BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13033
         (813 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|E96791|E96791 hypothetical protein F15M4.11 [imported] - Ara...   208   9e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AE005172_891034 Arabidopsis thaliana chromosome 1, top arm co...   204   2e-51   
gb:AC133859_1741530 Oryza sativa chromosome 3 BAC OSJNBa0075A22 ...   168   1e-40   
pir|A96714|A96714 hypothetical protein T6L1.12 [imported] - Arab...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP003044_1824349 Oryza sativa (japonica cultivar-group) genom...    99   9e-20   
gb:AP005284_1849815 Oryza sativa (japonica cultivar-group) genom...    95   2e-18   
gb:AF383149_1793879 Nicotiana tabacum armadillo repeat-containin...    65   2e-09   
gb:AP003259_1826538 Oryza sativa (japonica cultivar-group) genom...    57   3e-07   
gb:XLA557449_2582626 Xenopus laevis mRNA for importin alpha 5.2 ...    42   0.011   
gb:XLA557448_2582625 Xenopus laevis mRNA for importin alpha 5.1 ...    42   0.011   
gb:BC047409_1983854 Homo sapiens karyopherin alpha 5 (importin a...    42   0.011   
sp|O15131|IMA5_HUMAN|IMA5_HUMAN Importin alpha-6 subunit (Karyopherin alpha...    42   0.011   Homo sapiens [man]
gb:BC080896_2561811 Xenopus tropicalis kpna6-prov protein, mRNA ...    41   0.031   
gb:BC072048_2556313 Xenopus laevis cDNA clone MGC:78911 IMAGE:41...    41   0.031   
gb:AK046371_1167741 Mus musculus adult male corpora quadrigemina...    41   0.031   
sp|O35345|IMA7_MOUSE|IMA7_MOUSE Importin alpha-7 subunit (Karyopherin alpha...    41   0.031   Mus musculus [mouse]
gb:AJ720294_2502481 Gallus gallus mRNA for hypothetical protein,...    40   0.040   
gb:HSDJ622L5_2012304 Human DNA sequence from clone RP4-622L5 on ...    40   0.040   
gb:AX878192_1477338 Sequence 13097 from Patent EP1074617.              40   0.040   
sp|O60684|IMA7_HUMAN|IMA7_HUMAN Importin alpha-7 subunit (Karyopherin alpha...    40   0.040   Homo sapiens [man]
gb:BC063215_2553487 Xenopus tropicalis hypothetical protein MGC7...    40   0.068   
gb:BT007657_2150589 Synthetic construct Homo sapiens karyopherin...    39   0.089   
gb:AX021836_1456647 Sequence 10 from Patent EP0861322.                 39   0.089   
gb:AY010066_1423513 Sus scrofa karyopherin alpha 1 (Kpna1) mRNA,...    39   0.089   
pir|I59931|I59931 nucleoprotein interactor 1 - human>gb:S75295_2...    39   0.089   Homo sapiens [man]
sp|P52294|IMA1_HUMAN|IMA1_HUMAN Importin alpha-1 subunit (Karyopherin alpha...    39   0.089   Homo sapiens [man]
sp|Q02821|IMA1_YEAST|IMA1_YEAST Importin alpha subunit (Karyopherin alpha s...    39   0.12    Saccharomyces cerevisiae [brewer's yeast]
gb:MMU34228_2120893 Mus musculus SRP1 mRNA, complete cds.              39   0.15    
gb:AE016959_1023499 Oryza sativa (japonica cultivar-group) chrom...    39   0.15    
sp|P83953|IMA1_RAT|IMA1_RAT Importin alpha-1 subunit (Karyopherin alpha-1...    39   0.15    Rattus norvegicus [brown rat]
sp|Q60960|IMA1_MOUSE|IMA1_MOUSE Importin alpha-1 subunit (Karyopherin alpha...    39   0.15    Mus musculus [mouse]
gb:NC3H10_1688516 Neurospora crassa DNA linkage group V Cosmid c...    38   0.20    
gb:AJ719373_2501560 Gallus gallus mRNA for hypothetical protein,...    38   0.26    
gb:AE016815_1746085 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.34    
gb:HUMTRIP4M_2037877 Homo sapiens thyroid receptor interactor (T...    37   0.44    
gb:BC012448_1973616 Homo sapiens thyroid hormone receptor intera...    37   0.44    
sp|Q15650|TRI4_HUMAN|TRI4_HUMAN Activating signal cointegrator 1 (ASC-1) (T...    37   0.44    Homo sapiens [man]
gb:AE017344_1756435 Cryptococcus neoformans var. neoformans JEC2...    35   1.3     
gb:BX251411_764504 Tropheryma whipplei TW08/27, complete genome;...    34   2.9     
gb:CR380956_1652487 Candida glabrata strain CBS138 chromosome J ...    34   3.8     
gb:BC045358_2549200 Danio rerio karyopherin alpha 4 (importin al...    33   4.9     
gb:AY577009_2538253 Danio rerio clone RZ151A3F12 karyopherin alp...    33   4.9     
gb:AJ719777_2501964 Gallus gallus mRNA for hypothetical protein,...    33   4.9     
gb:CR382124_1656708 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   4.9     
gb:AE016851_348986 Tropheryma whipplei str. Twist, section 2 of ...    33   4.9     
gb:HSSRP11_2020521 H.sapiens mRNA for SRP1-like protein, partial.      33   8.4     
gb:CR382139_1672004 Debaryomyces hansenii chromosome G of strain...    33   8.4     
gb:CR857290_1181534 Pongo pygmaeus mRNA; cDNA DKFZp469L0521 (fro...    33   8.4     
gb:AE013435_292312 Methanosarcina mazei strain Goe1, section 217...    33   8.4     
pir|T39506|T39506 importin alpha subunit - fission yeast (Schizo...    33   8.4     Schizosaccharomyces pombe
sp|O35343|IMA4_MOUSE|IMA4_MOUSE Importin alpha-4 subunit (Karyopherin alpha...    33   8.4     Mus musculus [mouse]
sp|O00629|IMA4_HUMAN|IMA4_HUMAN Importin alpha-4 subunit (Karyopherin alpha...    33   8.4     Homo sapiens [man]


>pir|E96791|E96791 hypothetical protein F15M4.11 [imported] -
            Arabidopsis thaliana>gb:AE005173_895170 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC012394_1537625 Arabidopsis thaliana
            chromosome 1 BAC F15M4 genomic sequence, complete
            sequence.
          Length = 811

 Score =  208 bits (530), Expect = 9e-53
 Identities = 97/160 (60%), Positives = 129/160 (80%)
 Frame = -1

Query: 795  CLSQPPSITGLCKVHRGTCSLKETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLD 616
            CLS+PP + G+CK+H+G CS++E+FCL+EGQAV++LV LLDH  +KVV          L+
Sbjct: 652  CLSKPPVVLGICKIHQGICSVRESFCLVEGQAVDKLVDLLDHENDKVVGPALAALSTLLE 711

Query: 615  DGVDIEQGVQVLCEAEGIKPILQILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNV 436
            DG+D+ QGV+++ EA+GI PIL +LLE RTENLR RAVW  ER+LR ++IA EV  + NV
Sbjct: 712  DGLDVVQGVRLIDEADGITPILNVLLENRTENLRIRAVWMVERILRIEEIAREVGEEQNV 771

Query: 435  STALVDAFQHADYRTRQIAERALKHVDKIPNFSGVFPNMG 316
            + ALVDAFQ+AD+RTRQIAE+AL+H+DKIPNFSG+F N+G
Sbjct: 772  TAALVDAFQNADFRTRQIAEKALRHIDKIPNFSGIFTNIG 811



>gb:AE005172_891034 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC069251_1540738 Genomic sequence
            for Arabidopsis thaliana BAC F2D10 from chromosome I,
            complete sequence.
          Length = 801

 Score =  204 bits (518), Expect = 2e-51
 Identities = 97/159 (61%), Positives = 125/159 (78%)
 Frame = -1

Query: 795  CLSQPPSITGLCKVHRGTCSLKETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLD 616
            C+ +P  + GLCK+H+G CSL+ETFCL+EG AVE+LVALLDH   KVVE         L+
Sbjct: 642  CVRKPHVVNGLCKIHQGICSLRETFCLVEGGAVEKLVALLDHENVKVVEAALAALSSLLE 701

Query: 615  DGVDIEQGVQVLCEAEGIKPILQILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNV 436
            DG+D+E+GV++L EA+GI+ IL +L E RTE L RRAVW  ER+LR +DIA EV+ + ++
Sbjct: 702  DGLDVEKGVKILDEADGIRHILNVLRENRTERLTRRAVWMVERILRIEDIAREVAEEQSL 761

Query: 435  STALVDAFQHADYRTRQIAERALKHVDKIPNFSGVFPNM 319
            S ALVDAFQ+AD+RTRQIAE ALKH+DKIPNFS +FPN+
Sbjct: 762  SAALVDAFQNADFRTRQIAENALKHIDKIPNFSSIFPNI 800



>gb:AC133859_1741530 Oryza sativa chromosome 3 BAC OSJNBa0075A22
            genomic sequence, complete sequence.
          Length = 852

 Score =  168 bits (425), Expect = 1e-40
 Identities = 85/163 (52%), Positives = 116/163 (71%), Gaps = 7/163 (4%)
 Frame = -1

Query: 795  CLSQPPSIT----GLCKVHRGTCSLKETFCLLE---GQAVEELVALLDHTKEKVVEXXXX 637
            CL + P+      G+C+VH G CSL+ETFCL +   G+AVE LVA LDH   +VVE    
Sbjct: 685  CLGRRPAAAAVPAGVCRVHGGFCSLRETFCLAQADGGKAVERLVACLDHLDGRVVEAALA 744

Query: 636  XXXXXLDDGVDIEQGVQVLCEAEGIKPILQILLEKRTENLRRRAVWAAERLLRTDDIAYE 457
                 + DGVD  +GV VL EA+G++P++ I++E RTE L+RRAVWA ER+LR ++IA E
Sbjct: 745  ALSTLVCDGVDAREGVVVLGEADGLRPVVDIMVESRTEALQRRAVWAVERILRVEEIAGE 804

Query: 456  VSGDPNVSTALVDAFQHADYRTRQIAERALKHVDKIPNFSGVF 328
            V+ D  V++ALV+A+++ D RTRQ AERAL+H+D+IPNFS  F
Sbjct: 805  VAADQTVASALVEAYRNGDPRTRQTAERALRHLDRIPNFSAAF 847



>pir|A96714|A96714 hypothetical protein T6L1.12 [imported] -
            Arabidopsis thaliana>gb:AE005173_894510 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC011665_1537343 Arabidopsis thaliana
            chromosome 1 BAC T6L1 genomic sequence, complete
            sequence.
          Length = 1033

 Score =  107 bits (267), Expect = 3e-22
 Identities = 56/145 (38%), Positives = 85/145 (58%), Gaps = 2/145 (1%)
 Frame = -1

Query: 765  LCKVHRGTCSLKETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQ 586
            +C +HRG CS K TFCL+E  A+ +L+A L   K +VVE         LDD V++E+ + 
Sbjct: 885  ICAIHRGVCSAKNTFCLVEANAITKLLACLQSDKVEVVESALAAICTLLDDKVEVEKSLS 944

Query: 585  VLCEAEGIKPILQILLEKRTENLRRRAVWAAERLL--RTDDIAYEVSGDPNVSTALVDAF 412
            +L E   ++ IL  + E + E+L ++A W  ++ +    D  A E+S D  +S  LV AF
Sbjct: 945  MLSEMNAVQLILNAVKEHKKESLLQKAFWMIDKFIIRGGDKYASEISQDRMLSGMLVSAF 1004

Query: 411  QHADYRTRQIAERALKHVDKIPNFS 337
               D  TRQ+AE  L+ +DK+P+FS
Sbjct: 1005 HRGDGNTRQMAENILRRLDKMPSFS 1029



>gb:AP003044_1824349 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0038C05.
          Length = 973

 Score = 99.0 bits (245), Expect = 9e-20
 Identities = 58/161 (36%), Positives = 87/161 (54%), Gaps = 9/161 (5%)
 Frame = -1

Query: 783  PPSITGLCKVHRGTCSLKETFCLLEGQAVEELVALLDHTKE-KVVEXXXXXXXXXLDDGV 607
            PP+   LC VHRG CS   TFCL E  AVE LV +L+  +  +VV+         +DD V
Sbjct: 808  PPAQGRLCPVHRGVCSPATTFCLAEAGAVEALVGVLESNENGRVVDAVLGALCTLMDDAV 867

Query: 606  DIEQGVQVLCEAEGIKPILQILLEKRTEN------LRRRAVWAAERLLR--TDDIAYEVS 451
            D+E+GV VL E +  + +L+ L + R         + RR  WA ER L    +    +V+
Sbjct: 868  DVERGVAVLAEHDAARHVLRALRQHRDVGGDTAGAVSRRCFWAVERFLAHGGERCVRDVT 927

Query: 450  GDPNVSTALVDAFQHADYRTRQIAERALKHVDKIPNFSGVF 328
             D  + +ALV AF   D  T+Q+AE  L+ + ++P++S  +
Sbjct: 928  ADRALPSALVSAFHKGDAATKQVAESVLRSLHRMPDYSATY 968



>gb:AP005284_1849815 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1121A12.
          Length = 973

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 55/148 (37%), Positives = 80/148 (54%), Gaps = 2/148 (1%)
 Frame = -1

Query: 765  LCKVHRGTCSLKETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQ 586
            +C VHRG C+   TFCLLE  AVE L+A L++   +VV+         +DD VD+E+ V 
Sbjct: 821  VCPVHRGVCTPATTFCLLEAGAVEGLLACLENDDARVVDAALGALCTLVDDRVDVEKAVV 880

Query: 585  VLCEAEGIKPILQILLEKRTENLRRRAVWAAERLL-RTDDIAY-EVSGDPNVSTALVDAF 412
             L      + +L  L + R  +L  R     E+LL   DD+   EV+GD  + TALV AF
Sbjct: 881  ALAGQGAARRVLAALRQHRGNSLWHRCFSVVEKLLVHGDDVCVREVTGDRMLPTALVSAF 940

Query: 411  QHADYRTRQIAERALKHVDKIPNFSGVF 328
               D   +Q AE  L+ + K+P++S  +
Sbjct: 941  HRGDANAKQAAESILRRLHKMPDYSATY 968



>gb:AF383149_1793879 Nicotiana tabacum armadillo repeat-containing
           protein (HBP2) mRNA, partial cds.
          Length = 502

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 45/158 (28%), Positives = 76/158 (48%)
 Frame = -1

Query: 801 SPCLSQPPSITGLCKVHRGTCSLKETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXX 622
           S C++ P   T  C VH G CS++ TFCL+E  A+  L  +LD       E         
Sbjct: 352 SCCIASP---THGCPVHLGICSVESTFCLVEANALRPLAEVLDDPDPAASEASLDAILTI 408

Query: 621 LDDGVDIEQGVQVLCEAEGIKPILQILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDP 442
           + +G  ++ G ++L EA  I PI++ LL   +  L+ +A+ A ER+ R  ++  +     
Sbjct: 409 I-EGAQLQNGSKLLAEANAIAPIIK-LLSSSSIVLQEKALKALERIFRMIEMKQKYG--I 464

Query: 441 NVSTALVDAFQHADYRTRQIAERALKHVDKIPNFSGVF 328
           +    LV+  Q      + +A + L H++ +P  S  F
Sbjct: 465 SAQMPLVEITQKGRNDMKSLAAKVLAHLNVLPEQSSFF 502



>gb:AP003259_1826538 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0466H10.
          Length = 672

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 38/151 (25%), Positives = 67/151 (44%)
 Frame = -1

Query: 780 PSITGLCKVHRGTCSLKETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDI 601
           PS    C VH   C++K TFCL++  AV  L+ +L+    +            + D +  
Sbjct: 526 PSAETYCLVHNSQCTVKSTFCLVKAGAVSPLIQILEDDNREADGAVLEALATLMQDEI-W 584

Query: 600 EQGVQVLCEAEGIKPILQILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALV 421
           E G +V+ +A G+  +L+I  E      + +A+W  ER+ R +  A+           L+
Sbjct: 585 ENGSKVIEKASGVHALLRI-AEAGNSTSQEKAIWMLERIFRLE--AHRERYGEIAQALLI 641

Query: 420 DAFQHADYRTRQIAERALKHVDKIPNFSGVF 328
           D  Q  D   + +  + L H++ +   S  F
Sbjct: 642 DLAQKGDPILKPMIGKILAHLELLQTQSSYF 672



>gb:XLA557449_2582626 Xenopus laevis mRNA for importin alpha 5.2
           protein (imp alpha 5 gene).
          Length = 537

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 32/117 (27%), Positives = 51/117 (43%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 291 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 346

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +V  D N+   L++  Q A++RTR+ A  A+
Sbjct: 347 SSPKESIRKEACWTISNITAGNRGQIQVVADANIFPVLIEILQKAEFRTRKEAAWAI 403



>gb:XLA557448_2582625 Xenopus laevis mRNA for importin alpha 5.1
           protein (imp alpha 5 gene).
          Length = 537

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 32/117 (27%), Positives = 51/117 (43%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 291 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 346

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +V  D N+   L++  Q A++RTR+ A  A+
Sbjct: 347 SSPKESIRKEACWTISNITAGNRGQIQVVADANIFPVLIEILQKAEFRTRKEAAWAI 403



>gb:BC047409_1983854 Homo sapiens karyopherin alpha 5 (importin
           alpha 6), mRNA (cDNA clone MGC:51011 IMAGE:5297277),
           complete cds.>gb:HSDJ412I7_2012094 Human DNA sequence
           from clone RP3-412I7 on chromosome 6q22.1-22.33 Contains
           a gene similar to murine radial spokehead-like 1, a
           novel gene, the KPNA5 gene for karyopherin alpha 5
           (importin alpha 6) and a CpG island, complete sequence.
          Length = 539

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 32/117 (27%), Positives = 51/117 (43%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+  V + C A    P L  LL
Sbjct: 293 VIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 349 SSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 405



>sp|O15131|IMA5_HUMAN Importin alpha-6 subunit (Karyopherin alpha-5
           subunit).>gb:HUMIMPA6_2033750 Homo sapiens importin
           alpha 6 mRNA, complete cds.
          Length = 536

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 32/117 (27%), Positives = 51/117 (43%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+  V + C A    P L  LL
Sbjct: 290 VIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 345

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 346 SSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 402



>gb:BC080896_2561811 Xenopus tropicalis kpna6-prov protein, mRNA
           (cDNA clone MGC:79508 IMAGE:6977195), complete cds.
          Length = 534

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 288 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 343

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 344 SSPKESIRKEACWTISNITAGNRGQIQAVADANIFPVLIEILQKAEFRTRKEAAWAI 400



>gb:BC072048_2556313 Xenopus laevis cDNA clone MGC:78911
           IMAGE:4175643, complete cds.
          Length = 537

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 291 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 346

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 347 SSPKESIRKEACWTISNITAGNRGQIQAVADANIFPVLIEILQKAEFRTRKEAAWAI 403



>gb:AK046371_1167741 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230377C12 product:karyopherin (importin) alpha 6,
           full insert sequence.>gb:AK084212_1174189 Mus musculus
           12 days embryo eyeball cDNA, RIKEN full-length enriched
           library, clone:D230009G09 product:karyopherin (importin)
           alpha 6, full insert sequence.
          Length = 536

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 290 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 345

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 346 SSSKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 402



>sp|O35345|IMA7_MOUSE Importin alpha-7 subunit (Karyopherin alpha-6
           subunit) (Importin alpha S2).>gb:AF020773_2051085 Mus
           musculus importin alpha S2 mRNA, complete
           cds.>gb:BC004833_2089823 Mus musculus karyopherin
           (importin) alpha 6, mRNA (cDNA clone MGC:6524
           IMAGE:2651272), complete cds.
          Length = 533

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 287 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 342

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 343 SSSKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 399



>gb:AJ720294_2502481 Gallus gallus mRNA for hypothetical protein,
           clone 14f8.
          Length = 533

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 288 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 343

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 344 SSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 400



>gb:HSDJ622L5_2012304 Human DNA sequence from clone RP4-622L5 on
           chromosome 1p34.2-36.11 Contains the 3' end of the KPNA6
           gene for karyopherin alpha 6 (importin alpha 7), a novel
           gene (DKFZp451J0118), a novel gene (MGC1203) a novel
           gene, a novel gene (FLJ10547), a novel gene, a novel
           gene, the 5' end of the EIF3S2 gene for eukaryotic
           translation initiation factor 3 subunit 2 beta 36kDa and
           3 CpG islands, complete sequence.
          Length = 321

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 197 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 252

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 253 SSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 309



>gb:AX878192_1477338 Sequence 13097 from Patent EP1074617.
          Length = 536

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 290 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 345

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 346 SSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 402



>sp|O60684|IMA7_HUMAN Importin alpha-7 subunit (Karyopherin
           alpha-6).>gb:CR858533_1182705 Pongo pygmaeus mRNA; cDNA
           DKFZp469C0723 (from clone
           DKFZp469C0723).>gb:AF060543_1879831 Homo sapiens
           importin alpha 7 subunit mRNA, complete
           cds.>gb:AL445248_1927503 Human DNA sequence from clone
           RP11-277A4 on chromosome 1 Contains the 3' end of the
           KHDRBS1 gene for KH domain containing RNA binding signal
           transduction associated 1, a novel gene, a novel gene
           (FLJ10315), the 5' end of the KPNA6 gene for karyopherin
           alpha 6 (importin alpha 7) and a CpG island, complete
           sequence.>gb:BC020520_1977041 Homo sapiens karyopherin
           alpha 6 (importin alpha 7), mRNA (cDNA clone MGC:17918
           IMAGE:3913864), complete cds.>gb:BT009843_1990980 Homo
           sapiens karyopherin alpha 6 (importin alpha 7) mRNA,
           complete cds.>gb:HSDJ622L5_2012303 Human DNA sequence
           from clone RP4-622L5 on chromosome 1p34.2-36.11 Contains
           the 3' end of the KPNA6 gene for karyopherin alpha 6
           (importin alpha 7), a novel gene (DKFZp451J0118), a
           novel gene (MGC1203) a novel gene, a novel gene
           (FLJ10547), a novel gene, a novel gene, the 5' end of
           the EIF3S2 gene for eukaryotic translation initiation
           factor 3 subunit 2 beta 36kDa and 3 CpG islands,
           complete sequence.
          Length = 536

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 31/117 (26%), Positives = 50/117 (42%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KV           +  G DI+  V + C A    P L  LL
Sbjct: 290 VIDSGVCRRLVELLMHNDYKVASPALRAVGNIVT-GDDIQTQVILNCSA---LPCLLHLL 345

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
               E++R+ A W    +   +    +   D N+   L++  Q A++RTR+ A  A+
Sbjct: 346 SSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKEAAWAI 402



>gb:BC063215_2553487 Xenopus tropicalis hypothetical protein
           MGC76184, mRNA (cDNA clone MGC:76184 IMAGE:5335794),
           complete cds.
          Length = 538

 Score = 39.7 bits (91), Expect = 0.068
 Identities = 28/117 (23%), Positives = 55/117 (47%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   + +  +   + N+  AL++  Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRVQIQTVIEANIFPALINILQTAEFRTRKEAAWAI 404



>gb:BT007657_2150589 Synthetic construct Homo sapiens karyopherin
           alpha 1 (importin alpha 5) mRNA, partial cds.
          Length = 539

 Score = 39.3 bits (90), Expect = 0.089
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAI 404



>gb:AX021836_1456647 Sequence 10 from Patent EP0861322.
          Length = 531

 Score = 39.3 bits (90), Expect = 0.089
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAI 404



>gb:AY010066_1423513 Sus scrofa karyopherin alpha 1 (Kpna1) mRNA,
           partial cds.
          Length = 198

 Score = 39.3 bits (90), Expect = 0.089
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 84  VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 140

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 141 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAI 196



>pir|I59931|I59931 nucleoprotein interactor 1 -
           human>gb:S75295_2041480 nucleoprotein interactor 1=SRP1
           homolog [human, cervical carcinoma HeLa cells, mRNA,
           2940 nt].
          Length = 538

 Score = 39.3 bits (90), Expect = 0.089
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAI 404



>sp|P52294|IMA1_HUMAN Importin alpha-1 subunit (Karyopherin alpha-1
           subunit) (SRP1-beta) (RAG cohort protein 2)
           (Nucleoprotein interactor 1)
           (NPI-1).>gb:CR859588_1183696 Pongo pygmaeus mRNA; cDNA
           DKFZp459M124 (from clone
           DKFZp459M124).>gb:BC002374_1968060 Homo sapiens
           karyopherin alpha 1 (importin alpha 5), mRNA (cDNA clone
           MGC:8554 IMAGE:2822859), complete
           cds.>gb:BC003009_1968606 Homo sapiens karyopherin alpha
           1 (importin alpha 5), mRNA (cDNA clone MGC:4009
           IMAGE:2822859), complete cds.>gb:BT006959_1990397 Homo
           sapiens karyopherin alpha 1 (importin alpha 5) mRNA,
           complete cds.>gb:CR456743_1992950 Homo sapiens full open
           reading frame cDNA clone RZPDo834E0214D for gene KPNA1,
           karyopherin alpha 1 (importin alpha 5); complete cds,
           incl. stopcodon.
          Length = 538

 Score = 39.3 bits (90), Expect = 0.089
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAI 404



>sp|Q02821|IMA1_YEAST Importin alpha subunit (Karyopherin alpha
           subunit) (Serine-rich RNA polymerase I suppressor
           protein).>pir|S30884|S30884 SRP1 protein - yeast
           (Saccharomyces cerevisiae)>gb:SCYNL189W_1713792
           S.cerevisiae chromosome XIV reading frame ORF
           YNL189w.>gb:YSCSRP1A_1730671 Saccharomyces cerevisiae
           suppressor of RNA polymerase I mutations (SRP1) gene,
           complete cds.
          Length = 542

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 28/106 (26%), Positives = 51/106 (48%)
 Frame = -1

Query: 696 EELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILLEKRTENL 517
           + LV LL H +  +V+         +  G D++   QV+  A G+ P L++LL    EN+
Sbjct: 302 KRLVELLSH-ESTLVQTPALRAVGNIVTGNDLQ--TQVVINA-GVLPALRLLLSSPKENI 357

Query: 516 RRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIA 379
           ++ A W    +   +    +   D N+   LV   + A+Y+T++ A
Sbjct: 358 KKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEA 403



>gb:MMU34228_2120893 Mus musculus SRP1 mRNA, complete cds.
          Length = 538

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAI 404



>gb:AE016959_1023499 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078894_1541567
           Oryza sativa chromosome 10 BAC OSJNBa0096G08 genomic
           sequence, complete sequence.>gb:AC079029_1541745 Oryza
           sativa chromosome 10 BAC OSJNBb0028C01 genomic sequence,
           complete sequence.>gb:AE017113_1753318 Oryza sativa
           (japonica cultivar-group) chromosome 10, section 67 of
           77 of the complete sequence.
          Length = 575

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 35/118 (29%), Positives = 51/118 (43%)
 Frame = -1

Query: 699 VEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILLEKRTEN 520
           V  LV LL  T  K+ E          + G       + L  +EG  P L  L+E  +  
Sbjct: 212 VAALVQLLTATAPKIREKAATVLCLLAESG-----SCECLLVSEGALPPLIRLVESGSLV 266

Query: 519 LRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERALKHVDKIP 346
            R +AV   +RL  + DIA  + G   V   L+D  Q  D  ++  A  ALK++  +P
Sbjct: 267 GREKAVITLQRLSMSPDIARAIVGHSGV-RPLIDICQTGDSISQSAAAGALKNLSAVP 323



>sp|P83953|IMA1_RAT Importin alpha-1 subunit (Karyopherin alpha-1
           subunit) (Importin alpha 5).>gb:AY351984_2083991 Rattus
           norvegicus karyopherin alpha 1/importin alpha 5 (Kpna1)
           mRNA, complete cds.
          Length = 538

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAI 404



>sp|Q60960|IMA1_MOUSE Importin alpha-1 subunit (Karyopherin alpha-1
           subunit) (SRP1-beta) (RAG cohort protein 2)
           (Nucleoprotein interactor 1) (Importin alpha
           S1).>gb:AK028259_1160890 Mus musculus 12 days embryo
           head cDNA, RIKEN full-length enriched library,
           clone:3010020J22 product:karyopherin (importin) alpha 1,
           full insert sequence.>gb:AK028307_1160915 Mus musculus
           adult male brain cDNA, RIKEN full-length enriched
           library, clone:3526401G09 product:karyopherin (importin)
           alpha 1, full insert sequence.>gb:BC006771_2090378 Mus
           musculus karyopherin (importin) alpha 1, mRNA (cDNA
           clone MGC:6726 IMAGE:3588534), complete cds.
          Length = 538

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 29/117 (24%), Positives = 53/117 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D N+  AL+   Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDANMFPALISILQTAEFRTRKEAAWAI 404



>gb:NC3H10_1688516 Neurospora crassa DNA linkage group V Cosmid
           contig 3H10.
          Length = 548

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 28/113 (24%), Positives = 45/113 (39%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           ++E      LV LL H    V +         +  G D++  V + C   G  P L  LL
Sbjct: 289 VIEAGIPRRLVELLMHASTSV-QTPALRSVGNIVTGDDVQTQVIINC---GALPCLLSLL 344

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIA 379
               + +R+ A W    +   +    +   D N+   L+    HAD +TR+ A
Sbjct: 345 SSNKDGIRKEACWTISNITAGNSAQIQSVIDANIIPPLIHLLSHADLKTRKEA 397



>gb:AJ719373_2501560 Gallus gallus mRNA for hypothetical protein,
           clone 1l14.
          Length = 538

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 28/117 (23%), Positives = 54/117 (46%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++      LV LL H   KVV          +  G DI+   QV+     ++ +L +L 
Sbjct: 292 VIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVT-GDDIQ--TQVILNCSALQSLLHLLS 348

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIAERAL 367
             + E++++ A W    +   +    +   D ++  AL++  Q A++RTR+ A  A+
Sbjct: 349 SPK-ESIKKEACWTISNITAGNRAQIQTVIDAHIFPALINILQTAEFRTRKEAAWAI 404



>gb:AE016815_1746085 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 543

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 25/113 (22%), Positives = 53/113 (46%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++ +  + LV LL H +  +V+         +  G D++  + + C   G+ P L+ LL
Sbjct: 296 VVDARIPKRLVELLTH-QSTLVQTPALRAVGNIVTGNDLQTQIVINC---GVLPALRNLL 351

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIA 379
               +++R+ A W    +   +    +   D N+   LV   + A+Y+T++ A
Sbjct: 352 TSPKDSIRKEACWTISNITAGNTDQIQAVIDANLIPPLVKLLETAEYKTKKEA 404



>gb:HUMTRIP4M_2037877 Homo sapiens thyroid receptor interactor
           (TRIP4) mRNA, 3' end of cds.
          Length = 286

 Score = 37.0 bits (84), Expect = 0.44
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = -1

Query: 588 QVLCEAEGIKPIL---QILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVD 418
           +++CE EG  P L    ++     +++ +R    +++LL+      E SG  ++ST   D
Sbjct: 65  RIVCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKVDISTK--D 122

Query: 417 AFQHADYRTRQIAERALKHVDKIPNF 340
              H + R +   E+A+KH DK+  F
Sbjct: 123 LLPHQELRIKSGLEKAIKHKDKLLEF 148



>gb:BC012448_1973616 Homo sapiens thyroid hormone receptor
           interactor 4, mRNA (cDNA clone MGC:8719 IMAGE:3882630),
           complete cds.
          Length = 581

 Score = 37.0 bits (84), Expect = 0.44
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = -1

Query: 588 QVLCEAEGIKPIL---QILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVD 418
           +++CE EG  P L    ++     +++ +R    +++LL+      E SG  ++ST   D
Sbjct: 189 RIVCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKVDISTK--D 246

Query: 417 AFQHADYRTRQIAERALKHVDKIPNF 340
              H + R +   E+A+KH DK+  F
Sbjct: 247 LLPHQELRIKSGLEKAIKHKDKLLEF 272



>sp|Q15650|TRI4_HUMAN Activating signal cointegrator 1 (ASC-1)
           (Thyroid receptor interacting protein 4)
           (TRIP-4).>gb:AF168418_1887429 Homo sapiens activating
           signal cointegrator 1 mRNA, complete cds.
          Length = 581

 Score = 37.0 bits (84), Expect = 0.44
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = -1

Query: 588 QVLCEAEGIKPIL---QILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVD 418
           +++CE EG  P L    ++     +++ +R    +++LL+      E SG  ++ST   D
Sbjct: 189 RIVCEQEGSGPCLFCGTLVCTHEEQDILQRDSNKSQKLLKKLMSGVENSGKVDISTK--D 246

Query: 417 AFQHADYRTRQIAERALKHVDKIPNF 340
              H + R +   E+A+KH DK+  F
Sbjct: 247 LLPHQELRIKSGLEKAIKHKDKLLEF 272



>gb:AE017344_1756435 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 536

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 26/113 (23%), Positives = 47/113 (41%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           ++E      LV LL H     V+         +  G D++  V +   + G  P L  LL
Sbjct: 282 VIESGVCRRLVDLLMHPST-AVQTPALRSVGNIVTGDDLQTQVVI---SSGALPALLSLL 337

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIA 379
               E +R+ A W    +     +  +   D N+   L++   +AD++T++ A
Sbjct: 338 SSPKEGIRKEACWTISNITAGSPMQIQAIIDANIVPPLINILANADFKTKKEA 390



>gb:BX251411_764504 Tropheryma whipplei TW08/27, complete genome;
           segment 2/3.
          Length = 446

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 19/71 (26%), Positives = 37/71 (52%)
 Frame = +2

Query: 116 EIMTRKNGPRERRKMKI*NHLQRRKLGSNVCTCTSDFSQNNKQFRFYLKNL*SGNKYKNL 295
           + + R   P+ER + ++ N  +R ++ +   T  +D ++  ++F   LK L SGN  K++
Sbjct: 359 QAIVRSMTPQERAQPRMLNASRRLRIATGSGTTVNDINRLIQKFEHVLKVLSSGNSMKHM 418

Query: 296 KPFADPYPMFG 328
                 +P FG
Sbjct: 419 TFMNGRFPSFG 429



>gb:CR380956_1652487 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 543

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 24/113 (21%), Positives = 50/113 (44%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++ +  + LV LL H +  +V+         +  G D+   V + C   G+   L+ LL
Sbjct: 296 VIDARIPKRLVELLSH-QSTLVQTPALRAVGNIVTGNDLHTQVVINC---GVLSALRNLL 351

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIA 379
               E++R+ A W    +   +    +   D N+   L+   + A+Y+ ++ A
Sbjct: 352 SSPKESIRKEACWTISNITAGNTEQIQAVVDANLIPPLIKLLETAEYKIKKEA 404



>gb:BC045358_2549200 Danio rerio karyopherin alpha 4 (importin alpha
           3), mRNA (cDNA clone MGC:55488 IMAGE:2640657), complete
           cds.
          Length = 521

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 3/94 (3%)
 Frame = -1

Query: 732 KETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPI 553
           ++T  +L   A+    ALL H KEK+ +                +Q VQ + +A  + P+
Sbjct: 317 EQTQVVLNCDALGHFPALLTHPKEKINKEAVWFLSNITAGN---QQQVQAVIDA-NLVPM 372

Query: 552 LQILLEKRTENLRRRAVWAAERLL---RTDDIAY 460
           + +LL+K     ++ A WA   L    R D +AY
Sbjct: 373 IILLLDKGDFGTQKEAAWAISNLTISGRKDQVAY 406



>gb:AY577009_2538253 Danio rerio clone RZ151A3F12 karyopherin alpha
           4 mRNA, complete cds.
          Length = 531

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 26/94 (27%), Positives = 43/94 (45%), Gaps = 3/94 (3%)
 Frame = -1

Query: 732 KETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPI 553
           ++T  +L   A+    ALL H KEK+ +                +Q VQ + +A  + P+
Sbjct: 317 EQTQVVLNCDALGHFPALLTHPKEKINKEAVWFLSNITAGN---QQQVQAVIDA-NLVPM 372

Query: 552 LQILLEKRTENLRRRAVWAAERLL---RTDDIAY 460
           + +LL+K     ++ A WA   L    R D +AY
Sbjct: 373 IILLLDKGDFGTQKEAAWAISNLTISGRKDQVAY 406



>gb:AJ719777_2501964 Gallus gallus mRNA for hypothetical protein,
           clone 6g17.
          Length = 521

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 3/131 (2%)
 Frame = -1

Query: 732 KETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPI 553
           ++T  +L  +A+    ALL H KEK+ +                +Q VQ + +A  + P+
Sbjct: 317 EQTQVVLNCEALSHFPALLTHPKEKINKEAVWFLSNITAGN---QQQVQAVIDA-NLVPM 372

Query: 552 LQILLEKRTENLRRRAVWAAERLL---RTDDIAYEVSGDPNVSTALVDAFQHADYRTRQI 382
           +  LL+K     ++ A WA   L    R D +AY +    NV     +     D +  Q+
Sbjct: 373 IIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLI--QQNVIPPFCNLLTVKDAQVVQV 430

Query: 381 AERALKHVDKI 349
               L ++ K+
Sbjct: 431 VLDGLSNILKM 441



>gb:CR382124_1656708 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 538

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 24/113 (21%), Positives = 51/113 (45%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++ +  + LV LL H +  +V+         +  G D++  + + C   G    L+ LL
Sbjct: 291 VVDARIPKRLVELLSH-QSTLVQTPALRAVGNIVTGNDLQTQIVINC---GALAALRNLL 346

Query: 537 EKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIA 379
               E++R+ A W    +   +    +   D N+   L+   + A+Y+T++ A
Sbjct: 347 ASPKESIRKEACWTISNITAGNTEQIQAVIDANLIPPLIRLLETAEYKTKKEA 399



>gb:AE016851_348986 Tropheryma whipplei str. Twist, section 2 of 3
           of the complete genome.>gb:AE014184_1029182 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 448

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 18/71 (25%), Positives = 37/71 (52%)
 Frame = +2

Query: 116 EIMTRKNGPRERRKMKI*NHLQRRKLGSNVCTCTSDFSQNNKQFRFYLKNL*SGNKYKNL 295
           + + R   P+ER + ++ N  +R ++ +   T  +D ++  ++F +  K L SGN  K++
Sbjct: 361 QAIVRSMTPQERAQPRMLNASRRLRIATGSGTTVNDINRLIQKFEYVSKVLSSGNSMKHM 420

Query: 296 KPFADPYPMFG 328
                 +P FG
Sbjct: 421 TFMNGRFPAFG 431



>gb:HSSRP11_2020521 H.sapiens mRNA for SRP1-like protein, partial.
          Length = 281

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 3/131 (2%)
 Frame = -1

Query: 732 KETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPI 553
           ++T  +L   A+    ALL H KEK+ +                +Q VQ + +A  + P+
Sbjct: 77  EQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGN---QQQVQAVIDA-NLVPM 132

Query: 552 LQILLEKRTENLRRRAVWAAERLL---RTDDIAYEVSGDPNVSTALVDAFQHADYRTRQI 382
           +  LL+K     ++ A WA   L    R D +AY +    NV     +     D +  Q+
Sbjct: 133 IIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLI--QQNVIPPFCNLLTVKDAQVVQV 190

Query: 381 AERALKHVDKI 349
               L ++ K+
Sbjct: 191 VLDGLSNILKM 201



>gb:CR382139_1672004 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 545

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 28/115 (24%), Positives = 52/115 (45%), Gaps = 2/115 (1%)
 Frame = -1

Query: 717 LLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPILQILL 538
           +++ +    LV LL H +  +V+         +  G D++   Q++  A G+ P L  LL
Sbjct: 295 VVDARIPHRLVELLGH-ESTLVQTPALRAIGNIVTGNDVQ--TQIVINA-GVLPALAPLL 350

Query: 537 EKRTENLRRRAVWAAERLL--RTDDIAYEVSGDPNVSTALVDAFQHADYRTRQIA 379
               E +R+ A W    +    TD I   +  D N+   ++    + DY+T++ A
Sbjct: 351 NSPKETIRKEACWTISNITAGNTDQIQSVI--DANLIPQIIRLLINGDYKTKKEA 403



>gb:CR857290_1181534 Pongo pygmaeus mRNA; cDNA DKFZp469L0521 (from
           clone DKFZp469L0521).
          Length = 469

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 3/131 (2%)
 Frame = -1

Query: 732 KETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPI 553
           ++T  +L   A+    ALL H KEK+ +                +Q VQ + +A  + P+
Sbjct: 317 EQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGN---QQQVQAVIDA-NLVPM 372

Query: 552 LQILLEKRTENLRRRAVWAAERLL---RTDDIAYEVSGDPNVSTALVDAFQHADYRTRQI 382
           +  LL+K     ++ A WA   L    R D +AY +    NV     +     D +  Q+
Sbjct: 373 IIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLI--QQNVIPPFCNLLTVKDAQVVQV 430

Query: 381 AERALKHVDKI 349
               L ++ K+
Sbjct: 431 VLDGLSNILKM 441



>gb:AE013435_292312 Methanosarcina mazei strain Goe1, section 217 of
           379 of the complete genome.>gb:AE008384_966421
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 574

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 18/50 (36%), Positives = 26/50 (52%)
 Frame = -1

Query: 576 EAEGIKPILQILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVSTA 427
           EA  IK    I L + T+N++ R    +E L+ T   AY  SG P ++ A
Sbjct: 407 EAREIKNSTMIALAENTKNVQERNYLLSEYLVETGQAAYPASGKPKLAFA 456



>pir|T39506|T39506 importin alpha subunit - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC1604_1719054 S.pombe
           chromosome II cosmid c1604.
          Length = 539

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 20/78 (25%), Positives = 35/78 (44%)
 Frame = -1

Query: 612 GVDIEQGVQVLCEAEGIKPILQILLEKRTENLRRRAVWAAERLLRTDDIAYEVSGDPNVS 433
           G D +  + + C A    P L   L  + EN+R+ A W    +   +    +   + N+ 
Sbjct: 320 GTDAQTQIIIDCGALNAFPSL---LSHQKENIRKEACWTISNITAGNTQQIQAIIESNLI 376

Query: 432 TALVDAFQHADYRTRQIA 379
             LV    +ADY+T++ A
Sbjct: 377 PPLVHLLSYADYKTKKEA 394



>sp|O35343|IMA4_MOUSE Importin alpha-4 subunit (Karyopherin alpha-4
           subunit) (Importin alpha Q1).>gb:AF020771_2051083 Mus
           musculus importin alpha Q1 mRNA, complete
           cds.>gb:BC026821_2095574 Mus musculus karyopherin
           (importin) alpha 4, mRNA (cDNA clone MGC:19244
           IMAGE:3672708), complete cds.>gb:BC052162_2100982 Mus
           musculus karyopherin (importin) alpha 4, mRNA (cDNA
           clone MGC:59350 IMAGE:6510795), complete cds.
          Length = 521

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 3/131 (2%)
 Frame = -1

Query: 732 KETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPI 553
           ++T  +L   A+    ALL H KEK+ +                +Q VQ + +A  + P+
Sbjct: 317 EQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGN---QQQVQAVIDA-NLVPM 372

Query: 552 LQILLEKRTENLRRRAVWAAERLL---RTDDIAYEVSGDPNVSTALVDAFQHADYRTRQI 382
           +  LL+K     ++ A WA   L    R D +AY +    NV     +     D +  Q+
Sbjct: 373 IIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLI--QQNVIPPFCNLLTVKDAQVVQV 430

Query: 381 AERALKHVDKI 349
               L ++ K+
Sbjct: 431 VLDGLSNILKM 441



>sp|O00629|IMA4_HUMAN Importin alpha-4 subunit (Karyopherin alpha-4
           subunit) (Qip1 protein).>pir|JC5505|JC5505 DNA helicase
           Q1 interacting protein 1 - human>gb:AB002533_1863705
           Homo sapiens mRNA for Qip1, complete
           cds.>gb:BC028691_1979316 Homo sapiens karyopherin alpha
           4 (importin alpha 3), mRNA (cDNA clone MGC:26508
           IMAGE:4838709), complete cds.>gb:BC034493_1981297 Homo
           sapiens karyopherin alpha 4 (importin alpha 3), mRNA
           (cDNA clone MGC:26703 IMAGE:4821602), complete
           cds.>gb:HSU93240_2027602 Human importin alpha 3 mRNA,
           complete cds.
          Length = 521

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 32/131 (24%), Positives = 55/131 (41%), Gaps = 3/131 (2%)
 Frame = -1

Query: 732 KETFCLLEGQAVEELVALLDHTKEKVVEXXXXXXXXXLDDGVDIEQGVQVLCEAEGIKPI 553
           ++T  +L   A+    ALL H KEK+ +                +Q VQ + +A  + P+
Sbjct: 317 EQTQVVLNCDALSHFPALLTHPKEKINKEAVWFLSNITAGN---QQQVQAVIDA-NLVPM 372

Query: 552 LQILLEKRTENLRRRAVWAAERLL---RTDDIAYEVSGDPNVSTALVDAFQHADYRTRQI 382
           +  LL+K     ++ A WA   L    R D +AY +    NV     +     D +  Q+
Sbjct: 373 IIHLLDKGDFGTQKEAAWAISNLTISGRKDQVAYLI--QQNVIPPFCNLLTVKDAQVVQV 430

Query: 381 AERALKHVDKI 349
               L ++ K+
Sbjct: 431 VLDGLSNILKM 441


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 841,941,901
Number of Sequences: 1806583
Number of extensions: 17477155
Number of successful extensions: 48507
Number of sequences better than 10.0: 52
Number of HSP's better than 10.0 without gapping: 46708
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48465
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 53504197652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)