FL + E + YT GR  Q +             
Sbjct: 217 KQGMKDLILDLQGNGGGYLNAAIDLANEFLGQKELIVYTEGRTAQRSEFFAKGNGEFRDG 276

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
            +I+LV++ TASASEIV+ A+ D  R ++VG R++GKGL+Q   +L DGS + +TI +Y 
Sbjct: 277 RLIVLVDEYTASASEIVSGAVQDWDRGIIVGRRSFGKGLVQRPIDLPDGSMIRLTIARYY 336

Query: 474 TP 469
           TP
Sbjct: 337 TP 338



>gb:CP000027_79371 Dehalococcoides ethenogenes 195, complete genome.
          Length = 377

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 51/134 (38%), Positives = 76/134 (56%), Gaps = 2/134 (1%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--P 652
           A   VLDLR N GGLV + + +   F++ G  +T     D +   S  +  P  +TT  P
Sbjct: 225 AEGIVLDLRGNPGGLVSSVINVTSRFVSSGVVLTTV---DNEGNSSEYSVVPKTVTTSLP 281

Query: 651 VIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVT 472
           +++LV++ +AS SE ++ AL D  RA + G  TYGKG +   F +   +G+ +TIG++ T
Sbjct: 282 MVVLVDQYSASGSEALSGALQDYGRATIAGKTTYGKGSVNRTFNVTPDTGIYLTIGRWYT 341

Query: 471 PNHMDINGNGIEPD 430
           PN   I G GI PD
Sbjct: 342 PNGRMIEGQGITPD 355



>gb:CP000009_862359 Gluconobacter oxydans 621H, complete genome.
          Length = 485

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 51/142 (35%), Positives = 82/142 (57%), Gaps = 3/142 (2%)
 Frame = -1

Query: 846 EATARXGA--SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEA 673
           +AT   G   +  +LDLR N GG +   + ++  F+ +GE V+   GR  +  +   A+ 
Sbjct: 236 QATKASGGKLTGIILDLRSNPGGKLDQAIAVSDDFIKDGEIVSIR-GRHAENNQRWDAKG 294

Query: 672 PPLIT-TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVV 496
             +    P+++L N  +ASASEIVA AL D+ RA+++G++T+GKG +Q+   + D   V 
Sbjct: 295 TDITNGLPIVVLTNGGSASASEIVAGALKDHHRAIILGEKTFGKGSVQTLIPIGDQGAVR 354

Query: 495 VTIGKYVTPNHMDINGNGIEPD 430
           +T  +Y TP+   I G GI PD
Sbjct: 355 LTTARYYTPSGRSIQGLGITPD 376



>gb:AE016944_363625 Bacteroides thetaiotaomicron VPI-5482, section
           19 of 21 of the complete genome.>gb:AE015928_990113
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 582

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 43/116 (37%), Positives = 68/116 (58%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           ++DLR N GG ++A + +   FL EG+ + YT GR                  P+++L++
Sbjct: 237 IIDLRGNTGGYMEAAIRMVNEFLPEGKLIVYTQGRKYPRAEEFANGTGSCQKMPLVVLID 296

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           + +ASASEI   A+ DN R  +VG R++GKGL+Q   +  DGS + +TI +Y TP+
Sbjct: 297 EGSASASEIFTGAIQDNDRGTVVGRRSFGKGLVQQPIDFSDGSAIRLTIARYYTPS 352



>pir|D89919|D89919 hypothetical protein ctpA [imported] -
           Staphylococcus aureus (strain N315)>gb:BA000017_677109
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_679695 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete genome.
          Length = 496

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 51/136 (37%), Positives = 83/136 (61%), Gaps = 1/136 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVT-YTVGRDPQYTRSIVAEAPPLIT 658
           + G    VLDLR+N GGL+   V++A +F+++G+TV     G+D +  ++          
Sbjct: 257 KDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKDTEAIQTSNDSLKEAKD 316

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
             + ILVN+ +ASASE+   AL D  +A + G +T+GKG++Q+  E +DGS +  T  K+
Sbjct: 317 MDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTTREFKDGSLLKYTEMKW 376

Query: 477 VTPNHMDINGNGIEPD 430
           +TP+   I+G GI+PD
Sbjct: 377 LTPDGHYIHGKGIKPD 392



>gb:BX571856_780873 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 496

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 51/136 (37%), Positives = 83/136 (61%), Gaps = 1/136 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVT-YTVGRDPQYTRSIVAEAPPLIT 658
           + G    VLDLR+N GGL+   V++A +F+++G+TV     G+D +  ++          
Sbjct: 257 KDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKDTEAIQTSNDALKEAKD 316

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
             + ILVN+ +ASASE+   AL D  +A + G +T+GKG++Q+  E +DGS +  T  K+
Sbjct: 317 MDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTTREFKDGSLLKYTEMKW 376

Query: 477 VTPNHMDINGNGIEPD 430
           +TP+   I+G GI+PD
Sbjct: 377 LTPDGHYIHGKGIKPD 392



>gb:BA000033_711602 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.>gb:BX571857_783583
           Staphylococcus aureus strain MSSA476, complete genome.
          Length = 496

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 51/136 (37%), Positives = 83/136 (61%), Gaps = 1/136 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVT-YTVGRDPQYTRSIVAEAPPLIT 658
           + G    VLDLR+N GGL+   V++A +F+++G+TV     G+D +  ++          
Sbjct: 257 KDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKDTEAIQTSNDALKEAKD 316

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
             + ILVN+ +ASASE+   AL D  +A + G +T+GKG++Q+  E +DGS +  T  K+
Sbjct: 317 MDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTTREFKDGSLLKYTEMKW 376

Query: 477 VTPNHMDINGNGIEPD 430
           +TP+   I+G GI+PD
Sbjct: 377 LTPDGHYIHGKGIKPD 392



>gb:CP000046_91585 Staphylococcus aureus subsp. aureus COL, complete
           genome.
          Length = 496

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 51/136 (37%), Positives = 83/136 (61%), Gaps = 1/136 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVT-YTVGRDPQYTRSIVAEAPPLIT 658
           + G    VLDLR+N GGL+   V++A +F+++G+TV     G+D +  ++          
Sbjct: 257 KDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKDTEAIQTSNDALKEAKD 316

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
             + ILVN+ +ASASE+   AL D  +A + G +T+GKG++Q+  E +DGS +  T  K+
Sbjct: 317 MDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTTREFKDGSLLKYTEMKW 376

Query: 477 VTPNHMDINGNGIEPD 430
           +TP+   I+G GI+PD
Sbjct: 377 LTPDGHYIHGKGIKPD 392



>gb:CP000029_81601 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 491

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 50/136 (36%), Positives = 80/136 (58%), Gaps = 1/136 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTV-GRDPQYTRSIVAEAPPLIT 658
           + G    +LDLR+N GGL+   V++A +F+++G TV     G+D +  ++          
Sbjct: 252 KQGIRHIILDLRNNPGGLLDEAVKMANIFIDKGNTVVQLEKGKDKEELKTSNQALKQAKD 311

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
             V ILVN+ +ASASE+   A+ D  +A + G +T+GKG++Q+  E  DGS +  T  K+
Sbjct: 312 MKVSILVNEGSASASEVFTGAMKDYHKAKVYGSKTFGKGIVQTIREFSDGSLIKYTEMKW 371

Query: 477 VTPNHMDINGNGIEPD 430
           +TP+   I+G GI PD
Sbjct: 372 LTPDGHYIHGKGIRPD 387



>pir|A87675|A87675 carboxyl-terminal proteinase [imported] -
           Caulobacter crescentus>gb:AE006003_214560 Caulobacter
           crescentus CB15 section 329 of 359 of the complete
           genome.>gb:AE005673_924459 Caulobacter crescentus CB15
           complete genome.
          Length = 464

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 52/131 (39%), Positives = 81/131 (61%), Gaps = 3/131 (2%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLIT-TPVIILV 637
           +LDLR+N GGL+   V +A +FL+ GE V+   GRDP+  +   A    ++   P+++L+
Sbjct: 230 ILDLRNNPGGLLDQAVGVADVFLDGGEVVSQR-GRDPRNIQRYNARGGDMLNGLPMVVLI 288

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGS--GVVVTIGKYVTPNH 463
           N+ +ASA+EIVA AL D  RA +VG  ++GKG +Q+   L+ G+   + +T  +Y TP+ 
Sbjct: 289 NQGSASAAEIVAGALQDRKRAEVVGLTSFGKGSVQTVIPLRGGADGALKLTTARYFTPSG 348

Query: 462 MDINGNGIEPD 430
             I   GI PD
Sbjct: 349 RSIQKTGIAPD 359



>gb:BA000043_739749 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 468

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 2/154 (1%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVA--EAPPLITT 655
           G   ++ DLRDN GG V+   +IA  F N  +       RD      + A  + P  +T 
Sbjct: 215 GVKGWIFDLRDNQGGYVETAQKIAGFFPNVKQAFQL---RDRSNHPEVYAAVKQPVQMTG 271

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+ +LVN ++ASASE++A A+ +   AVL G RT+GKG +Q  FEL DGS + +T+  + 
Sbjct: 272 PIRLLVNASSASASEMLAAAVKEQKAAVLYGQRTFGKGSMQEMFELSDGSMLKLTVAHFF 331

Query: 474 TPNHMDINGNGIEPDFRNLPAWNEVSKHLSKCHK 373
           +P    I+  G++PD   +     V K L   H+
Sbjct: 332 SPKGTPIHNVGVKPDVPTV-----VGKELYAAHR 360



>gb:AP006841_575061 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 540

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 47/122 (38%), Positives = 72/122 (59%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           + G    +LDL+ N GG + A +++A  FL + E + YT GR  Q +             
Sbjct: 213 KKGMKDLILDLQGNGGGYLNAAIDLANEFLGQKELIVYTEGRSAQRSEFFAKGNGNFRNG 272

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
            +++LV++ +ASASEIV  A+ D  R V+VG R++GKGL+Q   +L DGS + +TI +Y 
Sbjct: 273 RLVVLVDEYSASASEIVTGAIQDWDRGVVVGRRSFGKGLVQRPIDLPDGSMIRLTIARYY 332

Query: 474 TP 469
           TP
Sbjct: 333 TP 334



>gb:AE016747_322763 Staphylococcus epidermidis ATCC 12228, section 4
           of 9 of the complete genome.>gb:AE015929_1147432
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 491

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 50/136 (36%), Positives = 80/136 (58%), Gaps = 1/136 (0%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTV-GRDPQYTRSIVAEAPPLIT 658
           + G    +LDLR+N GGL+   V++A +F+++G TV     G+D +  ++          
Sbjct: 252 KQGIRHIILDLRNNPGGLLDEAVKMANIFIDKGNTVVQLEKGKDKEELKTSNQALKQAKD 311

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
             V ILVN+ +ASASE+   A+ D  +A + G +T+GKG++Q+  E  DGS +  T  K+
Sbjct: 312 MKVSILVNEGSASASEVFTGAMKDYHKAKVYGSKTFGKGIVQTTREFSDGSLIKYTEMKW 371

Query: 477 VTPNHMDINGNGIEPD 430
           +TP+   I+G GI PD
Sbjct: 372 LTPDGHYIHGKGIRPD 387



>gb:BSORFRM1_750751 B.subtilis orfRM1 DNA.
          Length = 466

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 45/141 (31%), Positives = 81/141 (57%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           ++  + GA  ++LDLR N GGL++  + ++ LF+++G+ +     ++      + AE   
Sbjct: 223 DSLEKKGAKGYILDLRGNPGGLMEQAITMSNLFIDKGKNIMQVEYKNGS-KEVMKAEKER 281

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
            +T P ++LVN  TAS S      LH++    L+G+ T+GKG +Q+  E  DGS V +T+
Sbjct: 282 KVTKPTVVLVNDGTASRSRNYGRCLHESSNVPLIGETTFGKGTVQTAKEYDDGSTVKLTV 341

Query: 486 GKYVTPNHMDINGNGIEPDFR 424
            K++T +   I+  GI+P  +
Sbjct: 342 AKWLTADGEWIHKKGIKPQVK 362



>pir|A82525|A82525 carboxyl-terminal proteinase XF2704 [imported] -
           Xylella fastidiosa (strain 9a5c)>gb:AE004076_50330
           Xylella fastidiosa 9a5c, section 222 of 229 of the
           complete genome.>gb:AE003849_1117540 Xylella fastidiosa
           9a5c, complete genome.
          Length = 508

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 49/128 (38%), Positives = 72/128 (56%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           +LDLR N GGL+ A V++A   L++G  V+         TR        L   P+++LV+
Sbjct: 266 LLDLRSNPGGLLTAAVQVADALLDKGNIVSTRGRISASDTRFDATPGDLLDGLPLVVLVD 325

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASE++  AL DN RA ++G  T+GKG +Q+   L +G  V +T  +Y TP+   I
Sbjct: 326 AGSASASEVLVGALSDNHRARVIGSCTFGKGSVQTLLPLDNGDSVKLTTARYYTPSGRSI 385

Query: 453 NGNGIEPD 430
              GI PD
Sbjct: 386 QARGIVPD 393



>gb:AE017178_397984 Porphyromonas gingivalis W83 section 7 of 8 of
           the complete genome.>gb:AE015924_1033595 Porphyromonas
           gingivalis W83 complete genome.
          Length = 544

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 48/141 (34%), Positives = 86/141 (60%), Gaps = 5/141 (3%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP--LI 661
           + GA+S +LDLR+N GGL++  + +A  FL +   +    G+   Y R  ++      L 
Sbjct: 221 KKGATSLILDLRENRGGLLEPAIAMANEFLGKNLPILQIEGK--AYPREEISSDGKGILQ 278

Query: 660 TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGK 481
             P+++LV++ +AS+SE+   A+ D+ RA ++G RT+GKGL+Q  F+L DGS + +T+ +
Sbjct: 279 QIPLVVLVDEFSASSSEVFTGAMQDHDRAQIIGRRTFGKGLVQLPFDLADGSAIRLTVAR 338

Query: 480 YVTPNHMDIN---GNGIEPDF 427
           Y TP+   I     +G++ ++
Sbjct: 339 YYTPSGRSIQKPYSSGVDENY 359



>gb:AE012561_285429 Xylella fastidiosa Temecula1, section 9 of 9 of
           the complete genome.>gb:AE009442_962005 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 473

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 49/128 (38%), Positives = 72/128 (56%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           +LDLR N GGL+ A V++A   L++G  V+         TR        L   P+++LV+
Sbjct: 231 LLDLRSNPGGLLTAAVQVADALLDKGNIVSTRGRISASDTRFDATLGDLLDGLPLVVLVD 290

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASE++  AL DN RA ++G  T+GKG +Q+   L +G  V +T  +Y TP+   I
Sbjct: 291 AGSASASEVLVGALSDNHRARVIGSCTFGKGSVQTLLPLDNGDSVKLTTARYYTPSGRSI 350

Query: 453 NGNGIEPD 430
              GI PD
Sbjct: 351 QARGIVPD 358



>pir|F72340|F72340 probable carboxyl-terminal processing proteinase
           (EC 3.4.21.-) - Thermotoga maritima (strain
           MSB8)>gb:AE001744_38657 Thermotoga maritima MSB8 section
           56 of 136 of the complete genome.>gb:AE000512_1113130
           Thermotoga maritima MSB8, complete genome.
          Length = 402

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 47/133 (35%), Positives = 78/133 (58%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           G    ++D+RDN GG +   ++I  +F+++G  +    G   +        + P +  P+
Sbjct: 231 GVKGLIIDVRDNPGGYLDVALKIVSMFVDKGVILKVRNGFGEEDVYESYGNSYPNV--PI 288

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN+ +ASASEI+  AL D   A +VG +T+GKG +Q+ F L +G  + +T   Y+TP
Sbjct: 289 VLLVNEGSASASEILTGALKDLGIATVVGRKTFGKGSVQTGFPLSNGGVLFLTTAHYLTP 348

Query: 468 NHMDINGNGIEPD 430
           +  DI+  GIEPD
Sbjct: 349 SGKDIHKIGIEPD 361



>pir|G84099|G84099 carboxy-terminal processing proteinase BH3599
           [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_657545 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 479

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 49/134 (36%), Positives = 78/134 (58%), Gaps = 2/134 (1%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTR--SIVAEAPPLITT 655
           G    ++D+R N GG + A  +I  L + EGE +     RD +  R  S + E  P    
Sbjct: 238 GIDGLIIDVRGNPGGYLNAVEDIGSLIIPEGEPIVQIQNRDGEKMRYLSTLKEEKPY--- 294

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P++ L ++ +ASASEI+A AL +     +VG+ T+GKG +Q   EL DGS + +++ +++
Sbjct: 295 PIVGLTDRGSASASEILAAALKEAGHYDVVGETTFGKGTVQQSIELGDGSEIKLSLFRWL 354

Query: 474 TPNHMDINGNGIEP 433
           T +  DING G+EP
Sbjct: 355 TSDGNDINGVGVEP 368



>gb:AE016964_368725 Coxiella burnetii strain RSA 493, section 5 of 7
           of the complete genome.>gb:AE016828_1009461 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 456

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 58/165 (35%), Positives = 87/165 (52%), Gaps = 14/165 (8%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEG------ETVTYTVGRDPQYTRSIVAEAPPLIT-T 655
           VLDLR+N GGL+    ++A  FL+        + + YT GR P     I A    LI  T
Sbjct: 246 VLDLRNNPGGLLDVSAQVADSFLDASKMHRYNDLIVYTKGRVPGADIQIKATPGDLIPHT 305

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++L+N  +ASASEIVA AL D  RA+++G  ++GKG +Q+   +     + +T   Y 
Sbjct: 306 PMVVLINGGSASASEIVAGALQDYKRAIIMGTPSFGKGSVQTVLPIGKEDAIKLTTALYY 365

Query: 474 TPNHMDINGNGI-----EPDFRNLPAWNEVSKHLS--KCHKPKDG 361
           TP   +I   GI      P+F   P  +++S   +  + H P DG
Sbjct: 366 TPAGREIQAKGIIPNVAVPEFSITPPKSQLSLDEADFQNHLPNDG 410



>pir|AC1678|AC1678 carboxy-terminal processing proteinase homolog
           lin1965 [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596170_539309 Listeria innocua Clip11262
           complete genome, segment 8/12.
          Length = 496

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 52/151 (34%), Positives = 88/151 (58%), Gaps = 5/151 (3%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           +A  + G    V+DLR N GGL+   V I+ LF+ +G+ V    G+D   + +I A++  
Sbjct: 251 KALEKDGMKGLVIDLRGNPGGLLDQAVSISSLFVPDGKIVVQEQGKDGDKS-AIKADSSS 309

Query: 666 ----LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGV 499
                +  P  +L++  +ASASEI+A A  ++    LVG++++GKG +Q+   L D S +
Sbjct: 310 HGDYKVKVPTTMLIDGGSASASEILAAAAKESGGIKLVGNKSFGKGTVQTATTLSDDSTL 369

Query: 498 VVTIGKYVTPNHMDINGNGIEPD-FRNLPAW 409
            +T+ K++TPN   I+  GI PD   N+P++
Sbjct: 370 KLTVAKWLTPNSEWIHEKGITPDVVVNMPSY 400



>gb:CP000009_863267 Gluconobacter oxydans 621H, complete genome.
          Length = 594

 Score = 86.7 bits (213), Expect = 6e-16
 Identities = 52/138 (37%), Positives = 79/138 (57%), Gaps = 1/138 (0%)
 Frame = -1

Query: 843 ATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPL 664
           + ++   +  +LDLR + GG++Q  V  A L L+ G  VT T GR+P        +   +
Sbjct: 368 SASKNKTAGIILDLRGDRGGVLQQAVTTAALLLDHGVAVT-THGRNPLANHIWAVQGGDM 426

Query: 663 IT-TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
              TPV+ILV+  TASA+EI+A+AL D+ RAV++G  T GKGL+Q   ++ +G  + VT 
Sbjct: 427 TNGTPVVILVDGRTASAAEILASALADHRRAVVIGSETLGKGLVQVIGQMPNGGELFVTW 486

Query: 486 GKYVTPNHMDINGNGIEP 433
            +   P    I G G+ P
Sbjct: 487 SRNQAPLGWPIQGLGVMP 504



>gb:AE013202_290162 Thermoanaerobacter tengcongensis MB4, section
           229 of 244 of the complete genome.>gb:AE008691_1112227
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 453

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 53/137 (38%), Positives = 71/137 (51%), Gaps = 2/137 (1%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTV--GRDPQYTRSIVAEAPPLI 661
           +      +LDLR+N GGL+   V  A  F+ +G  VT     G    Y   +      L 
Sbjct: 219 KNNVKKLILDLRNNPGGLLTEVVSAANFFVPQGIVVTIERRNGEKEDYYSYLTKPKYKLA 278

Query: 660 TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGK 481
                +LVNK TASA+EI+A A+ D     LVG+ TYGKG +QS   L+DGSG  +TI +
Sbjct: 279 -----VLVNKGTASAAEILAGAIQDTKVGFLVGENTYGKGTVQSVVPLEDGSGFKLTIAR 333

Query: 480 YVTPNHMDINGNGIEPD 430
           Y  P+   I   G+ PD
Sbjct: 334 YKLPSGRYIGKEGLTPD 350



>gb:CP000013_869592 Borrelia garinii PBi, complete genome.
          Length = 476

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 51/146 (34%), Positives = 81/146 (55%), Gaps = 2/146 (1%)
 Frame = -1

Query: 861 FSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIV 682
           FS   +        S +LDLR N GG  QA +++A   L++G T+  T  R+        
Sbjct: 233 FSKALDNLKNRNIKSLILDLRLNTGGYFQAAIKMADDILSKG-TIVSTKSRNSSKPIDYK 291

Query: 681 AEAPPLITTPV--IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDG 508
           A +  ++ + +  + L+++++ASASE+   AL DN RA ++G+++YGKG+IQ       G
Sbjct: 292 ASSKQVLPSDIKIVALIDRSSASASEVFVGALKDNKRAYIIGEKSYGKGVIQHVVPFYTG 351

Query: 507 SGVVVTIGKYVTPNHMDINGNGIEPD 430
            G  +T  KY TP+   I+  GIEPD
Sbjct: 352 -GFKITSSKYYTPSGKSIHKVGIEPD 376



>gb:CP000010_867299 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 524

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 54/145 (37%), Positives = 75/145 (51%), Gaps = 17/145 (11%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----------------RDPQYTRSIV 682
           +LDLR+N GGL+Q+ V +A  FL     V  T G                R P +    +
Sbjct: 237 ILDLRNNGGGLLQSAVGVAGAFLPPDSVVVSTNGQIPDSKQIYRDNYENYRLPSFDSDPL 296

Query: 681 AEAPPLI-TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGS 505
              P +  T P+I+L N  +ASASEIVA AL D+ RAV++G  T+GKG +Q+   +   S
Sbjct: 297 KNLPAVFKTVPMIVLTNAYSASASEIVAGALQDSHRAVIMGKATFGKGSVQTVRPMTADS 356

Query: 504 GVVVTIGKYVTPNHMDINGNGIEPD 430
            + +T   Y TP+   I   GI PD
Sbjct: 357 ALRLTTAYYYTPSGRSIQNKGILPD 381



>gb:BX571965_790218 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 524

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 54/145 (37%), Positives = 75/145 (51%), Gaps = 17/145 (11%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----------------RDPQYTRSIV 682
           +LDLR+N GGL+Q+ V +A  FL     V  T G                R P +    +
Sbjct: 237 ILDLRNNGGGLLQSAVGVAGAFLPPDSVVVSTNGQIPDSKQIYRDNYENYRLPSFDSDPL 296

Query: 681 AEAPPLI-TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGS 505
              P +  T P+I+L N  +ASASEIVA AL D+ RAV++G  T+GKG +Q+   +   S
Sbjct: 297 KNLPAVFKTVPMIVLTNAYSASASEIVAGALQDSHRAVIMGKATFGKGSVQTVRPMTADS 356

Query: 504 GVVVTIGKYVTPNHMDINGNGIEPD 430
            + +T   Y TP+   I   GI PD
Sbjct: 357 ALRLTTAYYYTPSGRSIQNKGILPD 381



>gb:BX572594_800206 Rhodopseudomonas palustris CGA009 complete
           genome; segment 2/16.
          Length = 446

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 52/135 (38%), Positives = 74/135 (54%), Gaps = 2/135 (1%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGR--DPQYTRSIVAEAPPLITT 655
           G    V+DLR++ GGL+ A V +A   L +G TV    GR  D Q   S  ++   L   
Sbjct: 223 GLKGLVIDLRNDPGGLLNAAVSVAGDLL-DGGTVVSIRGRQADDQRVFSAPSKGDKLPGV 281

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
           P+++L+N  +ASASEIVA AL D  RA ++G  ++GKG +Q+   ++    V +T   Y 
Sbjct: 282 PIVVLINGASASASEIVAGALQDRKRATVMGTTSFGKGSVQTVIPIKGHGAVRLTTALYY 341

Query: 474 TPNHMDINGNGIEPD 430
           TP    I   GI PD
Sbjct: 342 TPAGRSIQDEGIVPD 356



>gb:AE017295_434431 Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130, chromosome I, section 9 of 14 of the
           complete sequence.>gb:AE016823_1067442 Leptospira
           interrogans serovar Copenhageni str. Fiocruz L1-130,
           chromosome I, complete sequence.
          Length = 590

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 49/157 (31%), Positives = 84/157 (53%), Gaps = 15/157 (9%)
 Frame = -1

Query: 819 SFVLDLRDNXGGLVQAGVEIAKLFLNEGETV-TYTVGRDPQYTRSIVAEAPPLITTPVII 643
           + +LDLR+N GG +   ++IA +F+ +G  V T +  R P+      A+   +   P+ +
Sbjct: 376 ALILDLRNNAGGYLDLAIDIADMFIEKGLIVSTKSPNRSPE---DAYAKNKDITNLPLAV 432

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           L+N  +ASASEIVA+A+  + R +L+G+RT+GK  +Q    L +   + +T  +Y +P+ 
Sbjct: 433 LINAKSASASEIVASAIKHHGRGILLGERTFGKATVQKLMPLGNDYLIKLTQARYYSPSG 492

Query: 462 MDINGNGIEPD--------------FRNLPAWNEVSK 394
             I   G++PD              FR    WN +S+
Sbjct: 493 NTIQVVGVKPDIDISSEEDGSFPFRFREENMWNHLSE 529



>gb:AE011330_271749 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 139 of 397 of the complete
           sequence.>gb:AE010300_1005148 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 607

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 49/157 (31%), Positives = 84/157 (53%), Gaps = 15/157 (9%)
 Frame = -1

Query: 819 SFVLDLRDNXGGLVQAGVEIAKLFLNEGETV-TYTVGRDPQYTRSIVAEAPPLITTPVII 643
           + +LDLR+N GG +   ++IA +F+ +G  V T +  R P+      A+   +   P+ +
Sbjct: 393 ALILDLRNNAGGYLDLAIDIADMFIEKGLIVSTKSPNRSPE---DAYAKNKDITNLPLAV 449

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           L+N  +ASASEIVA+A+  + R +L+G+RT+GK  +Q    L +   + +T  +Y +P+ 
Sbjct: 450 LINAKSASASEIVASAIKHHGRGILLGERTFGKATVQKLMPLGNDYLIKLTQARYYSPSG 509

Query: 462 MDINGNGIEPD--------------FRNLPAWNEVSK 394
             I   G++PD              FR    WN +S+
Sbjct: 510 NTIQVVGVKPDIDISSEEDGSFPFRFREENMWNHLSE 546



>pir|F70144|F70144 carboxyl-terminal processing proteinase (ctp)
           homolog - Lyme disease spirochete>gb:AE001141_32339
           Borrelia burgdorferi B31 (section 27 of 70) of the
           complete genome.>gb:AE000783_1119990 Borrelia
           burgdorferi B31 complete genome.
          Length = 475

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 52/151 (34%), Positives = 81/151 (53%), Gaps = 2/151 (1%)
 Frame = -1

Query: 876 HCQXGFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQY 697
           H    F    +        S +LDLR N GG  QA +++A   L++G  V+ T  R+   
Sbjct: 227 HTSVDFRKALDNLKNKNIKSLILDLRLNTGGYFQAAIKMADDILSKGIIVS-TKSRNSSK 285

Query: 696 TRSIVAEAPPLITT--PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFF 523
                A +  ++ +   ++ L+++++ASASE+   AL DN RA ++G+++YGKGLIQ   
Sbjct: 286 PIDYKASSKQVLPSNIKIVALIDRSSASASEVFVGALKDNKRAYIIGEKSYGKGLIQHVV 345

Query: 522 ELQDGSGVVVTIGKYVTPNHMDINGNGIEPD 430
               G G  +T  KY TP+   I+  GIEPD
Sbjct: 346 PFYTG-GFKITSSKYYTPSGKSIHKVGIEPD 375



>gb:BA000016_673341 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 428

 Score = 83.2 bits (204), Expect = 6e-15
 Identities = 49/147 (33%), Positives = 81/147 (55%), Gaps = 8/147 (5%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTV----GRDPQYTRSIVA 679
           +A    G    +LDLR N GG ++  V++   F+ + + +  T+     ++   ++  +A
Sbjct: 253 KALEEKGMKGLILDLRGNPGGFMKECVDLVSNFVPKDKVIVSTIDKYGNKEESVSKGGIA 312

Query: 678 EAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL----QD 511
           +  PL+     +L++  TASASEIVA A+ D     LVG  ++GKG++Q   +     +D
Sbjct: 313 QGMPLV-----VLIDGGTASASEIVAGAIRDYDLGTLVGTTSFGKGIVQVVLDKIGQEKD 367

Query: 510 GSGVVVTIGKYVTPNHMDINGNGIEPD 430
           G+ + VTI KY TPN  +I+  GI PD
Sbjct: 368 GTALKVTISKYYTPNGENIHKKGIGPD 394



>gb:CP000025_878386 Campylobacter jejuni RM1221, complete genome.
          Length = 444

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 47/134 (35%), Positives = 75/134 (55%), Gaps = 1/134 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTP-VIILV 637
           +LDLR+N GGL+   + +  LF+++G  V+   GR     +   A+    I+   +++LV
Sbjct: 239 ILDLRNNPGGLLNQAIGLVNLFVDKGVIVSQK-GRIASENQEYKADPKNKISNASLVVLV 297

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           N  +ASASEIV+ AL D  R V+VG+ T+GKG +Q    +     + +TI +Y  P+   
Sbjct: 298 NGGSASASEIVSGALQDLKRGVIVGENTFGKGSVQQIIPINKTEALRLTIARYYLPSGRT 357

Query: 456 INGNGIEPDFRNLP 415
           I   G++PD    P
Sbjct: 358 IQAVGVKPDIEVFP 371



>gb:AE012970_287715 Chlorobium tepidum TLS section 191 of 194 of the
           complete genome.>gb:AE006470_934883 Chlorobium tepidum
           TLS complete genome.
          Length = 574

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 1/127 (0%)
 Frame = -1

Query: 843 ATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPL 664
           A  R   +  VLDLR N GGL+ + VE+A LF+ +   +  T GR     +  V +  P 
Sbjct: 243 AKNRVVLNGIVLDLRGNPGGLLTSAVEVAGLFVEKNSRIVSTRGRAADSEQVYVTKTEPQ 302

Query: 663 ITT-PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
             T P++++++ ++ASASEIV+ A+ +  R V++G+ ++GKGL+QS   L     + +T 
Sbjct: 303 EPTLPLVVMIDGDSASASEIVSGAIQELDRGVILGENSFGKGLVQSIINLPYDHILKMTT 362

Query: 486 GKYVTPN 466
            KY TP+
Sbjct: 363 AKYYTPS 369



>pir|H81396|H81396 probable secreted proteinase Cj0511 [imported] -
           Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X2_846913 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment 2/6.
          Length = 444

 Score = 82.8 bits (203), Expect = 8e-15
 Identities = 47/134 (35%), Positives = 75/134 (55%), Gaps = 1/134 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTP-VIILV 637
           +LDLR+N GGL+   + +  LF+++G  V+   GR     +   A+    I+   +++LV
Sbjct: 239 ILDLRNNPGGLLNQAIGLVNLFVDKGVIVSQK-GRIASENQEYKADPKNKISNASLVVLV 297

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           N  +ASASEIV+ AL D  R V+VG+ T+GKG +Q    +     + +TI +Y  P+   
Sbjct: 298 NGGSASASEIVSGALQDLKRGVIVGENTFGKGSVQQIIPINKTEALRLTIARYYLPSGRT 357

Query: 456 INGNGIEPDFRNLP 415
           I   G++PD    P
Sbjct: 358 IQAVGVKPDIEVFP 371



>gb:AE017328_444300 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076656
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 468

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP---- 667
           + G    VLDLR N GGL+   V I+ LF+ +G+ V     +D   + +I A++      
Sbjct: 227 KDGMKGLVLDLRGNPGGLLDQAVSISSLFVPDGKIVVQEQDKDGDKS-AIKADSSSHGDY 285

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
            +  P  +L++  +ASASEI+A A  ++    LVG +++GKG +Q+   L D S + +T+
Sbjct: 286 KVKVPTTMLIDGGSASASEILAAAAKESGGIKLVGTKSFGKGTVQTATTLSDDSTLKLTV 345

Query: 486 GKYVTPNHMDINGNGIEPD 430
            K++TPN   I+  GI PD
Sbjct: 346 AKWLTPNSEWIHEKGITPD 364



>gb:AE015939_320038 Clostridium tetani E88, section 4 of 10 of the
           complete genome.>gb:AE015927_962827 Clostridium tetani
           E88, complete genome.
          Length = 563

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/131 (37%), Positives = 76/131 (58%)
 Frame = -1

Query: 819 SFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIIL 640
           + V+DLR N GG   +  EIA  F+   +TVT    +    T    +    L   P+I +
Sbjct: 248 NLVVDLRGNLGGYTSSAYEIAGYFIGN-KTVTIMKDKKGNETLYRGSSQELLRDIPIIFI 306

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
            +KNTASASEI+ +A+ D  RA ++G++TYGKG+ Q+ F L D S + +T  ++ +P   
Sbjct: 307 TDKNTASASEILTSAVKDYERAFIIGNKTYGKGVQQTSFILTDESFLKLTTHEFFSPFGS 366

Query: 459 DINGNGIEPDF 427
            IN  G++P+F
Sbjct: 367 KINKIGVKPNF 377



>pir|AC1306|AC1306 carboxy-terminal processing proteinase homolog
           lmo1851 [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591981_536342 Listeria monocytogenes strain
           EGD, complete genome, segment 9/12.
          Length = 496

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 49/139 (35%), Positives = 79/139 (56%), Gaps = 4/139 (2%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP---- 667
           + G    VLDLR N GGL+   V I+ LF+ +G+ V     +D   + +I A++      
Sbjct: 255 KDGMKGLVLDLRGNPGGLLDQAVSISSLFVPDGKIVVQEQDKDGDKS-AIKADSSSHGDY 313

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
            +  P  +L++  +ASASEI+A A  ++    LVG +++GKG +Q+   L D S + +T+
Sbjct: 314 KVKVPTTMLIDGGSASASEILAAAAKESGGIKLVGTKSFGKGTVQTATTLSDDSTLKLTV 373

Query: 486 GKYVTPNHMDINGNGIEPD 430
            K++TPN   I+  GI PD
Sbjct: 374 AKWLTPNSEWIHEKGITPD 392



>gb:AE012878_286646 Chlorobium tepidum TLS section 99 of 194 of the
           complete genome.>gb:AE006470_933814 Chlorobium tepidum
           TLS complete genome.
          Length = 538

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 46/127 (36%), Positives = 71/127 (55%), Gaps = 2/127 (1%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRD--PQYTRSIVAEAPPLITT 655
           G    ++D+R N GG +   V +A   L  G+ + YT  R       + +          
Sbjct: 215 GMRKLIIDVRGNPGGYLDQAVAVADELLPAGKLIVYTKSRHGGDDQMKYLSTSGGIFEKG 274

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYV 475
            V +LV++ +ASA+EI+A AL DN RA+L+G+ T+GKGL+Q  F+L D S V +T+ +Y 
Sbjct: 275 EVCLLVDRGSASAAEILAGALQDNRRALLIGELTFGKGLVQRQFKLPDDSVVRLTVSRYF 334

Query: 474 TPNHMDI 454
           TP+   I
Sbjct: 335 TPSGRQI 341



>gb:BA000043_739669 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 482

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 45/131 (34%), Positives = 78/131 (59%), Gaps = 3/131 (2%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRD---PQYTRSIVAEAPPLITTPVII 643
           ++D+R N GG +Q+  EI K  + +G+       RD    ++   + A+ P     P+++
Sbjct: 248 IIDVRGNPGGYLQSVEEILKQLIPKGKPYVQIEERDGDRQKFYSDLTAKKP----YPIVV 303

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNH 463
           L++K +ASASEI+A A+ +     LVG+ T+GKG +Q    + DGS + +T+ K++TP+ 
Sbjct: 304 LIDKGSASASEILAGAMKEAGGYKLVGETTFGKGTVQQAIPMGDGSNIKLTLYKWLTPDG 363

Query: 462 MDINGNGIEPD 430
             I+  GI+PD
Sbjct: 364 HWIHKKGIKPD 374



>gb:BX908798_829770 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 671

 Score = 79.7 bits (195), Expect = 7e-14
 Identities = 53/144 (36%), Positives = 77/144 (53%), Gaps = 5/144 (3%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVT--YTVGRDPQYTRSIVAEA 673
           E   +      +LDLR+N GG +   V++A LF+  G  V   Y+ G +  Y      + 
Sbjct: 392 ELEKKGNLRGLILDLRENSGGFLSQAVKVAGLFITNGVIVISKYSTGEERFYRD---VDG 448

Query: 672 PPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGD-RTYGKGLI--QSFFELQDGSG 502
                 P+++L++K TASA+EIVA AL D   A++VGD  TYGKG I  Q+  + Q  S 
Sbjct: 449 KIAYDGPLVVLISKATASAAEIVAQALQDYGVAIVVGDEHTYGKGTIQTQTVTDDQSTSY 508

Query: 501 VVVTIGKYVTPNHMDINGNGIEPD 430
             VT+GKY T +      NG++ D
Sbjct: 509 FKVTVGKYYTVSGKTPQKNGVKAD 532



>gb:NGU11547_152693 Neisseria gonorrhoeae MS11 UvrB (uvrB) gene,
           complete cds, and (ORF1) and (ORF2) genes, partial cds.
          Length = 196

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 40/79 (50%), Positives = 52/79 (65%)
 Frame = -1

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
           L T P+ +LVN  +ASASEIVA AL D+ RAV+VG +++GKG +Q+   L +GS V +T 
Sbjct: 10  LKTIPMAVLVNSGSASASEIVAGALQDHKRAVIVGTQSFGKGSVQTLIPLSNGSAVKLTT 69

Query: 486 GKYVTPNHMDINGNGIEPD 430
             Y TPN   I   GI PD
Sbjct: 70  ALYYTPNDRSIQAQGIVPD 88



>gb:BX842648_823934 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 3/11.
          Length = 673

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 4/132 (3%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLI--TTPVIIL 640
           VLDL +N GG ++  V+IA LF   G  V  +  ++     S + +  P++  + P+++L
Sbjct: 392 VLDLSNNGGGSLEDAVKIAGLFFQTGNVVKQS-SKNEGRAESALRDTDPMVDWSGPLVVL 450

Query: 639 VNKNTASASEIVATALHDNCRAVLV-GDRTYGKGLIQSFFELQDGSGVV-VTIGKYVTPN 466
            ++ +ASASEIV+  L D  RAV+V GD TYGKG +QS   + +  G + VT+G +  P 
Sbjct: 451 TSRISASASEIVSGTLQDYKRAVVVGGDHTYGKGSVQSVLPIPNNLGAIKVTVGMFFVPG 510

Query: 465 HMDINGNGIEPD 430
                  G++ D
Sbjct: 511 GKSTQHRGVDAD 522



>gb:AP006627_565380 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 484

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 44/135 (32%), Positives = 73/135 (54%), Gaps = 3/135 (2%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVT---YTVGRDPQYTRSIVAEAPPLIT 658
           G    V+D+R N GG ++   +I    + EG+ V    +  G    Y   +  + P    
Sbjct: 242 GIDGLVIDVRGNPGGYLEGATKIGDAIIPEGKPVVQIEHGNGEIDSYLSKMKGKKP---- 297

Query: 657 TPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKY 478
            PV+ L+N+++ASASEI+A AL ++    LVG+ T+GKG +Q    + DGS + +T  ++
Sbjct: 298 YPVVGLINESSASASEILAAALKESGDYDLVGETTFGKGTVQKSIPMDDGSALKITTDRW 357

Query: 477 VTPNHMDINGNGIEP 433
           +T     I+  G+EP
Sbjct: 358 LTAGGNTIDQEGVEP 372



>gb:AE017203_404315 Lactobacillus johnsonii NCC 533, section 4 of 7
           of the complete genome.>gb:AE017198_1122802
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 483

 Score = 76.6 bits (187), Expect = 6e-13
 Identities = 51/131 (38%), Positives = 72/131 (54%), Gaps = 2/131 (1%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVT-YTVGRDPQYTRSIVAEAPPLITT-PVIIL 640
           ++DL+DN GG + A ++ A  FL   + +  Y   +  +  RS    +    T    IIL
Sbjct: 246 IIDLQDNPGGAMDAALKSASYFLPNNKIIMQYQDRKQKEVIRSDKKLSGGFHTNLKPIIL 305

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           +N NTASASEI   AL  N RAV VG  +YGKG +Q   + QD S    TI K++TP+  
Sbjct: 306 INANTASASEIFTAALVQNHRAVSVGQTSYGKGTVQEVGQTQD-SEYKYTIAKWLTPDGT 364

Query: 459 DINGNGIEPDF 427
            IN  G++P +
Sbjct: 365 WINQKGLKPTY 375



>pir|C83238|C83238 periplasmic tail-specific proteinase PA3257
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004748_57493 Pseudomonas aeruginosa PAO1,
           section 309 of 529 of the complete
           genome.>gb:AE004091_971593 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 698

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 46/128 (35%), Positives = 71/128 (55%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           VLDLR+N GG +Q   E+  LF+++G TV      D +       E     T P+ +LVN
Sbjct: 416 VLDLRNNGGGSLQEATELTGLFIDQGPTVLVR-NSDGRVDVLNDDEGKAFYTGPLAVLVN 474

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
           + +ASASEI A A+ D  RA+++G +T+GKG +Q+   L  G  + +T+ K+   +    
Sbjct: 475 RLSASASEIFAGAMQDYHRALILGGQTFGKGTVQTIQPLNHGE-LKLTLAKFYRVSGQST 533

Query: 453 NGNGIEPD 430
              G+ PD
Sbjct: 534 QHQGVIPD 541



>gb:AX930250_1483905 Sequence 15 from Patent
           WO03087149.>gb:AX954545_1484166 Sequence 11 from Patent
           WO03093453.
          Length = 480

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 49/153 (32%), Positives = 79/153 (51%), Gaps = 3/153 (1%)
 Frame = -1

Query: 882 SMHCQXGFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGET---VTYTVG 712
           S H    F+   +   + G    VLD+R N GG +Q+  +I K F+ +      +    G
Sbjct: 222 SEHTAKDFTAELKKLEKKGIKGLVLDVRGNPGGYLQSVEDILKHFVTKDHPYIQIAERNG 281

Query: 711 RDPQYTRSIVAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQ 532
              QY   +  + P     PV ++ +K +ASASEI+A AL +     +VGD ++GKG +Q
Sbjct: 282 NKKQYFSKLKEKKP----YPVSVITDKGSASASEILAGALKEAEGYDVVGDPSFGKGTVQ 337

Query: 531 SFFELQDGSGVVVTIGKYVTPNHMDINGNGIEP 433
               + DGS + +T+ K++TP    I+  GI+P
Sbjct: 338 QAVPMGDGSNIKLTLYKWLTPKGNWIHKQGIQP 370



>gb:AE017333_449543 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_859331 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 479

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 49/153 (32%), Positives = 79/153 (51%), Gaps = 3/153 (1%)
 Frame = -1

Query: 882 SMHCQXGFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGET---VTYTVG 712
           S H    F+   +   + G    VLD+R N GG +Q+  +I K F+ +      +    G
Sbjct: 221 SEHTAKDFTAELKKLEKKGIKGLVLDVRGNPGGYLQSVEDILKHFVTKDHPYIQIAERNG 280

Query: 711 RDPQYTRSIVAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQ 532
              QY   +  + P     PV ++ +K +ASASEI+A AL +     +VGD ++GKG +Q
Sbjct: 281 NKKQYFSKLKEKKP----YPVSVITDKGSASASEILAGALKEAEGYDVVGDPSFGKGTVQ 336

Query: 531 SFFELQDGSGVVVTIGKYVTPNHMDINGNGIEP 433
               + DGS + +T+ K++TP    I+  GI+P
Sbjct: 337 QAVPMGDGSNIKLTLYKWLTPKGNWIHKQGIQP 369



>pir|E70042|E70042 carboxy-terminal processing proteinase homolog
           yvjB - Bacillus subtilis>gb:AF017113_469371 Bacillus
           subtilis 300-304 degree genomic
           sequence.>gb:BSUB0019_755489 Bacillus subtilis complete
           genome (section 19 of 21): from 3608981 to 3809670.
          Length = 480

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 48/150 (32%), Positives = 76/150 (50%)
 Frame = -1

Query: 882 SMHCQXGFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDP 703
           S H    F+       +      V+D+R N GG +Q+  EI K F+ + +       R+ 
Sbjct: 223 SEHTAEDFAKALRELEKKEIEGLVIDVRGNPGGYLQSVEEILKHFVTKDQPYIQIAERNG 282

Query: 702 QYTRSIVAEAPPLITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFF 523
              R   +        PV ++ +K +ASASEI+A AL +     +VGD ++GKG +Q   
Sbjct: 283 DKKRYF-STLTHKKAYPVNVITDKGSASASEILAGALKEAGHYDVVGDTSFGKGTVQQAV 341

Query: 522 ELQDGSGVVVTIGKYVTPNHMDINGNGIEP 433
            + DGS + +T+ K++TPN   I+  GIEP
Sbjct: 342 PMGDGSNIKLTLYKWLTPNGNWIHKKGIEP 371



>gb:CR522870_101922 Desulfotalea psychrophila LSv54 chromosome.
          Length = 710

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 52/147 (35%), Positives = 76/147 (51%), Gaps = 14/147 (9%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT-P 652
           G    VLDLR+N GG +   ++IA LF+ EG  V        +  R +  +   ++   P
Sbjct: 418 GVDGIVLDLRNNGGGALVDAIDIAGLFVKEGPMVQVRTSMGDK--RILFDQDEGIVYAGP 475

Query: 651 VIILVNKNTASASEIVATALHDNCRAVLVGD-RTYGKGLIQSFFEL------------QD 511
           ++ILVNK +ASASEIVA AL D  RAV++G   T+GKG +Q+  +L            +D
Sbjct: 476 LVILVNKFSASASEIVAAALQDYHRAVIMGGAHTHGKGSVQTVLDLNEYVPWLSMANYED 535

Query: 510 GSGVVVTIGKYVTPNHMDINGNGIEPD 430
              + + I K+   N       G+EPD
Sbjct: 536 LGALKIMIQKFYRVNGGSTQYKGVEPD 562



>gb:BX842655_826289 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 10/11.
          Length = 526

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 54/167 (32%), Positives = 75/167 (44%), Gaps = 7/167 (4%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           E   R      +LDLRDN GG ++    IA LF+     +      DP     +      
Sbjct: 313 EIVKRSHVRGLLLDLRDNPGGQMEEAACIASLFVGPENKIFEVRYLDPSKKAEVFYGGEE 372

Query: 666 L-ITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQ--SFFELQDGSGVV 496
                P+ +LVN  +ASASEIVA AL D  RAVLVG+RT+GKG  Q   ++       + 
Sbjct: 373 KHFDMPMAVLVNAASASASEIVAGALRDLNRAVLVGERTFGKGSFQEGEYWSQNKKIALF 432

Query: 495 VTIGKYVTPNHMDINGNGIEPD----FRNLPAWNEVSKHLSKCHKPK 367
            T G Y  P+       G+EPD    F  +    E  + ++    P+
Sbjct: 433 ETKGFYYLPSGRSPQMKGLEPDVAVNFEEISVVREAEQFINPLRAPE 479



>gb:AE016780_331154 Pseudomonas putida KT2440 section 7 of 21 of the
           complete genome.>gb:AE015451_946231 Pseudomonas putida
           KT2440 complete genome.
          Length = 704

 Score = 73.6 bits (179), Expect = 5e-12
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 2/130 (1%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP--LITTPVIIL 640
           V+DLR+N GG +Q   E+  LF+ +G TV     R+      ++ +  P      P+ +L
Sbjct: 422 VIDLRNNGGGSLQEATELTSLFIEKGPTVLV---RNSDGRVDVLEDENPGAFYKGPLALL 478

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           VN+ +ASASEI A A+ D  RA+++G +T+GKG +Q+   L  G  + +T+ K+   +  
Sbjct: 479 VNRLSASASEIFAGAMQDYHRALIIGGQTFGKGTVQTIQPLNHGE-LKLTLAKFYRVSGQ 537

Query: 459 DINGNGIEPD 430
                G+ PD
Sbjct: 538 STQHQGVLPD 547



>gb:AE016994_374253 Chlamydophila caviae GPIC section 1 of 4 of the
           complete genome.>gb:AE015925_993932 Chlamydophila caviae
           GPIC complete genome.
          Length = 651

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 48/132 (36%), Positives = 69/132 (52%), Gaps = 4/132 (3%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           VLD+R+N GG +   ++++ LF+  G  V      D    R            P+ ILV+
Sbjct: 392 VLDIRENTGGFLSQAIKVSGLFMTNGVVVVSRYA-DGSIKRYRTVSPKKFYDGPLTILVS 450

Query: 633 KNTASASEIVATALHDNCRAVLVGD-RTYGKGLI--QSFFELQDGSGVV-VTIGKYVTPN 466
           K++ASA+EIVA  L D   A++VGD +TYGKG I  Q+     D  G   VT+GKY +P+
Sbjct: 451 KSSASAAEIVAQTLQDYGVAIIVGDEQTYGKGTIQHQTITADSDKEGFFKVTVGKYYSPS 510

Query: 465 HMDINGNGIEPD 430
                  G+  D
Sbjct: 511 GKSTQLQGVRSD 522



>gb:AE016870_353263 Pseudomonas syringae pv. tomato str. DC3000
           section 15 of 21 of the complete
           genome.>gb:AE016853_1038438 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 693

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 2/130 (1%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP--LITTPVIIL 640
           VLDLR+N GG +Q   E+  LF+++G TV     R+      ++ +         P+ +L
Sbjct: 411 VLDLRNNGGGSLQEATELTSLFIDKGPTVLV---RNADGKVDVLEDEAKGAFYKGPMALL 467

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHM 460
           VN+ +ASASEI A A+ D  RA+++G +T+GKG +Q+   L  G  + +T+ K+   +  
Sbjct: 468 VNRLSASASEIFAGAMQDYHRALVIGGQTFGKGTVQTIQPLNHGE-LKLTLAKFYRVSGQ 526

Query: 459 DINGNGIEPD 430
                G+ PD
Sbjct: 527 STQHQGVVPD 536



>gb:AE017159_393918 Chlamydophila pneumoniae TW-183, section 3 of 4
           of the complete genome.>gb:AE009440_1028180
           Chlamydophila pneumoniae TW-183, complete genome.
          Length = 645

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 50/134 (37%), Positives = 71/134 (52%), Gaps = 6/134 (4%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP--LITTPVIIL 640
           VLD+R+N GG +   ++++ LF+  G  V   V R    T        P      P+ IL
Sbjct: 392 VLDIRENTGGFLSQAIKVSGLFMTNGVVV---VSRYADGTMKCYRTVSPKKFYDGPLAIL 448

Query: 639 VNKNTASASEIVATALHDNCRAVLVGD-RTYGKGLIQSFFELQDGSG---VVVTIGKYVT 472
           V+K++ASA+EIVA  L D   A++VGD +TYGKG IQ      D S      VT+GKY +
Sbjct: 449 VSKSSASAAEIVAQTLQDYGVALVVGDEQTYGKGTIQHQTITGDASQDDCFKVTVGKYYS 508

Query: 471 PNHMDINGNGIEPD 430
           P+       G++ D
Sbjct: 509 PSGKSTQLQGVKSD 522



>gb:AE016827_342450 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 718

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 51/149 (34%), Positives = 79/149 (53%), Gaps = 11/149 (7%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP---LITT 655
           A+S ++DLR+N GG +   VE++ LF+++G  V     RD  Y R  V E P    + T 
Sbjct: 390 ATSLIIDLRENGGGALTEAVELSGLFISDGPVVQV---RDA-YNRIRVHEDPDNAQVYTG 445

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL-------QDGSGVV 496
           P++++ N+ +ASASEI + A+ D  R +++G  T+GKG +Q    L       Q+  G +
Sbjct: 446 PLLVMTNRFSASASEIFSAAMQDYNRGIIIGQDTFGKGTVQQSRSLNFVYDLDQEPLGFI 505

Query: 495 -VTIGKYVTPNHMDINGNGIEPDFRNLPA 412
             TI K+   N       G+  D  N PA
Sbjct: 506 QYTIQKFYRINGGSTQLKGVTADI-NFPA 533



>gb:AE012868_286529 Chlorobium tepidum TLS section 89 of 194 of the
           complete genome.>gb:AE006470_933697 Chlorobium tepidum
           TLS complete genome.
          Length = 675

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 41/107 (38%), Positives = 59/107 (55%), Gaps = 7/107 (6%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYT-------VGRDPQYTRSIVAEAPPLITT 655
           ++DLR+N GG ++  V +  LF   G  V  +       V  D  Y        P L   
Sbjct: 386 IVDLRENGGGSLEEAVNVTGLFTGRGPVVQVSNALGGKMVLNDENY--------PMLYRG 437

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQ 514
           P+++LVN+ +ASASEI A A+ D  R ++VGDRT+GKG +QS   +Q
Sbjct: 438 PLVVLVNRYSASASEIFAAAIQDYGRGLIVGDRTFGKGTVQSIVTIQ 484



>pir|G86559|G86559 tail-specific proteinase [imported] -
           Chlamydophila pneumoniae (strain J138)>pir|F72063|F72063
           tail-specific proteinase precursor, probable CP0197
           [imported] - Chlamydophila pneumoniae (strains CWL029
           and AR39)>gb:AE001640_37407 Chlamydia pneumoniae section
           56 of 103 of the complete genome.>gb:AE002180_43683
           Chlamydophila pneumoniae AR39, section 16 of 94 of the
           complete genome.>gb:BA000008_663924 Chlamydophila
           pneumoniae J138 genomic DNA, complete
           sequence.>gb:AE002161_885808 Chlamydophila pneumoniae
           AR39, complete genome.>gb:AE001363_941964 Chlamydia
           pneumoniae, complete genome.>gb:AX464496_1469098
           Sequence 31 from Patent EP1219635.
          Length = 648

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 50/134 (37%), Positives = 71/134 (52%), Gaps = 6/134 (4%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP--LITTPVIIL 640
           VLD+R+N GG +   ++++ LF+  G  V   V R    T        P      P+ IL
Sbjct: 395 VLDIRENTGGFLSQAIKVSGLFMTNGVVV---VSRYADGTMKCYRTVSPKKFYDGPLAIL 451

Query: 639 VNKNTASASEIVATALHDNCRAVLVGD-RTYGKGLIQSFFELQDGSG---VVVTIGKYVT 472
           V+K++ASA+EIVA  L D   A++VGD +TYGKG IQ      D S      VT+GKY +
Sbjct: 452 VSKSSASAAEIVAQTLQDYGVALVVGDEQTYGKGTIQHQTITGDASQDDCFKVTVGKYYS 511

Query: 471 PNHMDINGNGIEPD 430
           P+       G++ D
Sbjct: 512 PSGKSTQLQGVKSD 525



>pir|B81673|B81673 tail specific proteinase precursor, probable
           TC0725 [imported] - Chlamydia muridarum (strain
           Nigg)>gb:AE002340_45309 Chlamydia muridarum Nigg section
           68 of 85 of the complete genome.>gb:AE002160_1149449
           Chlamydia muridarum Nigg, complete genome.
          Length = 649

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 49/134 (36%), Positives = 75/134 (55%), Gaps = 6/134 (4%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVT--YTVGRDPQYTRSIVAEAPPLITTPVIIL 640
           VLD+R+N GG +   ++++ LFL  G  V   Y  G   +Y R+I  +       P+ +L
Sbjct: 392 VLDIRENTGGFLSQAIKVSGLFLTNGVVVVSRYADGSVKRY-RTISPQK--FYDGPLAVL 448

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDR-TYGKGLIQSFFELQDGSG---VVVTIGKYVT 472
           V+K++ASA+EIVA  L D   A++VGD+ TYGKG IQ      + S      VT+G+Y +
Sbjct: 449 VSKSSASAAEIVAQTLQDYGVALIVGDKQTYGKGTIQHQTITGNNSQEDFFKVTVGRYYS 508

Query: 471 PNHMDINGNGIEPD 430
           P+       G++ D
Sbjct: 509 PSGKSTQLEGVKSD 522



>pir|B71515|B71515 probable tail-specific proteinase - Chlamydia
           trachomatis  (serotype D, strain
           UW3/Cx)>gb:AE001317_34375 Chlamydia trachomatis
           D/UW-3/CX section 44 of 87 of the complete
           genome.>gb:AE001273_1098401 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 644

 Score = 70.1 bits (170), Expect = 5e-11
 Identities = 50/136 (36%), Positives = 76/136 (55%), Gaps = 8/136 (5%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVT--YTVGRDPQYTRSIVAEAPPLITTPVIIL 640
           VLD+R+N GG +   ++++ LFL  G  V   Y  G   +Y R+I  +       P+ +L
Sbjct: 392 VLDIRENTGGFLSQAIKVSGLFLTNGVVVVSRYADGSVKRY-RTISPQK--FYDGPLAVL 448

Query: 639 VNKNTASASEIVATALHDNCRAVLVGD-RTYGKGLIQSFFELQDGSG-----VVVTIGKY 478
           V+K++ASA+EIVA  L D   A++VGD +TYGKG IQ   +   GS        VT+G+Y
Sbjct: 449 VSKSSASAAEIVAQTLQDYGVALIVGDQQTYGKGTIQ--HQTITGSNSQEDFFKVTVGRY 506

Query: 477 VTPNHMDINGNGIEPD 430
            +P+       G++ D
Sbjct: 507 YSPSGKSTQLEGVKSD 522



>gb:AE017153_392493 Haemophilus ducreyi strain 35000HP section 3 of
           6 of the complete genome.>gb:AE017143_1026755
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 688

 Score = 69.3 bits (168), Expect = 9e-11
 Identities = 36/104 (34%), Positives = 59/104 (56%), Gaps = 10/104 (9%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETV----------TYTVGRDPQYTRSIVAEAPPL 664
           ++DLRDN GG +   VE+ +LF+     V           Y      Q  +S+V    PL
Sbjct: 398 IVDLRDNGGGSLTEVVELTRLFIKSSPVVQVRDAFNRIKVYEDEPQIQVDKSVVTTNKPL 457

Query: 663 ITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQ 532
               +++++N+++ASASEI A A+ D  RA+++G +T+GKG +Q
Sbjct: 458 YDGKLMVMINRHSASASEIFAAAMQDYNRAIIIGQQTFGKGTVQ 501



>gb:CP000001_855467 Bacillus cereus ZK, complete genome.
          Length = 469

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 39/127 (30%), Positives = 72/127 (56%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           V+D+R N GG + +  EI    + + + +     R+ +  +    E     + P+ +L++
Sbjct: 236 VIDVRGNPGGYLNSVEEILGEIMTDKKPMLQVEQRNGE-KKKFSTELKERKSYPISVLID 294

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASEI+A AL +     L+G++T+GKG +Q     +DGS + +T+ K++TP+   I
Sbjct: 295 NGSASASEILAGALKEGEGYDLIGEKTFGKGTVQQAVPFKDGSNIKLTMFKWLTPDGNWI 354

Query: 453 NGNGIEP 433
           +  GI+P
Sbjct: 355 HKKGIKP 361



>gb:BX908798_829802 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 653

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 43/98 (43%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDP-QYTRSIVAEAPPLITTPVIILV 637
           +LDLR N GGL+   V +  LF+ +G  V+        Q+ R +  +       P+IILV
Sbjct: 384 ILDLRYNSGGLLSQAVAVTSLFITKGIVVSIKDENGKIQHLRDL--DGTSTWDGPLIILV 441

Query: 636 NKNTASASEIVATALHDNCRAVLVG-DRTYGKGLIQSF 526
           N+ +ASASEIVA  L D  RA++VG D TYGKG  Q+F
Sbjct: 442 NRMSASASEIVAQTLQDYGRAIIVGDDHTYGKGSYQTF 479



>gb:AE017280_426488 Bacillus cereus ATCC 10987, section 17 of 18 of
           the complete genome.>gb:AE017194_1064907 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 469

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 39/127 (30%), Positives = 71/127 (55%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           V+D+R N GG + +  EI    + + + +     R+ +  +    E       P+ +L++
Sbjct: 236 VIDVRGNPGGYLNSVEEILGEIMTDKKPMLQVEQRNGE-KKKFSTELKERKPYPISVLID 294

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASEI+A AL +     L+G++T+GKG +Q     +DGS + +T+ K++TP+   I
Sbjct: 295 NGSASASEILAGALKEGEGYDLIGEKTFGKGTVQQAVPFKDGSNIKLTMFKWLTPDGNWI 354

Query: 453 NGNGIEP 433
           +  GI+P
Sbjct: 355 HKKGIKP 361



>gb:AE017225_410398 Bacillus anthracis str. Sterne, complete
           genome.>gb:AE017355_466147 Bacillus thuringiensis
           serovar konkukian str. 97-27, complete genome.
          Length = 478

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 39/127 (30%), Positives = 71/127 (55%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           V+D+R N GG + +  EI    + + + +     R+ +  +    E       P+ +L++
Sbjct: 245 VIDVRGNPGGYLNSVEEILGEIMTDKKPMLQVEQRNGE-KKKFSTELKERKPYPISVLID 303

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASEI+A AL +     L+G++T+GKG +Q     +DGS + +T+ K++TP+   I
Sbjct: 304 NGSASASEILAGALKEGEGYDLIGEKTFGKGTVQQAVPFKDGSNIKLTMFKWLTPDGNWI 363

Query: 453 NGNGIEP 433
           +  GI+P
Sbjct: 364 HKKGIKP 370



>gb:AE017040_385313 Bacillus anthracis str. Ames section 17 of 18 of
           the complete genome.>gb:AE017334_455160 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE016879_1015018 Bacillus anthracis str. Ames
           complete genome.
          Length = 469

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 39/127 (30%), Positives = 71/127 (55%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           V+D+R N GG + +  EI    + + + +     R+ +  +    E       P+ +L++
Sbjct: 236 VIDVRGNPGGYLNSVEEILGEIMTDKKPMLQVEQRNGE-KKKFSTELKERKPYPISVLID 294

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASEI+A AL +     L+G++T+GKG +Q     +DGS + +T+ K++TP+   I
Sbjct: 295 NGSASASEILAGALKEGEGYDLIGEKTFGKGTVQQAVPFKDGSNIKLTMFKWLTPDGNWI 354

Query: 453 NGNGIEP 433
           +  GI+P
Sbjct: 355 HKKGIKP 361



>gb:AE012464_282676 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 372 of 460 of the complete
           genome.>gb:AE008922_915958 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 727

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 42/138 (30%), Positives = 73/138 (52%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PVIIL 640
           VLDLR+N GG +   +E+  LF+ +G  V     R+     ++  ++ P +    P+ +L
Sbjct: 412 VLDLRNNGGGSLDEAIELTGLFIEQGPVVQV---RESGGRVTVNGDSNPKVAWDGPLGVL 468

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL--------QDGSGVVVTIG 484
           +N+ +ASASEI A A+ D  R +++G+ T+GKG +Q+  +L        Q    V +TI 
Sbjct: 469 INRGSASASEIFAGAIQDYGRGLVIGETTFGKGTVQNIVDLDRWPAAEGQRYGQVKLTIA 528

Query: 483 KYVTPNHMDINGNGIEPD 430
           ++   +       G+ PD
Sbjct: 529 QFFRVSGSSTQHKGVVPD 546



>gb:AE011695_275629 Xanthomonas axonopodis pv. citri str. 306,
           section 73 of 469 of the complete
           genome.>gb:AE008923_917404 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 727

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 41/138 (29%), Positives = 73/138 (52%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PVIIL 640
           VLDLR+N GG +   +E+  LF+ +G  V     R+     ++  ++ P +    P+ +L
Sbjct: 412 VLDLRNNGGGSLDEAIELTGLFIEQGPVVQV---RESGGRVTVNGDSDPKVAWDGPLAVL 468

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL--------QDGSGVVVTIG 484
           +N+ +ASASEI A A+ D  R +++G+ ++GKG +Q+  +L        Q    V +TI 
Sbjct: 469 INRGSASASEIFAGAIQDYGRGLVIGETSFGKGTVQNIVDLDRWPAAEGQRYGQVKLTIA 528

Query: 483 KYVTPNHMDINGNGIEPD 430
           ++   +       G+ PD
Sbjct: 529 QFFRVSGSSTQHKGVVPD 546



>gb:AE006061_215157 Pasteurella multocida subsp. multocida str. Pm70
           section 28 of 204 of the complete
           genome.>gb:AE004439_1117887 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 683

 Score = 67.0 bits (162), Expect = 5e-10
 Identities = 37/101 (36%), Positives = 62/101 (61%), Gaps = 3/101 (2%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP---LITT 655
           A + ++DLRDN GG +   V ++ LF+++G  V     RD  + R  V E P    + + 
Sbjct: 391 AKALIIDLRDNGGGALTEAVGLSGLFISDGPIVQV---RDA-FQRIRVHEDPDSEQVYSG 446

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQ 532
           P+++++N+ +ASASEI A A+ D  R +++G  T+GKG +Q
Sbjct: 447 PLLVMINRFSASASEIFAAAMQDYNRGIIIGQNTFGKGTVQ 487



>gb:BA000028_696877 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 488

 Score = 66.6 bits (161), Expect = 6e-10
 Identities = 39/132 (29%), Positives = 70/132 (53%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           G    V+D+R N GGL+    +I K  + +   +      + Q    + ++       P+
Sbjct: 251 GIEGLVIDVRGNPGGLLNVAEDILKHLVPKDLPILQIEDGEGQ-VEEVYSDLEEKKEYPI 309

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
            +++++ +ASASEI+A A+ D     +VG+ +YGKG +Q    + DGS + +T  K+++P
Sbjct: 310 SVMIDEGSASASEILAVAMKD-LGYDIVGETSYGKGTVQQAVPMGDGSSIKLTTLKWLSP 368

Query: 468 NHMDINGNGIEP 433
               IN  G+EP
Sbjct: 369 KGEWINEEGVEP 380



>gb:AE017340_457036 Idiomarina loihiensis L2TR, complete genome.
          Length = 685

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 9/137 (6%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           V+DLR N GG +   + ++ LF+++G  V  + GR  +   S   +       P+ ++V+
Sbjct: 403 VIDLRGNGGGALTEAIGLSGLFIDKGPVVQVSDGRG-RVDVSEDKDGKTYYDGPLFVMVD 461

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQ---------SFFELQDGSGVVVTIGK 481
           + +ASASEI A A+ D  RA+++G+ T+GKG +Q          F++   GS V  TI K
Sbjct: 462 RYSASASEIFAAAMQDYERALIIGENTFGKGTVQQHRGLARRFDFYDKPLGS-VQYTIAK 520

Query: 480 YVTPNHMDINGNGIEPD 430
           +   +       G++PD
Sbjct: 521 FYRIDGGSTQLRGVQPD 537



>gb:AE013598_297651 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 727

 Score = 66.2 bits (160), Expect = 8e-10
 Identities = 41/138 (29%), Positives = 73/138 (52%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PVIIL 640
           VLDLR+N GG +   +E+  LF+ +G  V     R+     ++  ++ P +    P+ +L
Sbjct: 412 VLDLRNNGGGSLDEAIELTGLFIEQGPVVQV---RESGGRVTVNGDSDPKVAWDGPLGVL 468

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL--------QDGSGVVVTIG 484
           +N+ +ASASEI A A+ D  R +++G+ ++GKG +Q+  +L        Q    V +TI 
Sbjct: 469 INRGSASASEIFAGAIQDYGRGLVIGETSFGKGTVQNIVDLDRWPAAEGQRYGQVKLTIA 528

Query: 483 KYVTPNHMDINGNGIEPD 430
           ++   +       G+ PD
Sbjct: 529 QFFRVSGSSTQHKGVVPD 546



>gb:AE016761_326245 Escherichia coli CFT073 section 7 of 18 of the
           complete genome.>gb:AE014075_956829 Escherichia coli
           CFT073 complete genome.
          Length = 682

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 382 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPSGPIVQVR-DNNGKVREDSDTDGQVFYKG 440

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 441 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 500

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 501 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>gb:CP000026_75883 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 682

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 52/161 (32%), Positives = 76/161 (47%), Gaps = 17/161 (10%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----RDPQYTRSIVAEAPP 667
           +   +S V+DLR N GG +   V ++ LF+  G  V         R+   T  +V    P
Sbjct: 382 KQNVNSIVIDLRSNGGGALTEAVSLSGLFIPSGPIVQVRDNNGKVREDSDTDGVVYYKGP 441

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD-------- 511
           L+     +LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L          
Sbjct: 442 LV-----VLVDRFSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSLNRIYDQMLRP 496

Query: 510 -----GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
                GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 497 EWPALGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>sp|P43669|PRC_SALTY Tail-specific protease precursor (EC
           3.4.21.102) (Protease Re) (PRC protein) (C-terminal
           processing peptidase).>gb:AE008782_243532 Salmonella
           typhimurium LT2, section 86 of 220 of the complete
           genome.>gb:AE006468_1000614 Salmonella typhimurium LT2,
           complete genome.
          Length = 682

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 52/161 (32%), Positives = 76/161 (47%), Gaps = 17/161 (10%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----RDPQYTRSIVAEAPP 667
           +   +S V+DLR N GG +   V ++ LF+  G  V         R+   T  +V    P
Sbjct: 382 KQNVNSIVIDLRSNGGGALTEAVSLSGLFIPSGPIVQVRDNNGKVREDSDTDGVVYYKGP 441

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD-------- 511
           L+     +LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L          
Sbjct: 442 LV-----VLVDRFSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSLNRIYDQMLRP 496

Query: 510 -----GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
                GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 497 EWPALGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>gb:CP000020_871456 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 673

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 10/141 (7%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLI--TTPV 649
           S  ++DLR+N GG +     ++ LF+  G  V     RD     ++ A+    I  T P+
Sbjct: 391 SGIIVDLRNNGGGALTEATALSGLFITAGPVVQV---RDSYGRVNVNADTDGEISYTGPM 447

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQS------FFELQDG--SGVVV 493
            +LVN+ +ASASEI A A+ D  RAV++G+ ++GKG +Q        ++L D     V  
Sbjct: 448 TVLVNRYSASASEIFAAAMQDYGRAVILGENSFGKGTVQQHRSLNHIYDLFDKPLGHVQY 507

Query: 492 TIGKYVTPNHMDINGNGIEPD 430
           TI K+   N       G+ PD
Sbjct: 508 TIQKFYRINGGSTQNLGVVPD 528



>gb:AE016983_371339 Shigella flexneri 2a str. 2457T section 6 of 16
           of the complete genome.>gb:AE014073_996089 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 680

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 380 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR-DNNGKVREDSDTDGQVFYKG 438

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 439 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 498

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 499 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 533



>gb:ECOPRC_129848 Escherichia coli prc gene involved in the
           C-terminal processing of penicillin-binding protein 3,
           complete cds.
          Length = 680

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 380 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR-DNNGKVREDSDTDGQVFYKG 438

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 439 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 498

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 499 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 533



>gb:ECOPRC_129847 Escherichia coli prc gene involved in the
           C-terminal processing of penicillin-binding protein 3,
           complete cds.
          Length = 682

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 382 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR-DNNGKVREDSDTDGQVFYKG 440

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 441 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 500

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 501 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>gb:D90827_123074 E.coli genomic DNA, Kohara clone #336(41.2-41.6
           min.).
          Length = 644

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 382 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR-DNNGKVREDSDTDGQVFYKG 440

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 441 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 500

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 501 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>gb:AE005674_70977 Shigella flexneri 2a str. 301, complete genome.
          Length = 680

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 380 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR-DNNGKVREDSDTDGQVFYKG 438

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 439 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 498

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 499 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 533



>pir|D90946|D90946 hypothetical protein ECs2540 [imported] -
           Escherichia coli  (strain O157:H7, substrain RIMD
           0509952)>pir|H85794|H85794 hypothetical protein prc
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>gb:AE005174_66819 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:BA000007_660552
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 682

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 382 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR-DNNGKVREDSDTDGQVFYKG 440

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 441 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 500

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 501 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>sp|P23865|PRC_ECOLI Tail-specific protease precursor (EC
           3.4.21.102) (Protease Re) (PRC protein) (C-terminal
           processing peptidase).>pir|A41798|A41798
           carboxy-terminal proteinase (EC 3.4.21.-) precursor -
           Escherichia coli (strain K-12)>gb:D90826_123069 E.coli
           genomic DNA, Kohara clone #335(40.9-41.3
           min.).>gb:ECOTSP_130550 Escherichia coli tail-specific
           protease (tsp) gene, complete cds.>gb:U00096_200896
           Escherichia coli K-12 MG1655 complete genome.
          Length = 682

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/157 (30%), Positives = 74/157 (47%), Gaps = 13/157 (8%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT 655
           +   SS ++DLR N GG +   V ++ LF+  G  V      + +       +       
Sbjct: 382 KQNVSSVIIDLRSNGGGALTEAVSLSGLFIPAGPIVQVR-DNNGKVREDSDTDGQVFYKG 440

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD------------ 511
           P+++LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L              
Sbjct: 441 PLVVLVDRFSASASEIFAAAMQDYGRALVVGEPTFGKGTVQQYRSLNRIYDQMLRPEWPA 500

Query: 510 -GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 501 LGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>gb:BX936398_837019 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 692

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/110 (35%), Positives = 60/110 (54%), Gaps = 4/110 (3%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----RDPQYTRSIVAEAPP 667
           +   SS ++DLR N GG +   V ++ LF+  G  V         R+   T  +V    P
Sbjct: 381 KQNVSSIIIDLRSNGGGALTEAVSLSGLFIPSGPVVQVRDNNGKVREDSDTDGVVYYKGP 440

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL 517
           L+     +LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L
Sbjct: 441 LV-----VLVDRYSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSL 485



>gb:BA000031_707066 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 668

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 43/138 (31%), Positives = 70/138 (50%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PVIIL 640
           ++DLR+N GG +     +  LF+ EG  V     RD      + A+   L++   P+ +L
Sbjct: 389 IVDLRNNGGGALTEATALTGLFIKEGPVVQV---RDSYGRIKVNADTDGLVSYDGPLTVL 445

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL--------QDGSGVVVTIG 484
           +N+ +ASASEI A A+ D  RAV++G+ ++GKG +Q    L        ++   V  TI 
Sbjct: 446 INRYSASASEIFAAAMQDYNRAVILGENSFGKGTVQQHRSLNHIYDLFDKELGYVQYTIQ 505

Query: 483 KYVTPNHMDINGNGIEPD 430
           K+   +       G+ PD
Sbjct: 506 KFYRIDGGSTQNRGVAPD 523



>gb:AE013790_300176 Yersinia pestis KIM section 190 of 415 of the
           complete genome.>gb:AE017133_387535 Yersinia pestis
           biovar Medievalis str. 91001 section 7 of 16 of the
           complete genome.>gb:AE009952_930359 Yersinia pestis KIM
           complete genome.>gb:AE017042_1144101 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 706

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/110 (35%), Positives = 60/110 (54%), Gaps = 4/110 (3%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----RDPQYTRSIVAEAPP 667
           +   SS ++DLR N GG +   V ++ LF+  G  V         R+   T  +V    P
Sbjct: 397 KQNVSSIIIDLRSNGGGALTEAVSLSGLFIPSGPVVQVRDNNGKVREDSDTDGVVYYKGP 456

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL 517
           L+     +LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L
Sbjct: 457 LV-----VLVDRYSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSL 501



>pir|AI0207|AI0207 tail-specific proteinase precursor (EC 3.4.21.-)
           [imported] - Yersinia pestis (strain
           CO92)>gb:AJ414150_523518 Yersinia pestis strain CO92
           complete genome; segment 10/20.
          Length = 690

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 39/110 (35%), Positives = 60/110 (54%), Gaps = 4/110 (3%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----RDPQYTRSIVAEAPP 667
           +   SS ++DLR N GG +   V ++ LF+  G  V         R+   T  +V    P
Sbjct: 381 KQNVSSIIIDLRSNGGGALTEAVSLSGLFIPSGPVVQVRDNNGKVREDSDTDGVVYYKGP 440

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL 517
           L+     +LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L
Sbjct: 441 LV-----VLVDRYSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSL 485



>gb:AE017014_380005 Bacillus cereus ATCC 14579 section 17 of 18 of
           the complete genome.>gb:AE016877_1020255 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 478

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 38/127 (29%), Positives = 69/127 (54%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           V+D+R N GG + +  +I    +   + +     R+ +  +    E       P+ +L++
Sbjct: 245 VIDVRGNPGGYLNSVEDILGEIMTNKKPMLQVEQRNGE-KKKFSTELKERKPYPISVLID 303

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDI 454
             +ASASEI+A AL +     L+G++T+GKG +Q     +DGS + +T+ K++TP+   I
Sbjct: 304 NGSASASEILAGALKEGEGYDLIGEKTFGKGTVQQAVPFKDGSNIKLTMFKWLTPDGNWI 363

Query: 453 NGNGIEP 433
           +  GI P
Sbjct: 364 HKKGIAP 370



>gb:BX950851_841197 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 671

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 41/110 (37%), Positives = 60/110 (54%), Gaps = 4/110 (3%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----RDPQYTRSIVAEAPP 667
           +   SS V+DLR N GG +   V ++ LF+  G  V         R+   T  IV    P
Sbjct: 381 KQNVSSIVIDLRTNGGGALTEAVGLSGLFIPSGPVVQVRDNNGKVREDSDTDGIVYYKGP 440

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL 517
           L+     +LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L
Sbjct: 441 LV-----VLVDRFSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSL 485



>gb:AE016805_337244 Vibrio vulnificus CMCP6 chromosome I section 9
           of 11 of the complete sequence.>gb:AE016795_1046968
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 666

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 44/143 (30%), Positives = 70/143 (48%), Gaps = 10/143 (6%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT-- 655
           G    ++DLR+N GG +     +  LF+ +G  V     RD      + A+    I+   
Sbjct: 384 GVDGIIVDLRNNGGGALTEATALTGLFIEKGPVVQV---RDSYGRVKVNADTDGQISYSG 440

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL--------QDGSGV 499
           P+ +LVN+ +ASASEI A AL D  RA+++G+ ++GKG +Q    L        ++   V
Sbjct: 441 PMTVLVNRYSASASEIFAAALQDYGRAIILGENSFGKGTVQQHRSLNHIYDLFDKEIGYV 500

Query: 498 VVTIGKYVTPNHMDINGNGIEPD 430
             TI K+   +       G+ PD
Sbjct: 501 QYTIQKFYRIDGGSTQNKGVVPD 523



>gb:BA000037_722473 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 666

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 44/143 (30%), Positives = 70/143 (48%), Gaps = 10/143 (6%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT-- 655
           G    ++DLR+N GG +     +  LF+ +G  V     RD      + A+    I+   
Sbjct: 384 GIDGIIVDLRNNGGGALTEATALTGLFIEKGPVVQV---RDSYGRVKVNADTDGQISYSG 440

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL--------QDGSGV 499
           P+ +LVN+ +ASASEI A AL D  RA+++G+ ++GKG +Q    L        ++   V
Sbjct: 441 PMTVLVNRYSASASEIFAAALQDYGRAIILGENSFGKGTVQQHRSLNHIYDLFDKEIGYV 500

Query: 498 VVTIGKYVTPNHMDINGNGIEPD 430
             TI K+   +       G+ PD
Sbjct: 501 QYTIQKFYRIDGGSTQNKGVVPD 523



>pir|AE0728|AE0728 tail-specific protease precursor [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016837_345167 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 4 of 16 of
           the complete genome.>gb:AL627272_542140 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 8/20.>gb:AE014613_982499
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 682

 Score = 63.9 bits (154), Expect = 4e-09
 Identities = 51/161 (31%), Positives = 76/161 (47%), Gaps = 17/161 (10%)
 Frame = -1

Query: 834 RXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVG----RDPQYTRSIVAEAPP 667
           +   +S V++LR N GG +   V ++ LF+  G  V         R+   T  +V    P
Sbjct: 382 KQNVNSIVINLRSNGGGALTEAVSLSGLFIPSGPIVQVRDNNGKVREDSDTDGVVYYKGP 441

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQD-------- 511
           L+     +LV++ +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L          
Sbjct: 442 LV-----VLVDRFSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSLNRIYDQMLRP 496

Query: 510 -----GSGVVVTIGKYVTPNHMDINGNGIEPDFRNLPAWNE 403
                GS V  TI K+   N       G+ PD   +P  NE
Sbjct: 497 EWPALGS-VQYTIQKFYRVNGGSTQRKGVTPDI-IMPTGNE 535



>gb:BX571868_787539 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 10/17.
          Length = 683

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 38/102 (37%), Positives = 55/102 (53%)
 Frame = -1

Query: 822 SSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVII 643
           S+ V+DLR N GG +   V ++ LFL  G  V            S   E       P+++
Sbjct: 390 SAIVIDLRSNGGGALTEAVSLSGLFLPSGPVVQVRDNNGKVRQDSDTDEVV-YYKGPLVV 448

Query: 642 LVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL 517
           LV+  +ASASEI A A+ D  RA++VG+ T+GKG +Q +  L
Sbjct: 449 LVDHFSASASEIFAAAMQDYGRALIVGEPTFGKGTVQQYRSL 490



>gb:AE012557_284450 Xylella fastidiosa Temecula1, section 5 of 9 of
           the complete genome.>gb:AE009442_961026 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 727

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PVIIL 640
           VLDLR+N GG +   +++  LF+ +G  V     R+     ++  +    +T   P+ +L
Sbjct: 412 VLDLRNNGGGSLDEAIQLTGLFIEQGPVVQV---RESGGRVTVNGDRDDKVTWDGPLAVL 468

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSG--------VVVTIG 484
           +N+ +ASASEI A A+ D  R +++G+ ++GKG +Q+  +L             V +TI 
Sbjct: 469 INRGSASASEIFAGAIQDYGRGLVIGETSFGKGTVQNIVDLDRWPANESRRFGQVKLTIA 528

Query: 483 KYVTPNHMDINGNGIEPD 430
           ++   +       G+ PD
Sbjct: 529 QFFRISGSSTQHKGVLPD 546



>pir|F82634|F82634 tail-specific proteinase XF1823 [imported] -
           Xylella fastidiosa (strain 9a5c)>gb:AE004003_49458
           Xylella fastidiosa 9a5c, section 149 of 229 of the
           complete genome.>gb:AE003849_1116668 Xylella fastidiosa
           9a5c, complete genome.
          Length = 727

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 39/138 (28%), Positives = 71/138 (51%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PVIIL 640
           VLDLR+N GG +   +++  LF+ +G  V     R+     ++  +    +T   P+ +L
Sbjct: 412 VLDLRNNGGGSLDEAIQLTGLFIEQGPVVQV---RESGGRVTVNGDRDDKVTWDGPLAVL 468

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSG--------VVVTIG 484
           +N+ +ASASEI A A+ D  R +++G+ ++GKG +Q+  +L             V +TI 
Sbjct: 469 INRGSASASEIFAGAIQDYGRGLVIGETSFGKGTVQNIVDLDRWPANESRRFGQVKLTIA 528

Query: 483 KYVTPNHMDINGNGIEPD 430
           ++   +       G+ PD
Sbjct: 529 QFFRISGSSTQHKGVLPD 546



>gb:CR378669_95302 Photobacterium profundum SS9; segment 7/12.
          Length = 666

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 44/138 (31%), Positives = 68/138 (49%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLI--TTPVIIL 640
           V+DLR+N GG +     +  LF+N G  V     RD      +  ++   +    P+ +L
Sbjct: 389 VIDLRNNGGGALTEATALTGLFINSGPVVQV---RDSYGRVKVNGDSDDRVYFDGPLTVL 445

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQS------FFELQDG--SGVVVTIG 484
            N+ +ASASEI A A  D  RAV++G++++GKG +Q        ++L D     V  TI 
Sbjct: 446 QNRYSASASEIFAAATQDYGRAVVIGEQSFGKGTVQQHRSLNHIYDLFDKPLGHVQYTIQ 505

Query: 483 KYVTPNHMDINGNGIEPD 430
           K+   N       G+ PD
Sbjct: 506 KFYRINGGSTQNLGVVPD 523



>sp|P45306|PRC_HAEIN Tail-specific protease precursor (EC
           3.4.21.102) (Protease Re) (C- terminal processing
           peptidase).>pir|F64135|F64135 carboxy-terminal
           proteinase (EC 3.4.21.-) - Haemophilus influenzae
           (strain Rd KW20)>gb:U32840_205325 Haemophilus influenzae
           Rd KW20 section 155 of 163 of the complete
           genome.>gb:L42023_1097874 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 695

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 48/148 (32%), Positives = 72/148 (48%), Gaps = 11/148 (7%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAE---APPLITT 655
           A + ++DLR+N GG +   V ++ LF+ +G  V     RD  Y R  V E   A      
Sbjct: 392 AEALIVDLRENGGGALTEAVALSGLFITDGPVVQV---RDA-YQRIRVHEDDDATQQYKG 447

Query: 654 PVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL-------QDGSGVV 496
            + +++N+ +ASASEI A A+ D  R +++G  T+GKG +Q    L       Q   GV+
Sbjct: 448 LLFVMINRYSASASEIFAAAMQDYRRGIIIGQNTFGKGTVQQSRSLNFIYDLDQSPLGVL 507

Query: 495 -VTIGKYVTPNHMDINGNGIEPDFRNLP 415
             TI K+   N       G+  D  N P
Sbjct: 508 QYTIQKFYRVNGGSTQLKGVAADI-NFP 534



>pir|C82192|C82192 tail-specific proteinase VC1496 [imported] -
           Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004228_51881 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 136 of 251 of the
           complete chromosome.>gb:AE003852_1052655 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 665

 Score = 60.1 bits (144), Expect = 6e-08
 Identities = 40/138 (28%), Positives = 70/138 (50%), Gaps = 10/138 (7%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITT--PVIIL 640
           ++DLR+N GG +     ++ LF+  G  V     RD     ++ ++    I+   P+ +L
Sbjct: 390 IVDLRNNGGGALTEATALSGLFITSGPVVQV---RDSYGRVNVNSDTDGSISYSGPMTVL 446

Query: 639 VNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFEL--------QDGSGVVVTIG 484
           +N+ +ASASEI A A+ D  RA+++G+ ++GKG +Q    L        ++   V  TI 
Sbjct: 447 INRYSASASEIFAAAMQDYGRAIILGENSFGKGTVQQHRSLNHIYDLFDKELGYVQYTIQ 506

Query: 483 KYVTPNHMDINGNGIEPD 430
           K+   +       G+ PD
Sbjct: 507 KFYRIDGGSTQNKGVVPD 524



>gb:AE015702_316970 Shewanella oneidensis MR-1 section 251 of 457 of
           the complete genome.>gb:AE014299_952567 Shewanella
           oneidensis MR-1 complete genome.
          Length = 682

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 34/94 (36%), Positives = 54/94 (57%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVIILVN 634
           V+DLR N GG +   V +  LF++ G  V      D + +     +     T P+ ++V+
Sbjct: 397 VIDLRGNGGGALTEAVLLTGLFIDMGPVVQVR-DADGRVSAHRDNDGKTTYTGPLTVMVD 455

Query: 633 KNTASASEIVATALHDNCRAVLVGDRTYGKGLIQ 532
           + +ASASEI A AL D  RA++VG+ ++GKG +Q
Sbjct: 456 RYSASASEIFAAALQDYDRALIVGESSFGKGTVQ 489



>gb:BX294154_771684 Pirellula sp. strain 1 complete genome; segment
           22/24.
          Length = 708

 Score = 56.6 bits (135), Expect = 6e-07
 Identities = 40/140 (28%), Positives = 70/140 (50%), Gaps = 12/140 (8%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLITTPVIIL 640
           VLDL  N GG +   + +  LF++ G  V    + G   QY+     ++  +   P++++
Sbjct: 430 VLDLTRNGGGSLTEAISLTGLFIDRGPVVQVKNSDGSVQQYSDD---QSGTVWDGPLVVV 486

Query: 639 VNKNTASASEIVATALHDNCRAVLVGD-RTYGKGLIQSFFELQDG---------SGVVVT 490
            +K +ASASEI A A+ D  R ++VGD  T+GKG +Q+  ++              + VT
Sbjct: 487 TSKLSASASEIFAGAIKDYHRGIVVGDPATHGKGTVQTLMDIGQSLFRNNNANYGALKVT 546

Query: 489 IGKYVTPNHMDINGNGIEPD 430
           + ++  P+       G+E D
Sbjct: 547 LQQFYLPDGESTQLKGVEAD 566



>gb:BA000045_741600 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 481

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 1/128 (0%)
 Frame = -1

Query: 813 VLDLRDNXGGLVQAGVEIAKLFLNEGET-VTYTVGRDPQYTRSIVAEAPPLITTPVIILV 637
           +LDLR   G   Q+  + A+LF   G + +  TVG      R         +  PV++L+
Sbjct: 174 ILDLRGAGGEDAQSVADTARLFFPTGASPLVQTVGARDSVRRWDSKVRAVAVDLPVVVLI 233

Query: 636 NKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMD 457
           +K T + +E +A  L    RA ++G RT G  L    F L  G+ V +  G++ T +   
Sbjct: 234 DKKTRAGAEALAAQLGRTGRAQVLGTRTAGSDLFSESFALPSGAAVRLVTGRWRTGDGRG 293

Query: 456 INGNGIEP 433
           +   G+EP
Sbjct: 294 L-AEGVEP 300



>gb:AE012556_284361 Xylella fastidiosa Temecula1, section 4 of 9 of
           the complete genome.>gb:AE009442_960937 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 394

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 38/142 (26%), Positives = 67/142 (47%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVI 646
           A++ VLDLRDN GG   A  ++   FL  G  +   + R  +     V         P+ 
Sbjct: 233 ATAIVLDLRDNTGGSSIAVPKLLAGFLASGTRIATEI-RGKKTNEINVPTGYTPTDKPMA 291

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +L+   +AS +E+ A  L  + RA + G ++ G+ L+  F++L DGS + +     + P 
Sbjct: 292 VLIGLVSASGAEVTARTLQFHRRARIYGAQSSGQVLMSRFYKLTDGSYIQIPHANLLDPA 351

Query: 465 HMDINGNGIEPDFRNLPAWNEV 400
              +   G+ PD +     ++V
Sbjct: 352 GKPLEWYGVMPDVKKWKTLSDV 373



>pir|F82630|F82630 hypothetical protein XF1854 [imported] - Xylella
           fastidiosa  (strain 9a5c)>gb:AE004006_49489 Xylella
           fastidiosa 9a5c, section 152 of 229 of the complete
           genome.>gb:AE003849_1116699 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 532

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 36/142 (25%), Positives = 69/142 (48%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVI 646
           A++ VLDLR N GG   AG ++   FL  G  +   +        ++ +   P    P+ 
Sbjct: 371 ATAIVLDLRSNTGGSGIAGEKLLAGFLPSGTRIATEIRGKKTNVINVPSGYTPT-DKPMA 429

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +L++  ++S +E+ A  L  + RA + G ++ G+ L   F++L DG+ + +     + P 
Sbjct: 430 VLISLLSSSGAELAARTLQFHHRARIYGAQSSGQLLASRFYKLTDGTYMQIADTNLLDPA 489

Query: 465 HMDINGNGIEPDFRNLPAWNEV 400
              +   G+ PD +   A ++V
Sbjct: 490 GKPLEWYGVMPDVKKWKALSDV 511



>gb:AE012556_284360 Xylella fastidiosa Temecula1, section 4 of 9 of
           the complete genome.>gb:AE009442_960936 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 373

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 37/142 (26%), Positives = 67/142 (47%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPPLITTPVI 646
           A++ +LDLR N GG   AG ++   FL  G  +   +        ++ A   P    P  
Sbjct: 212 ATAILLDLRYNTGGSGIAGEKLLAGFLASGTRIATEIRGKKTNEINVPAGYTPT-DKPTA 270

Query: 645 ILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPN 466
           +L++  +AS +E+ A  L  + RA + G ++ G+ L   F++L DG+ + +     + P 
Sbjct: 271 VLISLLSASGAELAARTLQFHHRARIYGAQSSGQVLTSRFYKLTDGTYMQIADTNLLDPA 330

Query: 465 HMDINGNGIEPDFRNLPAWNEV 400
              I   G+ PD +     ++V
Sbjct: 331 GKPIEWYGVMPDVKKWKTLSDV 352



>gb:NMY14299_155995 Neisseria meningitidis uvrB gene.
          Length = 164

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 24/53 (45%), Positives = 33/53 (62%)
 Frame = -1

Query: 588 DNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTPNHMDINGNGIEPD 430
           D+ RAV+VG +++GKG +Q+   L +GS V +T   Y TPN   I   GI PD
Sbjct: 1   DHKRAVIVGTQSFGKGSVQTLIPLSNGSAVKLTTALYYTPNDRSIQAQGIVPD 53



>gb:CR543861_102573 Acinetobacter sp. ADP1 complete genome.
          Length = 727

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 35/148 (23%), Positives = 60/148 (40%)
 Frame = -1

Query: 846 EATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTYTVGRDPQYTRSIVAEAPP 667
           +A +       ++DLR+N GG ++    +    +  G  V    G               
Sbjct: 428 KALSAKNVEGIIIDLRNNPGGSLEEVARMLGQVIKSGPVVQIRDGNGNVSVFEDNDGGAQ 487

Query: 666 LITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTI 487
               P+ +L+N  +ASASEI + A+ D  R V++G  T GKG  Q   +        +T 
Sbjct: 488 TYAGPLAVLINLASASASEIYSAAIQDYERGVVIGSTTTGKGTAQVQLDSLAYGQATLTQ 547

Query: 486 GKYVTPNHMDINGNGIEPDFRNLPAWNE 403
            K+           G+ PD + +  ++E
Sbjct: 548 RKFYRVTGGSTQNKGVIPDVKLVDIYDE 575



>pir|AC2317|AC2317 hypothetical protein all4090 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_685079 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 374

 Score = 50.1 bits (118), Expect = 6e-05
 Identities = 37/138 (26%), Positives = 64/138 (46%), Gaps = 1/138 (0%)
 Frame = -1

Query: 825 ASSFVLDLRDNXGGLVQAGVEIAKLFL-NEGETVTYTVGRDPQYTRSIVAEAPPLITTPV 649
           A   +LDLRD  GG     +    +F   +  +VT+      +YT +   + P      V
Sbjct: 223 ADGLILDLRDGWGG---GDISYLNIFTAKQSPSVTHVQRNGRRYTYNYQWKKP------V 273

Query: 648 IILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGLIQSFFELQDGSGVVVTIGKYVTP 469
           ++LVN+ + S+ EI+A     N    ++G +T G  +    + +QDGS + V +      
Sbjct: 274 VMLVNEGSRSSKEILAFNFQQNQIGPVLGTKTTGAVVAGRPYIMQDGSLLYVAVADVFLN 333

Query: 468 NHMDINGNGIEPDFRNLP 415
            +  + G G+ PD  N+P
Sbjct: 334 GNQRLEGKGVTPDI-NVP 350



>gb:AB032855_2044844 Apodemus argenteus irbp gene for
           interphotoreceptor retinoid binding protein, partial
           cds, isolate:HS361/KT2944.
          Length = 384

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 35/105 (33%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +LN G TV +  T+   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLNPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGD 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L +++T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSRHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AY326093_2083571 Mastomys natalensis interphotoreceptor
           retinoid-binding protein (IRBP) gene, partial cds.
          Length = 411

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +LN G TV +  T+   P  T + +   P ++  
Sbjct: 117 GTSSLVLDLRHCAGGHV-SGIPYVISYLNPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGE 175

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 176 RYSAXKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 220



>gb:AY227616_2080022 Sciurillus pusillus kuhlii isolate Spu3
           interphotoreceptor binding protein (IRBP) gene, partial
           cds.
          Length = 393

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 47/172 (27%), Positives = 77/172 (44%), Gaps = 12/172 (6%)
 Frame = -1

Query: 864 GFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTR 691
           GF   +  +   G S+ VLDLR   GG + +G+     +LN G TV +  T+   P  T 
Sbjct: 108 GFLVVHMWSKLMGTSALVLDLRYCTGGHI-SGIPYVISYLNPGNTVLHVDTIYNRPSNTT 166

Query: 690 SIVAEAPPLI------TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL-IQ 532
           + +   P ++         V++L +  T   +E +A  L    RA++VG+RT G  L +Q
Sbjct: 167 TEIWTLPQVLGERYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQ 226

Query: 531 SFFELQDGSGVVVTIGKYVTP---NHMDINGNGIEPDFRNLPAWNEVSKHLS 385
                Q    + V + + + P         G+G+ P  R  PA   + K L+
Sbjct: 227 KLRIGQSNFFLTVPVSRSLGPLGGGSQTWEGSGVLPCVRT-PAEQALEKALA 277



>gb:AY163591_2077337 Mesocricetus auratus interphotoreceptor
           retinoid binding protein (Rbp3) gene, exon 1 and partial
           cds.
          Length = 396

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG + +G+     +L+ G TVT+  T+   P  T + +   P ++  
Sbjct: 118 GTSSLVLDLRHCTGGHI-SGIPYVISYLHPGNTVTHVDTIYDRPSNTTTEIWTLPKILGE 176

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L +  T   +E +A  L    RA++VG+RT G  L
Sbjct: 177 RYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGAL 221



>gb:AB164047_2049514 Mesocricetus auratus irbp gene for
           interphotoreceptor retinoid binding protein, partial
           cds.
          Length = 529

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG + +G+     +L+ G TVT+  T+   P  T + +   P ++  
Sbjct: 92  GTSSLVLDLRHCTGGHI-SGIPYVISYLHPGNTVTHVDTIYDRPSNTTTEIWTLPKILGE 150

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L +  T   +E +A  L    RA++VG+RT G  L
Sbjct: 151 RYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGAL 195



>gb:AB096854_2048195 Apodemus wardi irbp gene for interphotoreceptor
           retinoid binding protein, isolate:HS1307.
          Length = 384

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 46/160 (28%), Positives = 74/160 (46%), Gaps = 12/160 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  T+   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL-IQSFFELQDGSGVV 496
                  V++L + +T   +E +A  L    RA++VG+RT G  L +Q     Q    + 
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAXILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLT 209

Query: 495 VTIGKYVTP---NHMDINGNGIEPDFRNLPAWNEVSKHLS 385
           V + + + P         G+G+ P  R  PA   + K L+
Sbjct: 210 VPVSRSLGPLGGGGQTWEGSGVLPCVRT-PAEQALEKALA 248



>gb:AF025390_1411928 Erinaceus europaeus interphotoreceptor retinoid
           binding protein gene, partial cds.
          Length = 303

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 8/117 (6%)
 Frame = -1

Query: 864 GFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTR 691
           GF   +  T   G S+ VLDLR   GG V +GV     +L+ G TV +  T+   P  T 
Sbjct: 53  GFLAASVWTKLMGTSALVLDLRHCTGGHV-SGVPYLVSYLHSGNTVLHVDTIYDRPSNTT 111

Query: 690 SIVAEAPPL------ITTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
           + +   P +          V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 112 TEIWTLPQIPGERYSADKDVVVLTSSHTGGVAEDIAYILKQMRRAIVVGERTVGGAL 168



>gb:AB125811_2048909 Mus terricolor irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS1468.
          Length = 384

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHXAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADXDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB032863_2044852 Apodemus sylvaticus irbp gene for
           interphotoreceptor retinoid binding protein, partial
           cds.
          Length = 384

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 47/160 (29%), Positives = 74/160 (46%), Gaps = 12/160 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  T+   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCTGGHV-SGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL-IQSFFELQDGSGVV 496
                  V+IL + +T   +E +A  L    RA++VG+RT G  L +Q     Q    + 
Sbjct: 150 RYSADKDVVILTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLT 209

Query: 495 VTIGKYVTP---NHMDINGNGIEPDFRNLPAWNEVSKHLS 385
           V + + + P         G+G+ P  R  PA   + K L+
Sbjct: 210 VPVSRSLGPLGGGGQTWEGSGVLPCVRT-PAEQALEKALA 248



>gb:AB125803_2048901 Mus cookii irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2922.
          Length = 384

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVXDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB096853_2048194 Apodemus uralensis irbp gene for
           interphotoreceptor retinoid binding protein,
           isolate:KT3140/HS1744.
          Length = 384

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 46/160 (28%), Positives = 74/160 (46%), Gaps = 12/160 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  T+   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL-IQSFFELQDGSGVV 496
                  V++L + +T   +E +A  L    RA++VG+RT G  L +Q     Q    + 
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLT 209

Query: 495 VTIGKYVTP---NHMDINGNGIEPDFRNLPAWNEVSKHLS 385
           V + + + P         G+G+ P  R  PA   + K L+
Sbjct: 210 VPVSRSLGPLGGGGQTWEGSGVLPCVRT-PAEQALEKALA 248



>gb:AB032861_2044850 Apodemus alpicola irbp gene for
           interphotoreceptor retinoid binding protein, partial
           cds, isolate:HS596.
          Length = 384

 Score = 47.0 bits (110), Expect = 5e-04
 Identities = 46/160 (28%), Positives = 74/160 (46%), Gaps = 12/160 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  T+   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCTGGHV-SGIPYVISYLHPGNTVMHVDTIYDRPSNTTTEIWTLPKVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL-IQSFFELQDGSGVV 496
                  V++L + +T   +E +A  L    RA++VG+RT G  L +Q     Q    + 
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRIGQSNFFLT 209

Query: 495 VTIGKYVTP---NHMDINGNGIEPDFRNLPAWNEVSKHLS 385
           V + + + P         G+G+ P  R  PA   + K L+
Sbjct: 210 VPVSRSLGPLGGGGQTWEGSGVLPCVRT-PAEQALEKALA 248



>gb:AY227607_2080013 Ratufa affinis isolate Raf interphotoreceptor
           binding protein (IRBP) gene, partial cds.
          Length = 393

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 35/117 (29%), Positives = 56/117 (47%), Gaps = 8/117 (6%)
 Frame = -1

Query: 864 GFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTR 691
           GF   +  +   G S+ VLDLR   GG + +G+     +LN G TV +  T+   P  T 
Sbjct: 108 GFLVAHMWSKLMGTSALVLDLRHCTGGHI-SGIPYVISYLNPGNTVLHVDTIYDRPSNTT 166

Query: 690 SIVAEAPPLI------TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
           + +   P ++         V++L +  T   +E +A  L    RA++VG+RT G  L
Sbjct: 167 TEIWTLPEVLGERYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGAL 223



>gb:TSP427231_2140125 Tachyoryctes sp. partial irbp gene for
           interphotoreceptor retinoid binding protein, exon 1.
          Length = 424

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 8/117 (6%)
 Frame = -1

Query: 864 GFSYCNEATARXGASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTR 691
           GF   +  T   G S+ VLDLR   GG V +G+     +L+ G TV +  T+   P  T 
Sbjct: 108 GFLVAHVWTQLMGTSALVLDLRHCMGGHV-SGIPYVISYLHPGNTVMHVDTIYDRPSNTT 166

Query: 690 SIVAEAPPLI------TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
           + +   P ++         V++L +  T   +E +A  L    RA++VG+RT G  L
Sbjct: 167 TEIWTLPKVLGERYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGAL 223



>gb:AY326103_2083581 Phloeomys cumingi interphotoreceptor
           retinoid-binding protein (IRBP) gene, partial cds.
          Length = 411

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  T+   P  T + +   P ++  
Sbjct: 117 GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVVHVDTIYDRPSNTTTEIWTLPKVLGD 175

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 176 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 220



>gb:AY326088_2083566 Hylomyscus denniae interphotoreceptor
           retinoid-binding protein (IRBP) gene, partial cds.
          Length = 409

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  T+   P  T + +   P ++  
Sbjct: 117 GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVXHVDTIYDRPSNTTTEIWTLPKVLGE 175

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 176 RYSAEKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 220



>gb:AY227592_2079998 Protoxerus stangeri isolate Pst1
           interphotoreceptor binding protein (IRBP) gene, partial
           cds.
          Length = 392

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G S+ VLDLR   GG + +G+     +LN G TV +  T+   P  T + +   P ++  
Sbjct: 120 GTSALVLDLRHCTGGHI-SGIPYIISYLNPGNTVLHVDTIYDRPSNTTTEIWTLPEVLGE 178

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L +  T   +E +A  L    RA++VG+RT G  L
Sbjct: 179 RYSADKDVVVLTSSRTGGVAEDIAYILKQMRRAIVVGERTEGGAL 223



>gb:AY227589_2079995 Epixerus wilsoni isolate Ewi interphotoreceptor
           binding protein (IRBP) gene, partial cds.
          Length = 409

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G S+ VLDLR   GG + +G+     +LN G TV +  T+   P  T + +   P ++  
Sbjct: 137 GTSALVLDLRHCTGGHI-SGIPYIISYLNPGNTVLHVDTIYDRPSNTTTEIWTLPEVLGE 195

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L +  T   +E +A  L    RA++VG+RT G  L
Sbjct: 196 RYSADKDVVVLTSSRTGGVAEDIAYILKQMRRAIVVGERTEGGAL 240



>gb:AY227586_2079992 Spermophilus lateralis isolate Sla1
           interphotoreceptor binding protein (IRBP) gene, partial
           cds.
          Length = 393

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 45/160 (28%), Positives = 72/160 (45%), Gaps = 12/160 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G S+ VLDLR   GG + +G+     +LN G TV +  T+   P  T + +   P ++  
Sbjct: 120 GTSALVLDLRHCTGGHI-SGIPYIISYLNPGNTVLHVDTIYDRPSNTTTEIWTLPEVLGE 178

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL-IQSFFELQDGSGVV 496
                  V++L +  T   +E +A  L    RA++VG+RT G  L +Q     Q    + 
Sbjct: 179 RYSADKDVVVLTSGRTGGVAEDIAYILKQMRRAIVVGERTEGGALDLQKLRVGQSNFFLT 238

Query: 495 VTIGKYVTP---NHMDINGNGIEPDFRNLPAWNEVSKHLS 385
           V + + + P         G+G+ P     PA   + K LS
Sbjct: 239 VPVSRSLGPLGGGSQTWEGSGVLPCV-GTPAEQALEKALS 277



>gb:AB125816_2048914 Mus platythrix irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS628.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB125813_2048911 Mus fragilicauda irbp gene for
           interphotoreceptor retinoid-binding protein, partial
           cds, isolate:HS2952.>gb:AB125814_2048912 Mus
           fragilicauda irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2994.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB125804_2048902 Mus cookii irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2950.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB125802_2048900 Mus cookii irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2921.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB125801_2048899 Mus cervicolor irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2965.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB125800_2048898 Mus cervicolor irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2964.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB125799_2048897 Mus cervicolor irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2926.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCAGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194



>gb:AB125798_2048896 Mus caroli irbp gene for interphotoreceptor
           retinoid-binding protein, partial cds, isolate:HS2961.
          Length = 384

 Score = 46.2 bits (108), Expect = 8e-04
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)
 Frame = -1

Query: 828 GASSFVLDLRDNXGGLVQAGVEIAKLFLNEGETVTY--TVGRDPQYTRSIVAEAPPLI-- 661
           G SS VLDLR   GG V +G+     +L+ G TV +  TV   P  T + +   P ++  
Sbjct: 91  GTSSLVLDLRHCTGGHV-SGIPYVISYLHPGNTVMHVDTVYDRPSNTTTEIWTLPEVLGE 149

Query: 660 ----TTPVIILVNKNTASASEIVATALHDNCRAVLVGDRTYGKGL 538
                  V++L + +T   +E +A  L    RA++VG+RT G  L
Sbjct: 150 RYSADKDVVVLTSGHTGGVAEDIAYILKQMRRAIVVGERTEGGAL 194


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,023,053,763
Number of Sequences: 1806583
Number of extensions: 23972019
Number of successful extensions: 57479
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 54472
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56874
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 61559089476
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)