BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig13025
         (1017 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY052306_1562679 Arabidopsis thaliana At1g52320/F19K6_7 mRNA,...   310   3e-83   
pir|D96563|D96563 probable bZIP protein, 48652-45869 [imported] ...   310   3e-83   Arabidopsis thaliana [mouse-ear cress]
gb:AY091053_1574281 Arabidopsis thaliana unknown protein (At5g25...   289   7e-77   
gb:AC132483_1741105 Oryza sativa (japonica cultivar-group) chrom...   256   5e-67   
gb:AP003931_1835421 Oryza sativa (japonica cultivar-group) genom...   253   6e-66   
gb:AP003203_1825088 Oryza sativa (japonica cultivar-group) genom...   239   5e-62   
gb:AE016959_1023843 Oryza sativa (japonica cultivar-group) chrom...   127   3e-28   
gb:AY125487_1580297 Gossypium hirsutum unknown mRNA.                  122   1e-26   
gb:AY059759_1564614 Arabidopsis thaliana putative bZIP protein (...   120   6e-26   
pir|T49227|T49227 bZIP protein - Arabidopsis thaliana>gb:ATF27H5...   120   6e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AP006149_1860945 Oryza sativa (japonica cultivar-group) genom...   108   1e-22   
pir|A86153|A86153 hypothetical protein T7I23.5 - Arabidopsis tha...   103   7e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AB109206_1526819 Oryza sativa (japonica cultivar-group) genom...   101   3e-20   
gb:AP004676_1843194 Oryza sativa (japonica cultivar-group) genom...    98   3e-19   
gb:OSA307662_1692482 Oryza sativa genomic DNA fragment, chromoso...    96   1e-18   
gb:AF303133_1784342 Marsilea quadrifolia bZIP-like protein mRNA,...    95   3e-18   
gb:BC023708_2094224 Mus musculus cDNA clone MGC:38398 IMAGE:5345...    91   5e-17   
pir|A86351|A86351 hypothetical protein F8K7.18 - Arabidopsis tha...    86   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AC109595_1738722 Oryza sativa (japonica cultivar-group) chrom...    84   4e-15   
pir|T45760|T45760 hypothetical protein F24M12.330 - Arabidopsis ...    80   5e-14   Arabidopsis thaliana [mouse-ear cress]
pir|T06133|T06133 hypothetical protein F23E12.200 - Arabidopsis ...    77   7e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AY080860_1568550 Arabidopsis thaliana unknown protein (At1g77...    70   9e-11   
pir|D96804|D96804 unknown protein T5M16.9 [imported] - Arabidops...    70   9e-11   Arabidopsis thaliana [mouse-ear cress]
gb:BT000504_1634782 Arabidopsis thaliana unknown protein (At4g35...    68   3e-10   
gb:AP005251_1849587 Oryza sativa (japonica cultivar-group) genom...    67   6e-10   
pir|T52411|T52411 bZIP protein [imported] - Arabidopsis thaliana...    67   6e-10   Arabidopsis thaliana [mouse-ear cress]
pir|F84668|F84668 hypothetical protein At2g27090 [imported] - Ar...    65   2e-09   Arabidopsis thaliana [mouse-ear cress]
pir|B84548|B84548 hypothetical protein At2g17100 [imported] - Ar...    63   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AP005862_1859200 Oryza sativa (japonica cultivar-group) genom...    61   3e-08   
gb:AE005172_891008 Arabidopsis thaliana chromosome 1, top arm co...    61   4e-08   
gb:AP004858_1846104 Oryza sativa (japonica cultivar-group) genom...    59   2e-07   
gb:AP003238_1825987 Oryza sativa (japonica cultivar-group) genom...    58   3e-07   
gb:AC087553_1734122 Oryza sativa (japonica cultivar-group) chrom...    57   6e-07   
pir|T01368|T01368 hypothetical protein At2g34670 [imported] - Ar...    56   1e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AK118990_1816935 Arabidopsis thaliana At2g34670 mRNA for unkn...    56   1e-06   
gb:AP005525_1853470 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
pir|T08989|T08989 hypothetical protein F6G3.160 - Arabidopsis th...    47   8e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP003813_1833722 Oryza sativa (japonica cultivar-group) genom...    45   0.002   
gb:AC012679_1537795 Arabidopsis thaliana chromosome 1 BAC F25P22...    44   0.004   
gb:AY735668_1625710 Arabidopsis thaliana hypothetical protein AT...    43   0.011   
gb:AB026634_1517042 Arabidopsis thaliana genomic DNA, chromosome...    43   0.011   
pir|T05016|T05016 hypothetical protein T19P19.180 - Arabidopsis ...    43   0.011   Arabidopsis thaliana [mouse-ear cress]
pir|B96766|B96766 protein kinesin F2P9.27 [imported] - Arabidops...    42   0.026   Arabidopsis thaliana [mouse-ear cress]
gb:CR749347_1180974 Homo sapiens mRNA; cDNA DKFZp781D1722 (from ...    41   0.044   
gb:AE014134_1129509 Drosophila melanogaster chromosome 2L, compl...    39   0.22    
gb:AE014134_1129508 Drosophila melanogaster chromosome 2L, compl...    39   0.22    
gb:AE014134_1129507 Drosophila melanogaster chromosome 2L, compl...    39   0.22    
pir|T13030|T13030 microtubule binding protein D-CLIP-190 - fruit...    39   0.22    Drosophila melanogaster
sp|Q9VJE5|C190_DROME|C190_DROME Restin homolog (Cytoplasmic linker protein ...    39   0.22    Drosophila melanogaster
gb:AF120932_1769769 Arabidopsis thaliana SMC-like protein (MIM) ...    38   0.28    
gb:HSA132949_2000346 Homo sapiens mRNA for rfg5 protein.               37   0.63    
gb:BC023021_1978066 Homo sapiens golgi autoantigen, golgin subfa...    37   0.63    
pir|I38153|I38153 gene retII protein - human>gb:HSRETTT_2019953 ...    37   0.63    Homo sapiens [man]
sp|Q8TBA6|GOA5_HUMAN|GOA5_HUMAN Golgi autoantigen, golgin subfamily A membe...    37   0.63    Homo sapiens [man]
gb:KSU52064_2440991 Kaposi's sarcoma-associated herpes-like viru...    37   0.82    
gb:AB016887_1513154 Arabidopsis thaliana genomic DNA, chromosome...    37   0.82    
gb:CQ783618_1452546 Sequence 3758 from Patent EP1396543.>gb:AK07...    36   1.1     
gb:AF039039_1235277 Caenorhabditis elegans cosmid T08B1, complet...    36   1.1     
gb:AF039039_1235276 Caenorhabditis elegans cosmid T08B1, complet...    36   1.1     
pir|T30896|T30896 hypothetical protein T08B1.2 - Caenorhabditis ...    36   1.1     Caenorhabditis elegans [roundworm]
gb:U93872_2456846 Kaposi's sarcoma-associated herpesvirus glycop...    36   1.4     
gb:CR548612_1375532 Paramecium tetraurelia macronuclear largest ...    36   1.4     
gb:CP000025_877799 Campylobacter jejuni RM1221, complete genome.       36   1.4     
pir|F81417|F81417 MCP-domain signal transduction protein Cj0019c...    36   1.4     Campylobacter jejuni
gb:AF360120_2240875 Human herpesvirus 8 ORF73 gene, complete cds.      35   1.8     
gb:AF192756_2211542 Kaposi's sarcoma-associated herpesvirus Orf7...    35   1.8     
gb:AF148805_2203604 Kaposi's sarcoma-associated herpesvirus ORF ...    35   1.8     
gb:CR352243_2570074 Zebrafish DNA sequence from clone DKEYP-117H...    35   2.4     
gb:AF305694_2232001 Kaposi's sarcoma-associated herpesvirus late...    35   3.1     
gb:BC052083_2100962 Mus musculus TNFAIP3 interacting protein 2, ...    35   3.1     
gb:AX011244_1456399 Sequence 4 from Patent WO9957133.>gb:MMU3048...    35   3.1     
gb:U58760_1405415 Caenorhabditis elegans cosmid C27A2, complete ...    35   3.1     
gb:AY052127_1290721 Drosophila melanogaster SD07741 full insert ...    35   3.1     
gb:BX571662_779191 Wolinella succinogenes, complete genome; segm...    35   3.1     
pir|T15650|T15650 hypothetical protein C27A2.1 - Caenorhabditis ...    35   3.1     Caenorhabditis elegans [roundworm]
gb:HSCZCHOM_2437578 Cercopithecine herpesvirus 5 SPLF5 protein (...    34   4.1     
gb:BC039340_1982548 Homo sapiens Rho GTPase activating protein 2...    34   4.1     
gb:AY496267_1954841 Homo sapiens RhoGTPase regulating protein va...    34   4.1     
gb:AY496266_1954840 Homo sapiens RhoGTPase regulating protein va...    34   4.1     
gb:AY496264_1954838 Homo sapiens RhoGTPase regulating protein va...    34   4.1     
gb:AY496263_1954837 Homo sapiens RhoGTPase regulating protein va...    34   4.1     
gb:PFMAL1P1_1394249 Plasmodium falciparum DNA from MAL1P1, compl...    34   4.1     
gb:AF304204_1260567 Strongylocentrotus purpuratus dystrophin-lik...    34   4.1     
gb:AE014296_1134238 Drosophila melanogaster chromosome 3L, compl...    34   4.1     
gb:AE014296_1134237 Drosophila melanogaster chromosome 3L, compl...    34   4.1     
gb:AE014296_1134236 Drosophila melanogaster chromosome 3L, compl...    34   4.1     
gb:AE017199_403199 Nanoarchaeum equitans Kin4-M, complete genome.      34   4.1     
pir|C59436|C59436 KIAA1391 protein [imported] - human>gb:AB03781...    34   4.1     Homo sapiens [man]
pir|T27676|T27676 hypothetical protein ZK1058.4 - Caenorhabditis...    34   4.1     Caenorhabditis elegans [roundworm]
pir|T31504|T31504 hypothetical protein Y116A8C.36 - Caenorhabdit...    34   4.1     Caenorhabditis elegans [roundworm]
pir|T47645|T47645 centromere protein-like - Arabidopsis thaliana...    34   4.1     Arabidopsis thaliana [mouse-ear cress]
pir|T00529|T00529 hypothetical protein At2g19090 [imported] - Ar...    34   4.1     Arabidopsis thaliana [mouse-ear cress]
gb:AP003843_1834108 Oryza sativa (japonica cultivar-group) genom...    34   5.3     
gb:CNS07EGC_1373414 chromosome V of strain GB-M1 of Encephalitoz...    34   5.3     
gb:CEF22E12_1362844 Caenorhabditis elegans cosmid F22E12, comple...    34   5.3     
gb:AF438161_510754 Streptococcus pyogenes M protein precursor (e...    34   5.3     
gb:AF288753_496102 Streptococcus pyogenes isolate 7203-99 M prot...    34   5.3     
gb:AF288752_496101 Streptococcus pyogenes isolate 3148-00 M prot...    34   5.3     
gb:AE014170_305204 Streptococcus pyogenes MGAS315, section 35 of...    34   5.3     
gb:SPU40231_189531 Streptococcus pyogenes M3 protein (emm3.1) ge...    34   5.3     
pir|T21275|T21275 hypothetical protein F22E12.1 - Caenorhabditis...    34   5.3     Caenorhabditis elegans [roundworm]
gb:AF056035_2052674 Rattus norvegicus s-nexilin mRNA, complete cds.    33   6.9     
gb:AF056034_2052673 Rattus norvegicus F-actin binding protein b-...    33   6.9     
gb:AB053469_1868221 Homo sapiens mRNA for ELKS gamma, complete cds.    33   6.9     
gb:AX877984_1477246 Sequence 12889 from Patent EP1074617.>gb:AK0...    33   6.9     
gb:AC116984_1207263 Dictyostelium discoideum chromosome 2 map 25...    33   6.9     
gb:AC115592_1205726 Dictyostelium discoideum chromosome 2 map 1-...    33   6.9     
gb:HSM801462_1186187 Homo sapiens mRNA; cDNA DKFZp434A2017 (from...    33   6.9     
gb:AE014134_1127620 Drosophila melanogaster chromosome 2L, compl...    33   6.9     
gb:AE014134_1127619 Drosophila melanogaster chromosome 2L, compl...    33   6.9     
gb:AE014186_938241 Plasmodium falciparum 3D7 chromosome 11 compl...    33   6.9     
gb:AE017354_460836 Legionella pneumophila subsp. pneumophila str...    33   6.9     
gb:SCO939108_174929 Streptomyces coelicolor A3(2) complete genom...    33   6.9     
pir|T43445|T43445 hypothetical protein DKFZp434A2017.1 - human (...    33   6.9     Homo sapiens [man]
pir|A32264|A32264 parathymosin - human>gb:HUMTHYP_2037770 Human ...    33   6.9     Homo sapiens [man]
pir|JC5738|JC5738 membrane-bound proton-translocating ATPase (EC...    33   6.9     Streptococcus mutans
sp|P20962|THYP_HUMAN|THYP_HUMAN Parathymosin.                                     33   6.9     Homo sapiens [man]
sp|P19515|LIP_RHIMI|LIP_RHIMI Lipase precursor (EC 3.1.1.3) (Triacylglycer...    33   6.9     Rhizomucor miehei
gb:BC073415_2557256 Xenopus laevis MGC80881 protein, mRNA (cDNA ...    33   9.1     
gb:BC072844_2556770 Xenopus laevis hypothetical protein LOC44358...    33   9.1     
gb:AX961932_1484460 Sequence 143 from Patent WO03104277.>gb:AK05...    33   9.1     
gb:AF131221_1243493 Dictyostelium discoideum p21-activated prote...    33   9.1     
gb:CR858097_1182284 Pongo pygmaeus mRNA; cDNA DKFZp459O0833 (fro...    33   9.1     
gb:AK078225_1172233 Mus musculus adult male olfactory brain cDNA...    33   9.1     
gb:BA000028_695678 Oceanobacillus iheyensis HTE831 DNA, complete...    33   9.1     
gb:SPEMM3G_188147 S.pyogenes emm3 gene.                                33   9.1     
pir|I48176|I48176 synaptonemal complex protein - golden hamster ...    33   9.1     Mesocricetus auratus [Syrian golden hamster]
sp|Q60563|SCP1_MESAU|SCP1_MESAU Synaptonemal complex protein 1 (SCP-1 prote...    33   9.1     Mesocricetus auratus [Syrian golden hamster]


>gb:AY052306_1562679 Arabidopsis thaliana At1g52320/F19K6_7 mRNA,
            complete cds.>gb:BT000616_1634894 Arabidopsis thaliana
            probable bZIP protein (At1g52320/F19K6_7) mRNA, complete
            cds.
          Length = 398

 Score =  310 bits (794), Expect = 3e-83
 Identities = 158/271 (58%), Positives = 203/271 (74%), Gaps = 2/271 (0%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct: 118  KLVHLVEAMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEW 177

Query: 834  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG 655
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + 
Sbjct: 178  HTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLD 237

Query: 654  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR 475
            K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R
Sbjct: 238  KIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKR 297

Query: 474  TPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP 301
             P   +  E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LP
Sbjct: 298  GPEGMNPDEADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLP 356

Query: 300  ELFHAMSEFSRACSIMYQTLESITHPLNRES 208
            ELF AMSE + +CS MY+   +IT+   R+S
Sbjct: 357  ELFQAMSEVAYSCSDMYR---AITYASKRQS 384



>pir|D96563|D96563 probable bZIP protein, 48652-45869 [imported] -
            Arabidopsis thaliana>gb:AE005173_893144 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC037424_1540006 Arabidopsis thaliana
            chromosome 1 BAC F19K6 genomic sequence, complete
            sequence.
          Length = 798

 Score =  310 bits (794), Expect = 3e-83
 Identities = 158/271 (58%), Positives = 203/271 (74%), Gaps = 2/271 (0%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            KL  LVE+M +MWE M+ HH+ Q +I   LRSLD+SQ+ KET++HH+ERT QL  VVQEW
Sbjct: 518  KLVHLVEAMGKMWEMMQIHHQRQAEISKVLRSLDVSQAVKETNDHHHERTIQLLAVVQEW 577

Query: 834  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG 655
            H+QF +MI HQKEYI+ L  WLKLNL+PI++ LKEKVSSP R  NP I  LLHAW D + 
Sbjct: 578  HTQFCRMIDHQKEYIKALGGWLKLNLIPIESTLKEKVSSPPRVPNPAIQKLLHAWYDRLD 637

Query: 654  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR 475
            K+PDE+AK+AI +F+AVV+TI+Q Q DE+ L+++C++TRKEL ++ RQFEDWYHKY+Q+R
Sbjct: 638  KIPDEMAKSAIINFAAVVSTIMQQQEDEISLRNKCEETRKELGRKIRQFEDWYHKYIQKR 697

Query: 474  TPN--DDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP 301
             P   +  E D  H D  V  RQ  +E +K+RL+EEEEAY RQ  QVR KSL SLRT LP
Sbjct: 698  GPEGMNPDEADNDHND-EVAVRQFNVEQIKKRLEEEEEAYHRQSHQVREKSLASLRTRLP 756

Query: 300  ELFHAMSEFSRACSIMYQTLESITHPLNRES 208
            ELF AMSE + +CS MY+   +IT+   R+S
Sbjct: 757  ELFQAMSEVAYSCSDMYR---AITYASKRQS 784



>gb:AY091053_1574281 Arabidopsis thaliana unknown protein (At5g25590)
            mRNA, complete cds.>gb:AY133786_1581606 Arabidopsis
            thaliana clone U19101 unknown protein (At5g25590) mRNA,
            complete cds.
          Length = 775

 Score =  289 bits (739), Expect = 7e-77
 Identities = 136/266 (51%), Positives = 198/266 (74%), Gaps = 3/266 (1%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L +LVE MA+MW  M  HH+ Q  IV  L++L++S S KET++ H+ +T Q   V++E
Sbjct: 497  PRLVALVEGMAKMWTNMCIHHDTQLGIVGELKALEISTSLKETTKQHHHQTRQFCTVLEE 556

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
            WH QF+ ++ HQK+YI  LN+WLKLNL+PI+++LKEKVSSP RPQ PPI ALLH+W D +
Sbjct: 557  WHVQFDTLVTHQKQYINSLNNWLKLNLIPIESSLKEKVSSPPRPQRPPIQALLHSWHDRL 616

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
             KLPDE+AK+AI SF+AV+ TI+ HQ +EMKLK++C++TR+E  ++ + FEDWY K++Q+
Sbjct: 617  EKLPDEVAKSAISSFAAVIKTILLHQEEEMKLKEKCEETRREFIRKKQGFEDWYQKHLQK 676

Query: 477  RTPNDDTE---QDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG 307
            R P ++ E          ++V ER++ +E LK+RL+EEEEA+ R C+QVR KSL SL+  
Sbjct: 677  RGPTEEAEGGDDATTSSRDHVTERRIAVETLKKRLEEEEEAHQRHCVQVREKSLNSLKIR 736

Query: 306  LPELFHAMSEFSRACSIMYQTLESIT 229
            LPE+F A+S+++ AC+  Y+ L  I+
Sbjct: 737  LPEIFRALSDYAHACADSYEKLRIIS 762



>gb:AC132483_1741105 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0014C03, complete sequence.
          Length = 847

 Score =  256 bits (654), Expect = 5e-67
 Identities = 128/260 (49%), Positives = 181/260 (69%), Gaps = 1/260 (0%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L + MA+MWE M  HHENQ + VL L+S+D+S S  ETS+HH+  T QL  +V++
Sbjct: 527  PRLLDLADRMAKMWEDMHLHHENQLKTVLNLKSVDISDSHIETSDHHHSHTRQLRDIVEK 586

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
            W + F  ++ +QKEYI  L  WLKLNL+PI+++LKEKV+SP R Q PP+ ALL AW + +
Sbjct: 587  WTTNFSDLMSYQKEYINALYSWLKLNLIPIESSLKEKVASPPRVQQPPVKALLQAWNEHL 646

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
             KLPD+LAKTAI SF AV++TI+  Q +E+K K+ C+ TRKE  ++ R FEDWYHK+ QR
Sbjct: 647  TKLPDDLAKTAIVSFRAVLDTILSVQDEELKQKETCEHTRKEYMRKARAFEDWYHKHAQR 706

Query: 477  RTPNDDTEQ-DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP 301
            R  + D E  +G  + + V E++  +E+LK +L +E EA+ +   QVR KSL+ L+  LP
Sbjct: 707  RAFDVDPESGEGTSQKDTVAEKRFAVESLKNKLDDEVEAHNKLSKQVREKSLSILKAHLP 766

Query: 300  ELFHAMSEFSRACSIMYQTL 241
            ELF A+++FS A   MY  +
Sbjct: 767  ELFRALTDFSLASFEMYSKM 786



>gb:AP003931_1835421 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1664_D08.>gb:AP005779_1857724 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBb0042J07.
          Length = 737

 Score =  253 bits (645), Expect = 6e-66
 Identities = 127/266 (47%), Positives = 180/266 (67%), Gaps = 2/266 (0%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            PKL  LV+ M  MW+ M  HH+ Q +I+L L+SLD+S +P+ETSE H++RT QL  VV E
Sbjct: 467  PKLLELVKGMWHMWDAMYLHHKTQLKIILELKSLDISVAPRETSEQHHDRTVQLWNVVHE 526

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
            WH+QF+K + +QK+Y+  L  W+KLN++PIDTNLK   S P     PPI  +LHAW +++
Sbjct: 527  WHTQFDKFMTYQKQYVGSLYTWIKLNVIPIDTNLKPNSSQPHE-TTPPIKRVLHAWHEIL 585

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
            GKLPDE AK AI +F+ +V TI+ HQ DE+KL+ + +DTR++  K+ RQF+DW  KY+ +
Sbjct: 586  GKLPDEAAKKAINTFAEIVKTILVHQEDELKLRMKIEDTRRDYGKKRRQFDDWAQKYIHQ 645

Query: 477  RTP--NDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL 304
                  +D   DG   D  + ER+  +E L+  +KE EE Y++QC  VR KSL+ LRT L
Sbjct: 646  TAGILPEDRNPDGARPD-PMAERKAAMEKLELSMKELEEMYVKQCRVVREKSLSLLRTNL 704

Query: 303  PELFHAMSEFSRACSIMYQTLESITH 226
            PELF  +S+FS   + M++ + SI H
Sbjct: 705  PELFRVVSDFSLQSAGMFKGVWSIAH 730



>gb:AP003203_1825088 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1080D07.
          Length = 752

 Score =  239 bits (611), Expect = 5e-62
 Identities = 123/263 (46%), Positives = 175/263 (66%), Gaps = 4/263 (1%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            PKL  LV+ MA MW +M  HH+ Q  I+  +R+ +    P+ET++ HY++T  L  +V+E
Sbjct: 477  PKLVDLVDGMANMWSSMHHHHKWQLVIISGIRNFEAPPVPRETTDQHYKQTCDLRDIVRE 536

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
            WH QFEK++ HQK YIR LN WLKLNL+PI++NLKEKVSSP R   PPI  LL+AW D +
Sbjct: 537  WHMQFEKLMDHQKGYIRALNAWLKLNLIPIESNLKEKVSSPPRLVEPPIKDLLYAWHDQL 596

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
             +LP ELAKTAI SF+ V++ IV  Q +E+ L+ RC++TR++L ++  QFE+W+ +YM+R
Sbjct: 597  ERLPIELAKTAIKSFAEVISNIVLLQEEEVNLRRRCEETRRDLNRKKAQFEEWHQRYMER 656

Query: 477  R-TPNDDTEQDGPHEDNN---VIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRT 310
            + +  +D       E  N   V +R+  +E ++ RL+EE   + R   QVR KSL +LR 
Sbjct: 657  KASQGEDANNSEVAEAVNSDPVADRKTAIEEVEIRLREEMGHHNRIARQVREKSLANLRM 716

Query: 309  GLPELFHAMSEFSRACSIMYQTL 241
             LPELF  M++F+  C  MY  L
Sbjct: 717  HLPELFRNMTDFAGFCYEMYSNL 739



>gb:AE016959_1023843 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AY027588_1559051 Oryza sativa
            bZIP protein gene, complete cds.>gb:AC079890_1733049
            Oryza sativa chromosome 10 BAC OSJNBb0089A17 genomic
            sequence, complete sequence.>gb:AE017119_1753662 Oryza
            sativa (japonica cultivar-group) chromosome 10, section
            73 of 77 of the complete sequence.>gb:AF268596_1782049
            Oryza sativa bZIP (bZIP) mRNA, complete cds.
          Length = 767

 Score =  127 bits (320), Expect = 3e-28
 Identities = 77/258 (29%), Positives = 129/258 (50%), Gaps = 9/258 (3%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L  ++  MW +M   HE Q +IV  +R L  +   + TS+ H   T  L   V  
Sbjct: 494  PQLVELCFALLSMWRSMNHFHEIQNEIVQQVRGLVDNSMAESTSDLHRLATRDLEAAVSA 553

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
            WHS F ++I +Q++YIR L  WLKL L  +D+N+ ++  +    +   +      W+  +
Sbjct: 554  WHSNFNRLIKYQRDYIRALYGWLKLTLFQVDSNIPQEAYTSLISRE--LTTFCDEWKQAL 611

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
             +LPD  A  AI SF  VV+ I   Q +EMK+K R +   KELEK+T        KY Q 
Sbjct: 612  DRLPDASASEAIKSFVNVVHVIYTKQAEEMKIKKRTETYSKELEKKTNSLRAIEKKYYQS 671

Query: 477  ---------RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL 325
                      +  D  E       + + E++ ++   ++++++E   + +     R  +L
Sbjct: 672  YSMVGLGLPGSGRDGIESHSFDARDPLAEKKTEIAQCRRKVEDEMTRHAKAVEVTRSMTL 731

Query: 324  TSLRTGLPELFHAMSEFS 271
             +++TGLP +F A++ FS
Sbjct: 732  NNIQTGLPGMFQAIAGFS 749



>gb:AY125487_1580297 Gossypium hirsutum unknown mRNA.
          Length = 645

 Score =  122 bits (306), Expect = 1e-26
 Identities = 74/269 (27%), Positives = 132/269 (49%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  LV  +  MW +M   H+    IV  L+ L+   S + TSE H + T QL + VQ+
Sbjct: 381  PQLLDLVNGLMWMWRSMYEIHQVHTHIVQQLKYLNFMPSNEPTSEIHKQSTLQLELEVQQ 440

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
            WHS F  ++  Q++YI+ L  WL+L+L         K    +  +   I +    W   I
Sbjct: 441  WHSSFCNLVKAQRDYIQSLAGWLRLSLFQF-----SKDPLLRNNEESKIYSFCEEWHLAI 495

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
             ++PD++A   I SF  V++ IV  Q +E K K +     K+ EK+  +      KY   
Sbjct: 496  DRIPDKVASEGIKSFLTVIHAIVVQQAEEYKQKKKADSALKDFEKKAAELRSLESKY--- 552

Query: 477  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE 298
              P     +   +    V+E++ ++E L+ + +EE+  + +     R  +L +L+ G P 
Sbjct: 553  -GPFSSMPEMNKYP---VVEKRTKVEMLRAKAEEEKNKHEKSASVTRAMTLNNLQMGFPH 608

Query: 297  LFHAMSEFSRACSIMYQTLESITHPLNRE 211
            +F AM  +S  C   ++++ +  + +++E
Sbjct: 609  VFQAMVGYSSVCMQAFESVYNQANGIDQE 637



>gb:AY059759_1564614 Arabidopsis thaliana putative bZIP protein
            (At3g60320) mRNA, complete cds.
          Length = 796

 Score =  120 bits (300), Expect = 6e-26
 Identities = 79/267 (29%), Positives = 131/267 (49%), Gaps = 8/267 (2%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ 841
            P+L  L      MW++M  +HE Q  IV  +R L + S   + TSE H + T  L   V 
Sbjct: 526  PQLVELCHGFMYMWKSMHQYHETQNSIVEQVRGLINRSGKGESTSELHRQATRDLESAVS 585

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
             WHS F  +I  Q+++I  ++ W KL L+P+    ++  +  + P +    A    W+  
Sbjct: 586  SWHSSFSSLIKFQRDFIHSVHAWFKLTLLPVCQ--EDAANHHKEPLDA--YAFCDEWKLA 641

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ 481
            + ++PD +A  AI SF  VV+ I   Q DE K+K R +   KELEK+     +   KY Q
Sbjct: 642  LDRIPDTVASEAIKSFINVVHVISAKQADEHKIKKRTESASKELEKKASSVRNLERKYYQ 701

Query: 480  RRT-PNDDTEQDGPHED------NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT 322
              +       + GP         + + +++ +L   ++R++EE   Y +     R  +L 
Sbjct: 702  SYSMVGVGLPESGPDNQHMLDARDPLSDKKSELAVCQRRVEEEMVKYSKAIEVTRAMTLN 761

Query: 321  SLRTGLPELFHAMSEFSRACSIMYQTL 241
            +L+TGLP +F +++ FS       QT+
Sbjct: 762  NLQTGLPGVFQSLTSFSALFMESLQTV 788



>pir|T49227|T49227 bZIP protein - Arabidopsis
            thaliana>gb:ATF27H5_1550225 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F27H5.
          Length = 493

 Score =  120 bits (300), Expect = 6e-26
 Identities = 79/267 (29%), Positives = 131/267 (49%), Gaps = 8/267 (2%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ 841
            P+L  L      MW++M  +HE Q  IV  +R L + S   + TSE H + T  L   V 
Sbjct: 223  PQLVELCHGFMYMWKSMHQYHETQNSIVEQVRGLINRSGKGESTSELHRQATRDLESAVS 282

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
             WHS F  +I  Q+++I  ++ W KL L+P+    ++  +  + P +    A    W+  
Sbjct: 283  SWHSSFSSLIKFQRDFIHSVHAWFKLTLLPVCQ--EDAANHHKEPLDA--YAFCDEWKLA 338

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ 481
            + ++PD +A  AI SF  VV+ I   Q DE K+K R +   KELEK+     +   KY Q
Sbjct: 339  LDRIPDTVASEAIKSFINVVHVISAKQADEHKIKKRTESASKELEKKASSVRNLERKYYQ 398

Query: 480  RRT-PNDDTEQDGPHED------NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLT 322
              +       + GP         + + +++ +L   ++R++EE   Y +     R  +L 
Sbjct: 399  SYSMVGVGLPESGPDNQHMLDARDPLSDKKSELAVCQRRVEEEMVKYSKAIEVTRAMTLN 458

Query: 321  SLRTGLPELFHAMSEFSRACSIMYQTL 241
            +L+TGLP +F +++ FS       QT+
Sbjct: 459  NLQTGLPGVFQSLTSFSALFMESLQTV 485



>gb:AP006149_1860945 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:B1274F11.>gb:AP006174_1861379 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0229B10.
          Length = 242

 Score =  108 bits (271), Expect = 1e-22
 Identities = 69/234 (29%), Positives = 114/234 (48%), Gaps = 1/234 (0%)
 Frame = -1

Query: 939 IVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLN 760
           +V  L  L+ S S   TS  H +   QL + V  W+S F  ++  Q++Y+  L  WL+L+
Sbjct: 1   MVQQLEYLNNSLSTNPTSNVHRQAALQLEIEVDRWYSAFCSLVKSQRDYVYSLTGWLRLS 60

Query: 759 LVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQ 580
           L     +   K       QN  I +L   WQ  I ++PD++A   I +   V++ +V  Q
Sbjct: 61  LFQSYHDPYNKAH-----QNSDIYSLCEEWQLAIDRIPDKVASEGIKTLLTVIHAVVVQQ 115

Query: 579 LDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGP-HEDNNVIERQLQL 403
            +E K K R +   KELEK+  +      KY     P    E  G     + V +++ ++
Sbjct: 116 AEEQKQKKRSESAFKELEKKAEELRSLESKY----GPYSGAEGYGDMSRKSPVSDKRAKV 171

Query: 402 EALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTL 241
           EAL+ R  EE+  Y +     R  +L +L+TG P +F AM+ F+  C   ++++
Sbjct: 172 EALRCRADEEKSKYEKSIGVTRAMTLNNLQTGFPNVFQAMTGFASVCMEAFESV 225



>pir|A86153|A86153 hypothetical protein T7I23.5 - Arabidopsis
            thaliana>gb:AE005172_889258 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:U89959_1726478 Arabidopsis thaliana BAC
            T7I23, complete sequence.
          Length = 655

 Score =  103 bits (256), Expect = 7e-21
 Identities = 75/273 (27%), Positives = 129/273 (47%), Gaps = 6/273 (2%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSL-DMSQSPKETSEHHYERTYQLGVVVQ 841
            P+L  L   +  MW++M  +HE Q  IV  +R L + ++  + TSE H + T  L   V 
Sbjct: 418  PQLVELCHGLMYMWKSMHEYHEIQNNIVQQVRGLINQTERGESTSEVHRQVTRDLESAVS 477

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
             WHS F ++I  Q+E+I  L+ W KL+LVP+     +K       Q P   AL   W+  
Sbjct: 478  LWHSSFCRIIKFQREFICSLHAWFKLSLVPLSNGDPKK-------QRPDSFALCEEWKQS 530

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ 481
            +                         + +E+K+K R +   KELEK+         KY Q
Sbjct: 531  L------------------------ERAEEVKMKKRTESAGKELEKKASSLRSIERKYYQ 566

Query: 480  RRTPNDDTEQDGPHED-----NNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL 316
              +    T   GP  +     + + E++ +L A ++++++E   +++     R  +L +L
Sbjct: 567  AYS----TVGIGPGPEVLDSRDPLSEKKCELAACQRQVEDEVMRHVKAVEVTRAMTLNNL 622

Query: 315  RTGLPELFHAMSEFSRACSIMYQTLESITHPLN 217
            +TGLP +F A++ FS   +   QT+ S ++ +N
Sbjct: 623  QTGLPNVFQALTSFSSLFTESLQTVCSRSYSIN 655



>gb:AB109206_1526819 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:
            P0478E02.>gb:AP006149_1860980 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 9, BAC
            clone:B1274F11.
          Length = 722

 Score =  101 bits (251), Expect = 3e-20
 Identities = 66/272 (24%), Positives = 123/272 (45%), Gaps = 3/272 (1%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L++ + R W+ M   HE Q QI+  + S       K  ++     T +L   ++ 
Sbjct: 431  PQLVELLQGLTRTWKIMVDSHETQRQIMFEVNSFTCPAYGKFCNDAQRHATLKLEAELRN 490

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS--PQRPQNPPILALLHAWQD 664
            W S F   +  QK YI  L+ WL   ++         +SS  P R   PP++ + H W  
Sbjct: 491  WRSCFMIYVSAQKAYIEALDGWLSKFILTDTIRYSRGISSIAPDRSSAPPLVVICHDWYT 550

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM 484
             + K  ++     + +F   V  +   Q +E + K +     KE++K+   ++   +K +
Sbjct: 551  TLSKFQNKRVAFTMRNFIRSVRVLWLKQGEEQQQKRKVDSLAKEMDKKISAYKRAENKVI 610

Query: 483  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQ-VRVKSLTSLRTG 307
            + +      EQD      ++ E++  L  L++R+ E E+A    CM+     +L   + G
Sbjct: 611  ETKLLEHRPEQDAKQRMEHLSEKKEMLNVLRKRV-EAEKAKHHACMRDTHDVTLNGFKIG 669

Query: 306  LPELFHAMSEFSRACSIMYQTLESITHPLNRE 211
            L  +F +++EFS+    +Y+ L +   P   E
Sbjct: 670  LASIFESLTEFSKDSVKLYEDLLTHAEPKGSE 701



>gb:AP004676_1843194 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1003_B06.
          Length = 588

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 68/263 (25%), Positives = 117/263 (44%), Gaps = 15/263 (5%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            +L  L  +   MW  M+ HHE Q  I   LR L    S   T+E HYE T  L V +  W
Sbjct: 311  QLLGLCHATLDMWRAMRQHHEAQGLIAQQLRGLSSRTSMDPTTEIHYETTRALEVAMSSW 370

Query: 834  HSQFEKMIIHQKEYIRGLNDWLKLNL--VPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
             +    +  HQ++Y+  L+ WLKL L   P   +  E V+SP   +   + A +  W   
Sbjct: 371  CAALGHLAKHQRDYVHALHGWLKLTLQEAPAVVDGAEAVASPVAAE---LAAFVERWGQA 427

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ 481
            + ++       +I SF+  V ++   Q DE+++  R     +EL++++R        Y  
Sbjct: 428  LDRVHCADVLKSIKSFAGAVRSLYGLQSDELRVARRVSQYSRELDRKSRMLRQVEKSYYD 487

Query: 480  RRTPNDDTE----------QDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQV 340
               P                DG H     N V +R+ ++ A ++ +++E   + +     
Sbjct: 488  SYVPPMGLSLWHRGMRHWGDDGMHARDASNEVAQRRDEIAACRRTVEDEMRKHAKAIDAT 547

Query: 339  RVKSLTSLRTGLPELFHAMSEFS 271
            R  ++T ++  LP +F +M+ FS
Sbjct: 548  RSAAVTCVQGKLPAVFQSMAVFS 570



>gb:OSA307662_1692482 Oryza sativa genomic DNA fragment, chromosome 2.
          Length = 561

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 67/263 (25%), Positives = 117/263 (44%), Gaps = 15/263 (5%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            +L  L  +   MW  M+ HHE Q  I   LR L    S   T+E H+E T  L V +  W
Sbjct: 284  QLLGLCHATLDMWRAMRQHHEAQGLIAQQLRGLSSRTSMDPTTEIHHETTRALEVAMSSW 343

Query: 834  HSQFEKMIIHQKEYIRGLNDWLKLNL--VPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
             +    +  HQ++Y+  L+ WLKL L   P   +  E V+SP   +   + A +  W   
Sbjct: 344  CAALGHLAKHQRDYVHALHGWLKLTLQEAPAVVDGAEAVASPVAAE---LAAFVERWGQA 400

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ 481
            + ++       +I SF+  V ++   Q DE+++  R     +EL++++R        Y  
Sbjct: 401  LDRVHCADVLKSIKSFAGAVRSLYGLQSDELRVARRVSQYSRELDRKSRMLRQVEKSYYD 460

Query: 480  RRTPNDDTE----------QDGPH---EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQV 340
               P                DG H     N V +R+ ++ A ++ +++E   + +     
Sbjct: 461  SYVPPMGLSLWHRGMRHWGDDGMHARDASNEVAQRRDEIAACRRTVEDEMRKHAKAIDAT 520

Query: 339  RVKSLTSLRTGLPELFHAMSEFS 271
            R  ++T ++  LP +F +M+ FS
Sbjct: 521  RSAAVTCVQGKLPAVFQSMAVFS 543



>gb:AF303133_1784342 Marsilea quadrifolia bZIP-like protein mRNA,
            partial cds.
          Length = 195

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 53/176 (30%), Positives = 91/176 (51%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            +L  LV+    MW +M   H  Q  I+  ++ LD   SP  T+E++ + T QL   V  W
Sbjct: 15   QLVDLVQKSMIMWRSMLDCHLKQHYIINNMQ-LDDVFSPIATTEYNIKNTLQLESEVNIW 73

Query: 834  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG 655
                E ++  QKEY+  ++ WL L+++ I+ + K   SSPQ+  +PP+ AL   W   + 
Sbjct: 74   RRNLESLVHTQKEYVFAIHRWLCLHVIEIECSSKRAPSSPQKMSSPPVYALCKTWLSAVN 133

Query: 654  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKY 487
            ++    A  A+ +FS  ++ +  HQ +E++   R    RK+LEK+     D   ++
Sbjct: 134  QITGNSAVNALKTFSNSIHELKVHQTEELRQHKRLDHLRKDLEKKELALYDLLQEF 189



>gb:BC023708_2094224 Mus musculus cDNA clone MGC:38398 IMAGE:5345780,
            complete cds.>gb:BC023742_2094238 Mus musculus cDNA clone
            MGC:38531 IMAGE:5353453, complete cds.
          Length = 642

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 63/265 (23%), Positives = 120/265 (45%), Gaps = 6/265 (2%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L+  + R W +M   H+ Q +I+  + S    +  K  S+ H   T QL  V+Q+
Sbjct: 376  PQLFELLHGLLRTWNSMLETHDIQRKIMREINSFSCPEHGKFCSDSHRLATIQLEAVIQD 435

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSS-----PQRPQNPPILALLHA 673
            WH  F   +  QK Y + L  WL      ID   +   +S     P R   P ++     
Sbjct: 436  WHYCFSDYVSAQKTYAKSLLSWLSKF---IDAEAEYHYTSSFSLPPIRFNGPTLIVTCQR 492

Query: 672  WQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYH 493
            W   + +LPD+  K A+ S +  +  +   Q  E + K +     KE+ ++   F     
Sbjct: 493  WSTSMERLPDKSVKYAMKSLAKDLQALSVQQGAEQQQKRKVDGLDKEINRKILTFGKAED 552

Query: 492  K-YMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSL 316
            K  + + T + + E+    +  +++E++  L+  K++++ E E Y     +    ++  L
Sbjct: 553  KALLAKYTAHHNAEE----QVESLVEKKQLLQMFKEQVEMERERYFSTVQETERMTMERL 608

Query: 315  RTGLPELFHAMSEFSRACSIMYQTL 241
            + G   +F ++ +F+RA + +Y  L
Sbjct: 609  QMGFSSVFESLVDFARASTKVYADL 633



>pir|A86351|A86351 hypothetical protein F8K7.18 - Arabidopsis
            thaliana>gb:AE005172_891124 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:F8K7_1678628
            Arabidopsis thaliana chromosome 1 BAC F8K7 sequence,
            complete sequence.
          Length = 953

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 59/260 (22%), Positives = 117/260 (45%), Gaps = 11/260 (4%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L+  + RMW +M   H+ Q Q ++  +   +  +     +   +    L + ++E
Sbjct: 676  PQLTQLIHGLIRMWRSMLKCHQKQFQAIMESKVRSLRANTGLQRDSGLKAILDLEMELRE 735

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLK--LNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD 664
            W   F   +  QK Y+  LN WL   L+  P  T       SP R   P +  +   WQ+
Sbjct: 736  WCISFNDWVNTQKSYVESLNGWLSRCLHYEPESTEDGIAPFSPSRVGAPQVFVICKDWQE 795

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM 484
             + ++  E    A+  F++ ++ + + Q +E + + + +    + EKR     D   +  
Sbjct: 796  AMARISGENVSNAMQGFASSLHELWERQDEEQRQRVKAEYVSHDFEKR---LNDLRMERA 852

Query: 483  QRRTPNDDTEQDGPHEDNNVI---------ERQLQLEALKQRLKEEEEAYMRQCMQVRVK 331
            + R  ND   QDG  E + V+         + ++ L++++++L+EE   +      V   
Sbjct: 853  RVRMRNDQL-QDGASEKSVVLSESGISALDDLKVDLDSMRKKLEEERARHKETIKLVNNA 911

Query: 330  SLTSLRTGLPELFHAMSEFS 271
            + +SL+ GL  +F A+  F+
Sbjct: 912  ASSSLQAGLVPIFEALGNFT 931



>gb:AC109595_1738722 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1212_B02, complete sequence.
          Length = 872

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 66/269 (24%), Positives = 120/269 (44%), Gaps = 2/269 (0%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P L  L++ + RMW+ +   H  Q   +L  +S  +   PK   E + + T +L + +  
Sbjct: 607  PHLVKLIQGLVRMWKFILECHRKQFHAILETKSHVLI--PKNGPERNSKITLELEMELLN 664

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS--SPQRPQNPPILALLHAWQD 664
            W S F   I+ QK YI  LN WL   L        + ++  SP R   P +    + W  
Sbjct: 665  WCSCFSNWILSQKAYIETLNGWLVKWLPEEKEETPDGIAPFSPGRLGAPAVFITANDWCQ 724

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM 484
             + ++P+     A+ +F+  V+ + + Q +E + K +     ++  KR + F+  +   +
Sbjct: 725  SMKRIPEGTVIGAMEAFAVNVHMLRERQDEEQQQKLKADYLSRDYAKRLKSFQKEHG--L 782

Query: 483  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL 304
                  D T       +  V  R + L+AL +RL E+   +     Q++  S T L+ GL
Sbjct: 783  AGHHEADKTVLPVAENNRAVDSRIVALDALHKRLDEQRSRHEEAVNQIQESSATDLKAGL 842

Query: 303  PELFHAMSEFSRACSIMYQTLESITHPLN 217
              +F A+  F++     Y   E++  P+N
Sbjct: 843  GPIFEALESFTQDTLKGY---ENVRIPIN 868



>pir|T45760|T45760 hypothetical protein F24M12.330 - Arabidopsis
            thaliana>gb:ATF24M12_1549968 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F24M12.
          Length = 602

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 67/259 (25%), Positives = 109/259 (42%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  LV+    M+E+    H+ Q  IV  L+ L+   S + TSE H + T QL +    
Sbjct: 375  PQLVELVKGS--MYES----HQVQTHIVQQLKYLNTIPSTEPTSELHRQSTLQLEL---- 424

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
               +F K  + +  Y                                 I +    W   I
Sbjct: 425  ---EFSKNPLVRSSY------------------------------ESKIYSFCEEWHLAI 451

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
             ++PD++A   I SF   V+ IV  Q DE K K R +   K+ EK++        KY   
Sbjct: 452  DRIPDKVASEGIKSFLTAVHGIVAQQADEHKQKKRTESMLKDFEKKSASLRALESKYSPY 511

Query: 477  RTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPE 298
              P          + N VIE+++++E LK + +EE+  + +     R  +L +L+ G P 
Sbjct: 512  SVPES-------RKKNPVIEKRVKVEMLKGKAEEEKSKHEKSVSVTRAMTLNNLQMGFPH 564

Query: 297  LFHAMSEFSRACSIMYQTL 241
            +F AM  FS  C   ++++
Sbjct: 565  VFQAMVGFSSVCMQAFESV 583



>pir|T06133|T06133 hypothetical protein F23E12.200 - Arabidopsis
            thaliana>gb:ATCHRIV83_1547485 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 83.>gb:ATF23E12_1549737
            Arabidopsis thaliana DNA chromosome 4, BAC clone F23E12
            (ESSA project).
          Length = 828

 Score = 76.6 bits (187), Expect = 7e-13
 Identities = 46/153 (30%), Positives = 78/153 (50%), Gaps = 3/153 (1%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L +L++ + RMW+TM   H++QCQ +   + L   ++ K+  + H E T  LG  +  
Sbjct: 572  PQLNALIQGLTRMWKTMLECHQSQCQAIREAQGLGPIRASKKLGDEHLEATSLLGHELIN 631

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLV--PIDTNLKEKVSSPQRPQNPPILALLHAWQD 664
            W   F   +  QK Y++ LN WL   L+  P +T       SP R   PPI  + + W  
Sbjct: 632  WILGFSSWVSAQKGYVKELNKWLMKCLLYEPEETPDGIVPFSPGRIGAPPIFVICNQWSQ 691

Query: 663  LIGKLPDELAKTAIYSF-SAVVNTIVQHQLDEM 568
             + ++ ++    A+ SF ++V+    Q +LD M
Sbjct: 692  ALDRISEKEVIEAMRSFTTSVLQLWEQDRLDTM 724



>gb:AY080860_1568550 Arabidopsis thaliana unknown protein (At1g77500)
            mRNA, partial cds.
          Length = 666

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 54/251 (21%), Positives = 111/251 (44%), Gaps = 2/251 (0%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L+  + RMW +M   H+ Q Q +   +   +  +    ++        L + ++E
Sbjct: 415  PQLIQLIHGLIRMWRSMLRCHQKQFQAIRESKVRSLKANTTLQNDSGSTAILDLEIELRE 474

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLK--LNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD 664
            W   F   +  QK Y++ L+ WL   L+  P  T+      SP +   PPI  +   WQ+
Sbjct: 475  WCISFNNWVNTQKSYVQFLSGWLTKCLHYEPEATDDGIAPFSPSQIGAPPIFIICKDWQE 534

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM 484
             + ++  E    A+  F++ ++ + + Q +E ++K + +    E E+             
Sbjct: 535  AMCRISGENVTNAMQGFASSLHELWEKQEEEQRVKAQSEQRDAESERSV---------VS 585

Query: 483  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL 304
            + R+ +  +  D         + ++ L+++++RL EE          V   S +SL+ GL
Sbjct: 586  KGRSESGISALD---------DLKVDLDSMRKRLVEERGKGKETIKLVNNASSSSLKAGL 636

Query: 303  PELFHAMSEFS 271
              +F A+ +F+
Sbjct: 637  VPIFGALRKFT 647



>pir|D96804|D96804 unknown protein T5M16.9 [imported] - Arabidopsis
            thaliana>gb:AE005173_895273 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC010704_1537019 Arabidopsis thaliana
            chromosome 1 BAC T5M16 genomic sequence, complete
            sequence.>gb:BT002322_1635925 Arabidopsis thaliana clone
            C105014 unknown protein (At1g77500) mRNA, complete cds.
          Length = 879

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 54/251 (21%), Positives = 111/251 (44%), Gaps = 2/251 (0%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L+  + RMW +M   H+ Q Q +   +   +  +    ++        L + ++E
Sbjct: 628  PQLIQLIHGLIRMWRSMLRCHQKQFQAIRESKVRSLKANTTLQNDSGSTAILDLEIELRE 687

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLK--LNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD 664
            W   F   +  QK Y++ L+ WL   L+  P  T+      SP +   PPI  +   WQ+
Sbjct: 688  WCISFNNWVNTQKSYVQFLSGWLTKCLHYEPEATDDGIAPFSPSQIGAPPIFIICKDWQE 747

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM 484
             + ++  E    A+  F++ ++ + + Q +E ++K + +    E E+             
Sbjct: 748  AMCRISGENVTNAMQGFASSLHELWEKQEEEQRVKAQSEQRDAESERSV---------VS 798

Query: 483  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL 304
            + R+ +  +  D         + ++ L+++++RL EE          V   S +SL+ GL
Sbjct: 799  KGRSESGISALD---------DLKVDLDSMRKRLVEERGKGKETIKLVNNASSSSLKAGL 849

Query: 303  PELFHAMSEFS 271
              +F A+ +F+
Sbjct: 850  VPIFGALRKFT 860



>gb:BT000504_1634782 Arabidopsis thaliana unknown protein
            (At4g35240/F23E12_200) mRNA, complete
            cds.>gb:AF412083_1797336 Arabidopsis thaliana
            AT4g35240/F23E12_200 mRNA, complete cds.
          Length = 399

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 59/235 (25%), Positives = 102/235 (43%), Gaps = 5/235 (2%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            +L  L++ +++MW++M   H++QC+ +   R L   ++ K     H E T  LG  +  W
Sbjct: 154  QLNELIQGLSKMWKSMLECHKSQCEAIKEARGLGPIRASKNFGGEHLEVTRTLGYELINW 213

Query: 834  HSQFEKMIIHQKEYIRGLNDWLK--LNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
               F   +  QK ++R LN WL   L   P +T       SP R   P I  + + W+  
Sbjct: 214  IVGFSSWVSAQKGFVRELNSWLMKCLFYEPEETPDGIVPFSPGRIGAPMIFVICNQWEQA 273

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQ 481
            + ++ ++    AI  F+    T V H  ++ +L  R +       +   + E    K +Q
Sbjct: 274  LDRISEKEVIEAIRRFT----TSVLHLWEQDRLATRERIIGHGDPRNMDREEQRIQKEIQ 329

Query: 480  RRTPNDDTEQDGPHEDNNVIERQLQLEALK---QRLKEEEEAYMRQCMQVRVKSL 325
                       GP EDN V +     E+L+   QR+ E  E +  + ++  V  L
Sbjct: 330  ELEMK--MVLVGPGEDNIVYQSDTSNESLQGSLQRIFEAMERFTEESLKAYVDLL 382



>gb:AP005251_1849587 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OSJNBb0011H15.
          Length = 937

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 61/265 (23%), Positives = 112/265 (42%), Gaps = 6/265 (2%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+   L++ + +MW  M   H+ QC  +   R+LD        SE H +   +L + + E
Sbjct: 666  PQTCELIQGLMQMWHAMSKCHQIQCHAISQARNLDSKLDSARFSEAHMDLIKRLELQLLE 725

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLK--LNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQD 664
              S F   +  QK ++  LN+WLK  ++ VP  T+      SP R   PPI  + + W  
Sbjct: 726  LISSFATWVNAQKSFVGTLNEWLKRGIDYVPEVTDDGTPPFSPGRLGAPPIFIICNNWAI 785

Query: 663  LIGKLPDELAKTAIYSF-SAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKY 487
              G++ ++     + +F S+V++   +H+L+  +     KD  ++L            + 
Sbjct: 786  GTGRISEKEVVDKMQAFASSVLHLWEKHRLEWRQGMMANKDMDRDL------------RV 833

Query: 486  MQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTS---L 316
            M+R              D   + + L  ++ K  L   +         V     T+   L
Sbjct: 834  MER--------------DELSMRKALDAQSKKLVLVSNQSGVSLSAQVVHDSGPTAEVGL 879

Query: 315  RTGLPELFHAMSEFSRACSIMYQTL 241
            ++ + ++F AM  F+ AC+  Y  L
Sbjct: 880  QSCMNKVFEAMESFTAACANAYSDL 904



>pir|T52411|T52411 bZIP protein [imported] - Arabidopsis
            thaliana>gb:ATU17887_1556785 Arabidopsis thaliana bZIP
            protein mRNA, complete cds.
          Length = 369

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 40/152 (26%), Positives = 75/152 (49%), Gaps = 1/152 (0%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRS-LDMSQSPKETSEHHYERTYQLGVVVQ 841
            P+L  L      MW++M  +HE Q  IV  +R  ++ S   + TSE H + T  L   V 
Sbjct: 223  PQLVELCHGFMYMWKSMHQYHETQNSIVEQVRGVINRSGKGESTSELHRQATRDLESAVS 282

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
             WHS F  +I  Q+++I  ++ W KL L+P+     ++ ++    +     A    W+  
Sbjct: 283  SWHSSFSSLIKFQRDFIHSVHAWFKLTLLPV----WQQHAANHHKEPLDAYAFCDEWKLA 338

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMK 565
            + ++PD +A     + S+ ++  ++ Q D+ +
Sbjct: 339  LDRIPDTVASEESRA-SSTLSRDIRKQADDTR 369



>pir|F84668|F84668 hypothetical protein At2g27090 [imported] -
            Arabidopsis thaliana>gb:AC005623_1532857 Arabidopsis
            thaliana chromosome 2 clone T20P8 map B68, complete
            sequence.>gb:BT012583_1641653 Arabidopsis thaliana
            At2g27090 mRNA, complete cds.
          Length = 743

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 51/175 (29%), Positives = 82/175 (46%), Gaps = 4/175 (2%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLA-LRSLDMSQSPKETSEHHYERTYQLGVVVQ 841
            P+L+ L+E ++RMWE M   H+ Q Q++ A  R  ++  + +  SE H + T  L   + 
Sbjct: 512  PQLEELIEGLSRMWEVMLECHKVQFQLIKACYRGGNIKLNMQ--SELHRQVTSHLEDELC 569

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQ---RPQNPPILALLHAW 670
               S F K I  QK YI+ +N+WL +  V +    K K  +PQ   R   PPI A    W
Sbjct: 570  ALASSFTKWITGQKSYIQAINEWL-VKCVALPQRSKRKRRAPQPSLRNYGPPIYATCGIW 628

Query: 669  QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFE 505
             + +  LP +    +I + ++ V   +  Q      K R  + + +L     Q E
Sbjct: 629  LEKLEVLPTKEVSGSIKALASDVARFLPRQEKNRTKKHRSGENKNDLTAHMLQDE 683



>pir|B84548|B84548 hypothetical protein At2g17100 [imported] -
            Arabidopsis thaliana>gb:AC002354_1530571 Arabidopsis
            thaliana chromosome II section 98 of 255 of the complete
            sequence. Sequence from clones F12A24, F6P23.
          Length = 693

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 57/227 (25%), Positives = 97/227 (42%), Gaps = 5/227 (2%)
 Frame = -1

Query: 990  MARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQFEKMI 811
            +++MW++M   H++QC+ +   R L   ++ K     H E T  LG  +  W   F   +
Sbjct: 456  LSKMWKSMLECHKSQCEAIKEARGLGPIRASKNFGGEHLEVTRTLGYELINWIVGFSSWV 515

Query: 810  IHQKEYIRGLNDWLK--LNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDEL 637
              QK ++R LN WL   L   P +T       SP R   P I  + + W+  + ++ ++ 
Sbjct: 516  SAQKGFVRELNSWLMKCLFYEPEETPDGIVPFSPGRIGAPMIFVICNQWEQALDRISEKE 575

Query: 636  AKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDT 457
               AI  F+    T V H  ++ +L  R +       +   + E    K +Q        
Sbjct: 576  VIEAIRRFT----TSVLHLWEQDRLATRERIIGHGDPRNMDREEQRIQKEIQELEMK--M 629

Query: 456  EQDGPHEDNNVIERQLQLEALK---QRLKEEEEAYMRQCMQVRVKSL 325
               GP EDN V +     E+L+   QR+ E  E +  + ++  V  L
Sbjct: 630  VLVGPGEDNIVYQSDTSNESLQGSLQRIFEAMERFTEESLKAYVDLL 676



>gb:AP005862_1859200 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OSJNBa0038K02.
          Length = 912

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/153 (24%), Positives = 72/153 (47%), Gaps = 2/153 (1%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+   L++ + RMW TM   H+ Q   +   +++D   +  +  E H +   +L +   +
Sbjct: 652  PQTCELIQGLMRMWSTMLECHQIQLHAISHAKNIDSMINGAKFGEAHMDLIKRLELQHLD 711

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLV--PIDTNLKEKVSSPQRPQNPPILALLHAWQD 664
            W + F   +  QK Y+  LNDWL+  +   P  T+      SP R   PPI  + + W  
Sbjct: 712  WIASFASWVNAQKSYVGTLNDWLRKGVTYEPEVTDDGVPPFSPGRLGAPPIFVIYNNWAV 771

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMK 565
             +G++ ++    A+ +F++ V  + +    E +
Sbjct: 772  GVGRISEKEVVEAMQAFASNVLGLWERHRSEQR 804



>gb:AE005172_891008 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC027665_1539906 Genomic sequence
            for Arabidopsis thaliana BAC F5M15 from chromosome I,
            complete sequence.
          Length = 614

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 40/181 (22%), Positives = 81/181 (44%), Gaps = 1/181 (0%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            ++K L+  ++ MW +M   H  Q +++   + LD     +       E   +L + ++ W
Sbjct: 395  QMKELIHRLSEMWNSMLECHSRQSKVIAEAKKLDKMTIKENLDLSQLELAMELKLELRNW 454

Query: 834  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAW-QDLI 658
                   I  Q +Y++ LN+WL   L       + +  +P   + PP+   ++ W Q+L 
Sbjct: 455  SLSMSNWIDAQAQYVKALNNWLMRCL-----KQEPQEPTPDLSEEPPLFGAINTWSQNLE 509

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
                ++    A+Y+    VN  V+ Q  E++ +     + K++E++    E    K MQR
Sbjct: 510  ISHGEKEFTEAVYTILMHVNHQVEKQRMELEEQRNVNGSVKDIERKLMMLEKEEQK-MQR 568

Query: 477  R 475
            +
Sbjct: 569  K 569



>gb:AP004858_1846104 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1725_H08.>gb:AP005055_1847349 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0684A08.
          Length = 368

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 55/251 (21%), Positives = 107/251 (42%), Gaps = 2/251 (0%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P++ +L++   +MW+     +  QCQ +   ++LD   S   +     +   +L + + +
Sbjct: 118  PQVNTLIQGFVKMWQDKLNCYHIQCQAISEAKNLDSIISGGTSR----DLAMELELELIK 173

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS--SPQRPQNPPILALLHAWQD 664
            W   F   +  Q+ +I+ LN WL L L        + V   SP R   P +  + ++W  
Sbjct: 174  WIVNFSSWVNEQRSFIKALNGWLALCLNYQQEETADGVPPYSPGRVGAPLVFVICNSWSQ 233

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM 484
             + ++ +   K  I S  A+V+++       +  K   + T + +  R R  E W +K +
Sbjct: 234  AMDRISE---KEVITSMQALVSSV-----RSLWEKQNVEQTEQLIAIRER--EKW-NKIL 282

Query: 483  QRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGL 304
            +R+T   + E D        + R+L L   +Q L    + Y     QV      S++  L
Sbjct: 283  ERKTLEINKEAD-------TLNRKLALVPGRQSLLPTAQTY-----QVHFLEANSVQVSL 330

Query: 303  PELFHAMSEFS 271
              +  A+  +S
Sbjct: 331  KRVLEALESYS 341



>gb:AP003238_1825987 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0401G10.
          Length = 834

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 59/267 (22%), Positives = 104/267 (38%), Gaps = 17/267 (6%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVL-----ALRSLDMSQSPKETSEHHYERTYQLG 853
            P+L  L+  + RMW+ +   HE Q   +       ++++ +SQS           T +L 
Sbjct: 568  PQLVDLIIGLRRMWKAVLLCHEKQLSAIQDSKMHLIKAVTISQSNAAAVA-----TVELE 622

Query: 852  VVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVS-----SPQRPQNPPIL 688
              + +W+  F K I  Q+ Y   LN WL+  L   +   +         SP +   PP+ 
Sbjct: 623  RELAKWYRCFNKWISSQRSYAEALNGWLRKWLTEPEVQEENTPDGAPPFSPGKLGAPPVF 682

Query: 687  ALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQF 508
             + + W  +I  +        I  FS +V+   + Q  E + K +     ++  KR    
Sbjct: 683  VISNDWLQVIEMVSKNEVLKTIDQFSKLVHEYKKTQEKEHRQKRKADHASRDYNKR---- 738

Query: 507  EDWYHKYMQRRTPNDDT-------EQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQC 349
                 K +QR      +       E      DN VIE    LE + ++  EE+  +    
Sbjct: 739  ----RKVLQRELGLSTSLDMVAVMENTHHSHDNRVIE----LEKMSRKKDEEKTKHDEIV 790

Query: 348  MQVRVKSLTSLRTGLPELFHAMSEFSR 268
                + +  +L  GL  + H +  FS+
Sbjct: 791  KHAHLAASATLPVGLVPVLHQIVSFSQ 817



>gb:AC087553_1734122 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0685E10, complete sequence.
          Length = 722

 Score = 57.0 bits (136), Expect = 6e-07
 Identities = 49/155 (31%), Positives = 70/155 (45%), Gaps = 7/155 (4%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L++ + RMW+TM   H  Q  I ++L     S +  +  EHH+     L   +  
Sbjct: 486  PQLVELIQGLIRMWKTMLECHHKQF-ITISLAYHVKSATTVQQGEHHHRAATHLWNELDC 544

Query: 837  WHSQFEKMIIHQKEYIRGLNDWL-KLNLVPIDT--NLKEKVSSPQR-PQNPPILALLHAW 670
            + S F+  +   K Y+  LN WL K  L P       K KVS P R   +PPI  L   W
Sbjct: 545  FSSSFKIWVTAHKSYVESLNAWLQKCVLQPAQDRWRRKRKVSFPPRHALSPPIFVLCRDW 604

Query: 669  QDLI--GKLP-DELAKTAIYSFSAVVNTIVQHQLD 574
              ++    LP DEL K +I     ++     HQ D
Sbjct: 605  LTMMESQSLPTDELCK-SIKEVVQLLRGSFDHQAD 638



>pir|T01368|T01368 hypothetical protein At2g34670 [imported] -
            Arabidopsis thaliana>gb:AC003096_1531079 Arabidopsis
            thaliana chromosome 2 clone T29F13 map ve016, complete
            sequence.
          Length = 664

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 54/272 (19%), Positives = 112/272 (41%), Gaps = 9/272 (3%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L +L   +A+MW+TM   H+ Q  I   L  L    S   +SE+  +   +L   V  
Sbjct: 421  PQLVALTSGLAQMWKTMLKCHQVQIHISQQLNHLPDYPSIDLSSEYKRQAVNELETEVTC 480

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNP-PILA--LLHAWQ 667
            W++ F K++  Q+EY++ L  W++L          +++S+    ++  P+ A  L   WQ
Sbjct: 481  WYNSFCKLVNSQREYVKTLCTWIQLT---------DRLSNEDNQRSSLPVAARKLCKEWQ 531

Query: 666  DLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKY 487
                                           E  L+ +C    + LEK      +     
Sbjct: 532  ------------------------------LEYNLRRKCNKLERRLEKELISLAE----- 556

Query: 486  MQRR------TPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL 325
            ++RR         ++         + +  +Q ++EAL++R+  E+  Y+      +  +L
Sbjct: 557  IERRLEGILAMEEEEVSSTSLGSKHPLSIKQAKIEALRKRVDIEKTKYLNSVEVSKRMTL 616

Query: 324  TSLRTGLPELFHAMSEFSRACSIMYQTLESIT 229
             +L++ LP +F  ++  +   +  ++++   T
Sbjct: 617  DNLKSSLPNVFQMLTALANVFANGFESVNGQT 648



>gb:AK118990_1816935 Arabidopsis thaliana At2g34670 mRNA for unknown
            protein, complete cds, clone: RAFL21-32-H17.
          Length = 561

 Score = 55.8 bits (133), Expect = 1e-06
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 3/130 (2%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L +L   +A+MW+TM   H+ Q  I   L  L    S   +SE+  +   +L   V  
Sbjct: 421  PQLVALTSGLAQMWKTMLKCHQVQIHISQQLNHLPDYPSIDLSSEYKRQAVNELETEVTC 480

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNP-PILA--LLHAWQ 667
            W++ F K++  Q+EY++ L  W++L          +++S+    ++  P+ A  L   WQ
Sbjct: 481  WYNSFCKLVNSQREYVKTLCTWIQLT---------DRLSNEDNQRSSLPVAARKLCKEWQ 531

Query: 666  DLIGKLPDEL 637
             +  KLPD++
Sbjct: 532  LVFEKLPDKV 541



>gb:AP005525_1853470 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC
            clone:P0564H06.>gb:AP005580_1854443 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OJ1759_F09.
          Length = 735

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 2/128 (1%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L++ + RMW  M   H  Q  IV +   + + +SP+   E + +    L   +  
Sbjct: 483  PQLLELLKGLTRMWAMMHEIHRVQQTIVSSSDIVYVLRSPR--GEPYKQPLVNLVNEMGF 540

Query: 837  WHSQFEKMIIHQKEYIRGLNDWL-KLNLVPID-TNLKEKVSSPQRPQNPPILALLHAWQD 664
            ++S     I   K Y+ GL+ WL K  L P D T  +    SP+R   PP+  LL  W  
Sbjct: 541  FYSSLTNWIAAYKCYVDGLHSWLQKCVLQPYDHTRGRRLTLSPRRHLAPPMFVLLDDWSS 600

Query: 663  LIGKLPDE 640
             I  LP E
Sbjct: 601  AIASLPGE 608



>pir|T08989|T08989 hypothetical protein F6G3.160 - Arabidopsis
            thaliana>gb:ATCHRIV72_1546934 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 72.>gb:ATF6G3_1550840
            Arabidopsis thaliana DNA chromosome 4, BAC clone F6G3
            (ESSA project).>gb:AY056278_1563592 Arabidopsis thaliana
            unknown protein (At4g30130) mRNA, complete
            cds.>gb:BT001979_1635582 Arabidopsis thaliana clone
            U11129 unknown protein (At4g30130) mRNA, complete cds.
          Length = 725

 Score = 46.6 bits (109), Expect = 8e-04
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 12/161 (7%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHE------NQCQIVLALRSLDMSQSPKETS--EHHYER-- 868
            P+L  LV+ +A+MW+ M   H+      ++ +++LA    +  +  ++TS  E + +R  
Sbjct: 485  PQLLELVQGLAQMWKVMAECHQIQKRTLDEAKLLLATTPSNRHKKQQQTSLPEINSQRLA 544

Query: 867  --TYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP 694
                 L V ++ W + F+  I  Q+ YI  L  WL L     D +  EKV+    P   P
Sbjct: 545  RSALHLVVQLRNWRACFQAWITSQRSYILSLTGWL-LRCFRCDPD-PEKVTLTSCPH--P 600

Query: 693  ILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDE 571
            I  +   W  L+  L ++     +  F++ +  I   QL E
Sbjct: 601  IYEVCIQWSRLLNGLNEKPVLDKLDFFASGMGAIYARQLKE 641



>gb:AP003813_1833722 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1150_E04.>gb:AP003818_1833805 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OJ1200_C08.
          Length = 909

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 49/158 (31%), Positives = 64/158 (40%), Gaps = 12/158 (7%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQE 838
            P+L  L+ S+ RMWETM   H  Q  I + L S   S      SE   +    L   + +
Sbjct: 699  PQLDELIRSLTRMWETMLECHHLQLAI-MKLVSSKRSVKLSFQSESECQDALLLSAKLIK 757

Query: 837  WHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQN-----------PPI 691
              S F+  +   K Y+  LN WL   + P    LK++  S  R QN            PI
Sbjct: 758  LCSDFQNWVASHKVYLSSLNLWLHKCMKP----LKKRKGS--RKQNVVDVSLTECAVAPI 811

Query: 690  LALLHAWQDLIGK-LPDELAKTAIYSFSAVVNTIVQHQ 580
                  W  LI   L +EL K AI +  A V     HQ
Sbjct: 812  FTTCEIWIKLIDDLLTNELVK-AIENLVADVGRSFPHQ 848



>gb:AC012679_1537795 Arabidopsis thaliana chromosome 1 BAC F25P22
           genomic sequence, complete sequence.
          Length = 1050

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 29/102 (28%), Positives = 55/102 (53%), Gaps = 4/102 (3%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYM-QRRTPNDDTEQDGPHEDNNVIERQ 412
           QH L+   LK   + T+++ E++  Q E    K   + +  N++ + D   ++N+  +  
Sbjct: 262 QHNLEISALKQELETTKRKYEQQYSQIESQTKKSKWEEQKKNEEEDMDKLLKEND--QFN 319

Query: 411 LQLEALKQRLKEEEEAYMRQCMQVRVKSL---TSLRTGLPEL 295
           LQ+ AL+Q L+   +AY +QC Q+  +++   T L + L EL
Sbjct: 320 LQISALRQELETTRKAYEQQCSQMESQTMVATTGLESRLKEL 361



>gb:AY735668_1625710 Arabidopsis thaliana hypothetical protein
            AT4G39790 mRNA, complete cds.
          Length = 657

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 6/142 (4%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETM-KGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQ 841
            P+L   ++ + RMW+ M + HH     I LA      S++  E+      +   L  +++
Sbjct: 459  PQLLEFLQGLIRMWKAMLECHHTQYITISLAYHCRHSSKTAHES----VLKRRILAELLE 514

Query: 840  EWHS---QFEKMIIHQKEYIRGLNDWL-KLNLVPIDTNLKEKVS-SPQRPQNPPILALLH 676
            E       F  ++     Y+  LN WL    L+P + + + +   SP+R   PPI  L  
Sbjct: 515  ETECFGLSFVDLVHSMASYVEALNGWLHNCVLLPQERSTRNRRPWSPRRVLAPPIFVLCR 574

Query: 675  AWQDLIGKLPDELAKTAIYSFS 610
             W   I  LP +    +I  FS
Sbjct: 575  DWSAGIKTLPSDELSGSIKGFS 596



>gb:AB026634_1517042 Arabidopsis thaliana genomic DNA, chromosome 5,
            BAC clone:F24B18.
          Length = 720

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 49/258 (18%), Positives = 100/258 (38%)
 Frame = -1

Query: 1002 LVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHSQF 823
            ++     MW  +   H  Q +++   +S        E      + T Q+   ++ +    
Sbjct: 489  IINGFKTMWRFLAKCHHKQFRVIARSKSC---VHIVENGSSSRKATQQVEKQIRRYRESL 545

Query: 822  EKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPD 643
            +  I   + +++ LN+WL   ++  D    E          P I  +   W   I  +  
Sbjct: 546  KGYIDAHRGFVKLLNEWLNRIIMEDDETETEA---------PEIFRVCSEWLREIENVDT 596

Query: 642  ELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPND 463
                + +         +   Q++E K + R +   KELEK+T++ E+       R T   
Sbjct: 597  IKVLSVVEEMRLRFQGLGFKQVEEEKQRMRTERLSKELEKKTKELEE------IRGT--- 647

Query: 462  DTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAM 283
                 G    +N++E +L    L++ + +E E + R   ++      SL+  +  +F A+
Sbjct: 648  ----RGSSPTSNMVEPELLF--LRESVTQETEKHERLIRELNDAVSMSLQECMVPVFEAL 701

Query: 282  SEFSRACSIMYQTLESIT 229
             +F  A    YQ +  +T
Sbjct: 702  GDFCFANFKAYQNIVIVT 719



>pir|T05016|T05016 hypothetical protein T19P19.180 - Arabidopsis
            thaliana>gb:ATCHRIV91_1547963 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 91.>gb:ATT19P19_1554866
            Arabidopsis thaliana DNA chromosome 4, BAC clone T19P19
            (ESSA project).
          Length = 631

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 37/142 (26%), Positives = 61/142 (42%), Gaps = 6/142 (4%)
 Frame = -1

Query: 1017 PKLKSLVESMARMWETM-KGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQ 841
            P+L   ++ + RMW+ M + HH     I LA      S++  E+      +   L  +++
Sbjct: 433  PQLLEFLQGLIRMWKAMLECHHTQYITISLAYHCRHSSKTAHES----VLKRRILAELLE 488

Query: 840  EWHS---QFEKMIIHQKEYIRGLNDWL-KLNLVPIDTNLKEKVS-SPQRPQNPPILALLH 676
            E       F  ++     Y+  LN WL    L+P + + + +   SP+R   PPI  L  
Sbjct: 489  ETECFGLSFVDLVHSMASYVEALNGWLHNCVLLPQERSTRNRRPWSPRRVLAPPIFVLCR 548

Query: 675  AWQDLIGKLPDELAKTAIYSFS 610
             W   I  LP +    +I  FS
Sbjct: 549  DWSAGIKTLPSDELSGSIKGFS 570



>pir|B96766|B96766 protein kinesin F2P9.27 [imported] - Arabidopsis
           thaliana>gb:AE005173_894932 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016662_1538239 Arabidopsis thaliana
           chromosome 1 BAC F2P9 genomic sequence, complete
           sequence.
          Length = 987

 Score = 41.6 bits (96), Expect = 0.026
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 6/104 (5%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYH---KYMQRRTPNDDTEQDGPHEDNNVIE 418
           QH L+   LK   + T+++ E++  Q E          + +  N++ + D   ++N+  +
Sbjct: 230 QHNLEISALKQELETTKRKYEQQYSQIESQTKTEKSKWEEQKKNEEEDMDKLLKEND--Q 287

Query: 417 RQLQLEALKQRLKEEEEAYMRQCMQVRVKSL---TSLRTGLPEL 295
             LQ+ AL+Q L+   +AY +QC Q+  +++   T L + L EL
Sbjct: 288 FNLQISALRQELETTRKAYEQQCSQMESQTMVATTGLESRLKEL 331



>gb:CR749347_1180974 Homo sapiens mRNA; cDNA DKFZp781D1722 (from clone
            DKFZp781D1722).
          Length = 292

 Score = 40.8 bits (94), Expect = 0.044
 Identities = 50/215 (23%), Positives = 90/215 (41%)
 Frame = -1

Query: 1014 KLKSLVESMARMWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEW 835
            KLK   ++  R+   ++ +   +C++  AL+  D SQ+ K   E  ++RT       +EW
Sbjct: 76   KLKDKSQNQERLEREIESY---RCRLAAALQDRDQSQASKRDVECDFQRTR------EEW 126

Query: 834  HSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIG 655
                EKM                 NL   +  L EK+S+ +      I +L   W     
Sbjct: 127  FHLKEKMNFDMS------------NLKDKNELLSEKLSNAEN----KIRSLKMKWHQTKD 170

Query: 654  KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR 475
             L ++              T+V   +     + +C+  RKE+E+  +  ED   KY+Q++
Sbjct: 171  ALKEK--------------TLVLEDVQRDLTQSQCR--RKEIEQMFQNEEDKVSKYIQKQ 214

Query: 474  TPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEE 370
               +  E+    ++ N++ RQ   EA K+   +EE
Sbjct: 215  ESLE--ERLSQIQNENLLLRQQLDEAYKKADNQEE 247



>gb:AE014134_1129509 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003655_1219616 Drosophila melanogaster
            chromosome 2L, section 64 of 83 of the complete sequence.
          Length = 1652

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/83 (24%), Positives = 45/83 (54%)
 Frame = -1

Query: 564  LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
            +K+  K+T  +L++R ++FE+   K  Q +      +Q+       + E Q  L+ L+  
Sbjct: 1135 IKEELKETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDS 1194

Query: 384  LKEEEEAYMRQCMQVRVKSLTSL 316
            +K++EE  + Q ++ +V+  +S+
Sbjct: 1195 VKQKEE--LVQNLEEKVRESSSI 1215



>gb:AE014134_1129508 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003655_1219615 Drosophila melanogaster
            chromosome 2L, section 64 of 83 of the complete sequence.
          Length = 1677

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/83 (24%), Positives = 45/83 (54%)
 Frame = -1

Query: 564  LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
            +K+  K+T  +L++R ++FE+   K  Q +      +Q+       + E Q  L+ L+  
Sbjct: 1160 IKEELKETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDS 1219

Query: 384  LKEEEEAYMRQCMQVRVKSLTSL 316
            +K++EE  + Q ++ +V+  +S+
Sbjct: 1220 VKQKEE--LVQNLEEKVRESSSI 1240



>gb:AE014134_1129507 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003655_1219614 Drosophila melanogaster
            chromosome 2L, section 64 of 83 of the complete
            sequence.>gb:AY118896_1300618 Drosophila melanogaster
            LD05834 full insert cDNA.
          Length = 1689

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/83 (24%), Positives = 45/83 (54%)
 Frame = -1

Query: 564  LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
            +K+  K+T  +L++R ++FE+   K  Q +      +Q+       + E Q  L+ L+  
Sbjct: 1172 IKEELKETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDS 1231

Query: 384  LKEEEEAYMRQCMQVRVKSLTSL 316
            +K++EE  + Q ++ +V+  +S+
Sbjct: 1232 VKQKEE--LVQNLEEKVRESSSI 1252



>pir|T13030|T13030 microtubule binding protein D-CLIP-190 - fruit fly 
            (Drosophila melanogaster)>gb:AF041382_1235782 Drosophila
            melanogaster microtubule binding protein D-CLIP-190 mRNA,
            complete cds.
          Length = 1690

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/83 (24%), Positives = 45/83 (54%)
 Frame = -1

Query: 564  LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
            +K+  K+T  +L++R ++FE+   K  Q +      +Q+       + E Q  L+ L+  
Sbjct: 1173 IKEELKETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDS 1232

Query: 384  LKEEEEAYMRQCMQVRVKSLTSL 316
            +K++EE  + Q ++ +V+  +S+
Sbjct: 1233 VKQKEE--LVQNLEEKVRESSSI 1253



>sp|Q9VJE5|C190_DROME Restin homolog (Cytoplasmic linker protein 190)
            (Microtubule binding protein 190)
            (d-CLIP-190).>gb:AE014134_1129506 Drosophila melanogaster
            chromosome 2L, complete sequence.>gb:AE003655_1219613
            Drosophila melanogaster chromosome 2L, section 64 of 83
            of the complete sequence.
          Length = 1690

 Score = 38.5 bits (88), Expect = 0.22
 Identities = 20/83 (24%), Positives = 45/83 (54%)
 Frame = -1

Query: 564  LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
            +K+  K+T  +L++R ++FE+   K  Q +      +Q+       + E Q  L+ L+  
Sbjct: 1173 IKEELKETHLQLDERQKKFEELEEKLKQAQQSEQKLQQESQTSKEKLTEIQQSLQELQDS 1232

Query: 384  LKEEEEAYMRQCMQVRVKSLTSL 316
            +K++EE  + Q ++ +V+  +S+
Sbjct: 1233 VKQKEE--LVQNLEEKVRESSSI 1253



>gb:AF120932_1769769 Arabidopsis thaliana SMC-like protein (MIM)
           gene, complete cds.>gb:AF120933_1769770 Arabidopsis
           thaliana SMC-like protein (MIM) mRNA, complete cds.
          Length = 1055

 Score = 38.1 bits (87), Expect = 0.28
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = -1

Query: 633 KTAIYSFSAVVNTIVQHQLD-EMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDT 457
           K  I SF     T V+ ++  + +   +C   +K ++ R R+ E       ++   N   
Sbjct: 313 KREIESFHQSAKTAVREKIALQEEFNHKCNYVQK-IKDRVRRLERQVGDINEQTMKNTQA 371

Query: 456 EQDGPHEDNNVIERQLQ-LEALKQRLKEEEEAYMRQCMQVRVK 331
           EQ    E    +ER+++ +E L+ RLKEEE  ++ +  + R K
Sbjct: 372 EQSEIEEKLKYLEREVEKVETLRSRLKEEENCFLEKAFEGRKK 414



>gb:HSA132949_2000346 Homo sapiens mRNA for rfg5 protein.
          Length = 585

 Score = 37.0 bits (84), Expect = 0.63
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 6/176 (3%)
 Frame = -1

Query: 735 KEKVSS----PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEM 568
           KE VSS    P     P      H   +L  +L ++L +  + S +  + +++Q      
Sbjct: 199 KENVSSNAACPDHTPTPNDDGKSHELSNL--RLENQLLRNEVQSLNQEMASLLQ------ 250

Query: 567 KLKDRCKDTRKELEKRTRQFEDWY--HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
               R K+T++EL K   + E W   H    R T     + D   E   V  +  QL  L
Sbjct: 251 ----RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTE--AVAAKDSQLAVL 304

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH 226
           K RL+E +     Q +  R ++L +L++    +    SE +   +   QTL+   H
Sbjct: 305 KVRLQEAD-----QLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLH 355



>gb:BC023021_1978066 Homo sapiens golgi autoantigen, golgin
           subfamily a, 5, mRNA (cDNA clone MGC:29870
           IMAGE:4999710), complete cds.
          Length = 731

 Score = 37.0 bits (84), Expect = 0.63
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 6/176 (3%)
 Frame = -1

Query: 735 KEKVSS----PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEM 568
           KE VSS    P     P      H   +L  +L ++L +  + S +  + +++Q      
Sbjct: 199 KENVSSNAACPDHTPTPNDDGKSHELSNL--RLENQLLRNEVQSLNQEMASLLQ------ 250

Query: 567 KLKDRCKDTRKELEKRTRQFEDWY--HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
               R K+T++EL K   + E W   H    R T     + D   E   V  +  QL  L
Sbjct: 251 ----RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTE--AVAAKDSQLAVL 304

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH 226
           K RL+E +     Q +  R ++L +L++    +    SE +   +   QTL+   H
Sbjct: 305 KVRLQEAD-----QLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLH 355



>pir|I38153|I38153 gene retII protein - human>gb:HSRETTT_2019953
           Human ret-II gene.
          Length = 899

 Score = 37.0 bits (84), Expect = 0.63
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 6/176 (3%)
 Frame = -1

Query: 735 KEKVSS----PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEM 568
           KE VSS    P     P      H   +L  +L ++L +  + S +  + +++Q      
Sbjct: 199 KENVSSNAACPDHTPTPNDDGKSHELSNL--RLENQLLRNEVQSLNQEMASLLQ------ 250

Query: 567 KLKDRCKDTRKELEKRTRQFEDWY--HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
               R K+T++EL K   + E W   H    R T     + D   E   V  +  QL  L
Sbjct: 251 ----RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTE--AVAAKDSQLAVL 304

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH 226
           K RL+E +     Q +  R ++L +L++    +    SE +   +   QTL+   H
Sbjct: 305 KVRLQEAD-----QLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLH 355



>sp|Q8TBA6|GOA5_HUMAN Golgi autoantigen, golgin subfamily A member 5
           (Golgin-84) (RET-fused gene 5 protein) (Ret-II
           protein).>gb:AF085199_1881723 Homo sapiens golgin-84
           mRNA, complete cds.
          Length = 731

 Score = 37.0 bits (84), Expect = 0.63
 Identities = 44/176 (25%), Positives = 73/176 (41%), Gaps = 6/176 (3%)
 Frame = -1

Query: 735 KEKVSS----PQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEM 568
           KE VSS    P     P      H   +L  +L ++L +  + S +  + +++Q      
Sbjct: 199 KENVSSNAACPDHTPTPNDDGKSHELSNL--RLENQLLRNEVQSLNQEMASLLQ------ 250

Query: 567 KLKDRCKDTRKELEKRTRQFEDWY--HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
               R K+T++EL K   + E W   H    R T     + D   E   V  +  QL  L
Sbjct: 251 ----RSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTE--AVAAKDSQLAVL 304

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLESITH 226
           K RL+E +     Q +  R ++L +L++    +    SE +   +   QTL+   H
Sbjct: 305 KVRLQEAD-----QLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTLQERLH 355



>gb:KSU52064_2440991 Kaposi's sarcoma-associated herpes-like virus
           ORF73 homolog gene, complete cds.>gb:KSU75698_2441123
           Kaposi's sarcoma-associated herpesvirus long unique
           region, 80 putative ORF's and kaposin gene, complete
           cds.
          Length = 1162

 Score = 36.6 bits (83), Expect = 0.82
 Identities = 16/79 (20%), Positives = 46/79 (58%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q + ++ + +++ ++  +ELE++ ++ ED   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 750 QDEQEQQEEQEQQEEQEQELEEQEQELEDQEQELEEQEQELEEQEQELEEQEQELEEQEQ 809

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 810 ELEEQEQELEEQEQELEEQ 828



 Score = 35.0 bits (79), Expect = 2.4
 Identities = 18/82 (21%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = -1

Query: 588  QHQLDEMKLKDR---CKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE 418
            Q +  E +L+++    +D  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E
Sbjct: 761  QQEEQEQELEEQEQELEDQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEE 820

Query: 417  RQLQLEALKQRLKEEEEAYMRQ 352
            ++ +LE  +Q L+E+E+    Q
Sbjct: 821  QEQELEEQEQELEEQEQELEEQ 842



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 19/80 (23%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = -1

Query: 588 QHQLDEMKLKD-RCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ 412
           Q Q DE + +D + +   +E ++   Q E+   +  ++    +D EQ+   ++  + E++
Sbjct: 735 QQQQDEQQQQDEQQQQDEQEQQEEQEQQEEQEQELEEQEQELEDQEQELEEQEQELEEQE 794

Query: 411 LQLEALKQRLKEEEEAYMRQ 352
            +LE  +Q L+E+E+    Q
Sbjct: 795 QELEEQEQELEEQEQELEEQ 814



>gb:AB016887_1513154 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCI2.
          Length = 1057

 Score = 36.6 bits (83), Expect = 0.82
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 2/103 (1%)
 Frame = -1

Query: 633 KTAIYSFSAVVNTIVQHQLD-EMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDT 457
           K  I SF     T V+ ++  + +   +C   +K ++ R R+ E       ++   N   
Sbjct: 315 KREIESFHQSAKTAVREKIALQEEFNHKCNYVQK-IKDRVRRLERQVGDINEQTMKNTQA 373

Query: 456 EQDGPHEDNNVIERQLQ-LEALKQRLKEEEEAYMRQCMQVRVK 331
           EQ    E    +E++++ +E L+ RLKEEE  ++ +  + R K
Sbjct: 374 EQSEIEEKLKYLEQEVEKVETLRSRLKEEENCFLEKAFEGRKK 416



>gb:CQ783618_1452546 Sequence 3758 from Patent
            EP1396543.>gb:AK074719_1912646 Homo sapiens cDNA FLJ90238
            fis, clone NT2RM2000632, weakly similar to EXCISION
            REPAIR PROTEIN ERCC-6.
          Length = 1106

 Score = 36.2 bits (82), Expect = 1.1
 Identities = 43/211 (20%), Positives = 88/211 (41%), Gaps = 23/211 (10%)
 Frame = -1

Query: 882  HHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLK-EKVSSPQRP 706
            H+ ++  Q    + E+ SQ ++ ++ Q+   R    WL+  + P  T  K  K++ PQ P
Sbjct: 551  HYIQQRVQKAQFLVEFESQNKEFLMEQQR-TRNEGAWLREPVFPSSTKKKCPKLNKPQ-P 608

Query: 705  QNPPILALLHAWQD---------LIGKLPDELAKTAIYSFSAVVNTIVQHQ----LDEM- 568
            Q  P+L+  H  ++         +I  LP E  K  + S    V T+   +     D + 
Sbjct: 609  QPSPLLSTHHTQEEDISSKMASVVIDDLPKEGEKQDLSSIKVNVTTLQDGKGTGSADSIA 668

Query: 567  -------KLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHED-NNVIERQ 412
                    +++ C ++   +EK      +   K   +  P  +  Q+ P E  N V+ + 
Sbjct: 669  TLPKGFGSVEELCTNSSLGMEKSFATKNEAVQKETLQEGPKQEALQEDPLESFNYVLSKS 728

Query: 411  LQLEALKQRLKEEEEAYMRQCMQVRVKSLTS 319
             + +      + +++  +R C    + S+T+
Sbjct: 729  TKADIGPNLDQLKDDEVLRHCNPWPIISITN 759



>gb:AF039039_1235277 Caenorhabditis elegans cosmid T08B1, complete
           sequence.
          Length = 308

 Score = 36.2 bits (82), Expect = 1.1
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -1

Query: 588 QHQLDEM-KLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ 412
           +H+ DE  KL+D  K  R E EK   + E    K  QR+   +  E++   E   + E +
Sbjct: 57  RHENDEQAKLEDYEKARRSEREKEEEELEKLKEKQAQRKLAREQEEREAA-ERKRLDEER 115

Query: 411 LQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP 301
            Q E  ++R + EEE   ++  + ++K    +  G P
Sbjct: 116 RQKEEQERRARAEEEKKRKE--EEKLKKAQMMGGGFP 150



>gb:AF039039_1235276 Caenorhabditis elegans cosmid T08B1, complete
           sequence.
          Length = 347

 Score = 36.2 bits (82), Expect = 1.1
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -1

Query: 588 QHQLDEM-KLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ 412
           +H+ DE  KL+D  K  R E EK   + E    K  QR+   +  E++   E   + E +
Sbjct: 57  RHENDEQAKLEDYEKARRSEREKEEEELEKLKEKQAQRKLAREQEEREAA-ERKRLDEER 115

Query: 411 LQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP 301
            Q E  ++R + EEE   ++  + ++K    +  G P
Sbjct: 116 RQKEEQERRARAEEEKKRKE--EEKLKKAQMMGGGFP 150



>pir|T30896|T30896 hypothetical protein T08B1.2 - Caenorhabditis
           elegans
          Length = 515

 Score = 36.2 bits (82), Expect = 1.1
 Identities = 27/97 (27%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = -1

Query: 588 QHQLDEM-KLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ 412
           +H+ DE  KL+D  K  R E EK   + E    K  QR+   +  E++   E   + E +
Sbjct: 225 RHENDEQAKLEDYEKARRSEREKEEEELEKLKEKQAQRKLAREQEEREAA-ERKRLDEER 283

Query: 411 LQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLP 301
            Q E  ++R + EEE   ++  + ++K    +  G P
Sbjct: 284 RQKEEQERRARAEEEKKRKE--EEKLKKAQMMGGGFP 318



>gb:U93872_2456846 Kaposi's sarcoma-associated herpesvirus
           glycoprotein M, DNA replication protein, glycoprotein,
           DNA replication protein, FLICE inhibitory protein and
           v-cyclin genes, complete cds, and tegument protein gene,
           partial cds.
          Length = 1089

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 18/79 (22%), Positives = 41/79 (51%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q Q DE +  ++ +   +E ++   Q E+   +  Q +   ++ EQ+   ++  + E++ 
Sbjct: 604 QEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQEQQEEQEQELEEQEQELEEQEQ 663

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 664 ELEEQEQELEEQEQELEEQ 682



 Score = 34.7 bits (78), Expect = 3.1
 Identities = 16/79 (20%), Positives = 43/79 (54%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q Q  + + +   ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 639 QEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 698

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 699 ELEEQEQELEEQEQELEEQ 717



 Score = 34.3 bits (77), Expect = 4.1
 Identities = 17/79 (21%), Positives = 46/79 (58%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q Q +E + +++ ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 633 QEQQEEQE-QEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 691

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 692 ELEEQEQELEEQEQELEEQ 710



 Score = 33.5 bits (75), Expect = 6.9
 Identities = 17/82 (20%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = -1

Query: 588 QHQLDEMKLKDR---CKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIE 418
           Q +  E +L+++    ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E
Sbjct: 643 QQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEE 702

Query: 417 RQLQLEALKQRLKEEEEAYMRQ 352
           ++ +LE  +Q L+E+E+    Q
Sbjct: 703 QEQELEEQEQELEEQEQELEEQ 724



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 704 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 761

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 762 ELEEQEQELEEQEQELEEQ 780



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 690 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 747

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 748 ELEEQEQELEEQEQELEEQ 766



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 676 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 733

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 734 ELEEQEQELEEQEQELEEQ 752



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 662 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 719

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 720 ELEEQEQELEEQEQELEEQ 738



>gb:CR548612_1375532 Paramecium tetraurelia macronuclear largest
            chromosome, complete sequence.
          Length = 694

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 46/282 (16%), Positives = 118/282 (41%), Gaps = 15/282 (5%)
 Frame = -1

Query: 1011 LKSLVESMARMWETMKGHHENQCQIVLALRSLDMS---QSPKETSEHHYERTYQLGVVVQ 841
            +K L + + R    +    +    + +  + L  S   Q  ++  E  YE   Q   + Q
Sbjct: 403  VKGLEQEIKRQQGIILEKSQQNADLQVKFQKLQQSLIQQIEQKVKETQYECKLQFNKMQQ 462

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKE-----KVSSPQRPQNPPILALLH 676
            E+ +Q EKM+      I  L   L   +      LKE     ++ + Q  +   I+  L 
Sbjct: 463  EYENQREKMLSEHSYKINLLQQQLSYEVDKFKCELKELQQKIELLNKQIQEKEQIIIYL- 521

Query: 675  AWQDLIGKLPDELAKTAIYSFSAVVNTIV--QHQLDEMKL--KDRCKDTRKELEKRTRQF 508
               + + +  ++ +K    + + + N  +  + Q+++++   + +  D   +L  +T Q 
Sbjct: 522  --SEQLQQNKEQQSKDKTLAEANINNLQIAQKQQVEQLEKIHQQKLNDIISQLNLQTSQN 579

Query: 507  EDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKS 328
            E    +Y Q    N +   +   +  ++ + ++Q + L + L+ + +  + + +  R++ 
Sbjct: 580  EQLNQQYSQLLKNNQELRNESKEQKQSIQQYKIQCDKLSKELQIQWD--IAKSLNDRIRQ 637

Query: 327  LTSLRTGLPELFHAMSEFSRACSIMYQTL---ESITHPLNRE 211
            +        + ++  ++ +R  ++M   +   +  T P+NR+
Sbjct: 638  MQVELENAKQTYNIFTKTTRIPAVMSSEIRLSKLRTSPMNRK 679



>gb:CP000025_877799 Campylobacter jejuni RM1221, complete genome.
          Length = 593

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 24/88 (27%), Positives = 42/88 (47%)
 Frame = -1

Query: 666 DLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKY 487
           D +G+L D+ +K+ + + +A VNTIVQ   D   L D   D+ KE   +T   +      
Sbjct: 464 DEVGQLADKTSKSLL-NINATVNTIVQQINDNKALMDLIHDSMKETSSKTNDLQQELVNS 522

Query: 486 MQRRTPNDDTEQDGPHEDNNVIERQLQL 403
           M +   + ++ Q    +   V ++ L L
Sbjct: 523 MHKLESSIESTQTMKDKSMEVKDKMLIL 550



>pir|F81417|F81417 MCP-domain signal transduction protein Cj0019c
           [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X1_846451 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment 1/6.
          Length = 592

 Score = 35.8 bits (81), Expect = 1.4
 Identities = 24/88 (27%), Positives = 42/88 (47%)
 Frame = -1

Query: 666 DLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKY 487
           D +G+L D+ +K+ + + +A VNTIVQ   D   L D   D+ KE   +T   +      
Sbjct: 463 DEVGQLADKTSKSLL-NINATVNTIVQQINDNKALMDLIHDSMKETSSKTNDLQQELVNS 521

Query: 486 MQRRTPNDDTEQDGPHEDNNVIERQLQL 403
           M +   + ++ Q    +   V ++ L L
Sbjct: 522 MHKLESSIESTQTMKDKSMEVKDKMLIL 549



>gb:AF360120_2240875 Human herpesvirus 8 ORF73 gene, complete cds.
          Length = 1003

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 15/79 (18%), Positives = 46/79 (58%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q + ++ + +++ ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 539 QEEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 598

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 599 ELEEQEQELEEQEQELEEQ 617



 Score = 33.5 bits (75), Expect = 6.9
 Identities = 15/79 (18%), Positives = 43/79 (54%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + Q  + + +   ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 546 EEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 605

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 606 ELEEQEQELEEQEQELEEQ 624



 Score = 33.5 bits (75), Expect = 6.9
 Identities = 17/79 (21%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q Q DE +  ++ +D +++ +++ +Q E    +  + +   ++ EQ+   ++  + E++ 
Sbjct: 514 QEQQDEQQQDEQQQDEQQQQDEQEQQEEQ---EQQEEQEQQEEQEQELEEQEQELEEQEQ 570

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 571 ELEEQEQELEEQEQELEEQ 589



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 618 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 675

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 676 ELEEQEQELEEQEQELEEQ 694



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 604 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 661

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 662 ELEEQEQELEEQEQELEEQ 680



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 590 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 647

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 648 ELEEQEQELEEQEQELEEQ 666



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 576 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 633

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 634 ELEEQEQELEEQEQELEEQ 652



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 562 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 619

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 620 ELEEQEQELEEQEQELEEQ 638



>gb:AF192756_2211542 Kaposi's sarcoma-associated herpesvirus Orf73
           gene, complete cds.
          Length = 976

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 15/79 (18%), Positives = 46/79 (58%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q + ++ + +++ ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 568 QEEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 627

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 628 ELEEQEQELEEQEQELEEQ 646



 Score = 33.5 bits (75), Expect = 6.9
 Identities = 15/79 (18%), Positives = 43/79 (54%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + Q  + + +   ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 575 EEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 634

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 635 ELEEQEQELEEQEQELEEQ 653



 Score = 33.5 bits (75), Expect = 6.9
 Identities = 17/79 (21%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q Q DE +  ++ +D +++ +++ +Q E    +  + +   ++ EQ+   ++  + E++ 
Sbjct: 543 QEQQDEQQQDEQQQDEQQQQDEQEQQEEQ---EQQEEQEQQEEQEQELEEQEQELEEQEQ 599

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 600 ELEEQEQELEEQEQELEEQ 618



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 591 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 648

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 649 ELEEQEQELEEQEQELEEQ 667



>gb:AF148805_2203604 Kaposi's sarcoma-associated herpesvirus ORF 68
           gene, partial cds; and ORF 69, kaposin, v-FLIP,
           v-cyclin, latent nuclear antigen, ORF K14, v-GPCR,
           putative phosphoribosylformylglycinamidine synthase, and
           LAMP (LAMP) genes, complete cds.
          Length = 1129

 Score = 35.4 bits (80), Expect = 1.8
 Identities = 15/79 (18%), Positives = 46/79 (58%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q + ++ + +++ ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 707 QEEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 766

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 767 ELEEQEQELEEQEQELEEQ 785



 Score = 33.5 bits (75), Expect = 6.9
 Identities = 15/79 (18%), Positives = 43/79 (54%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + Q  + + +   ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 714 EEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 773

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 774 ELEEQEQELEEQEQELEEQ 792



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 744 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 801

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 802 ELEEQEQELEEQEQELEEQ 820



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 730 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 787

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 788 ELEEQEQELEEQEQELEEQ 806



>gb:CR352243_2570074 Zebrafish DNA sequence from clone DKEYP-117H8
           in linkage group 20 Contains the paics gene for
           phosphoribosylaminoimidazole carboxylase
           phosphoribosylaminoimidazole succinocarboxamide
           synthetase, the gene for a novel AMP-binding enzyme
           domain containing protein, the gene for a novel protein
           similar to vertebrate phosphoribosyl pyrophosphate
           amidotransferase (PPAT), the 3' end of the gene for a
           novel protein similar to cytochrome P450 family 2
           subfamily J, the 5' end of a novel gene and two novel
           genes, complete sequence.
          Length = 1079

 Score = 35.0 bits (79), Expect = 2.4
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 9/97 (9%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNV----- 424
           Q + +E K ++  +  R+E E+R R  E+   +  + R   ++ E+    E+        
Sbjct: 241 QREEEERKKREEEERRREEEERRLRHEEERKRQEEEERMKKEEEERKRAEEERRQQELLA 300

Query: 423 ----IERQLQLEALKQRLKEEEEAYMRQCMQVRVKSL 325
               +E + + E  ++R KEEEEA  R+  +++ K L
Sbjct: 301 ERLRLEEERKREQEERRRKEEEEAEKRRIQELQEKRL 337



>gb:AF305694_2232001 Kaposi's sarcoma-associated herpesvirus latent
           nuclear antigen gene, partial cds.
          Length = 1036

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 17/79 (21%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    D+ EQ+   ++  + E++ 
Sbjct: 623 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELDEQEQELEEQEQELEEQEQ 680

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 681 ELEEQEQELEEQEQELEEQ 699



 Score = 34.7 bits (78), Expect = 3.1
 Identities = 14/74 (18%), Positives = 45/74 (60%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q + ++ + +++ ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 586 QDEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 645

Query: 408 QLEALKQRLKEEEE 367
           +LE  +Q L+E+E+
Sbjct: 646 ELEEQEQELEEQEQ 659



 Score = 34.3 bits (77), Expect = 4.1
 Identities = 16/74 (21%), Positives = 43/74 (58%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +LDE +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 658 EQELDEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 715

Query: 408 QLEALKQRLKEEEE 367
           +LE  +Q L+E+E+
Sbjct: 716 ELEEQEQELEEQEQ 729



 Score = 33.9 bits (76), Expect = 5.3
 Identities = 17/79 (21%), Positives = 41/79 (51%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           Q Q DE +  ++ +   +E ++   Q E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 572 QEQQDEQQQDEQQQQDEQEQQEEQEQQEEQEQELEEQEQELEEQEQELEEQEQELEEQEQ 631

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 632 ELEEQEQELEEQEQELEEQ 650



 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/79 (20%), Positives = 44/79 (55%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           + +L+E +     ++  +ELE++ ++ E+   +  ++    ++ EQ+   ++  + E++ 
Sbjct: 609 EQELEEQE--QELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELDEQEQ 666

Query: 408 QLEALKQRLKEEEEAYMRQ 352
           +LE  +Q L+E+E+    Q
Sbjct: 667 ELEEQEQELEEQEQELEEQ 685



>gb:BC052083_2100962 Mus musculus TNFAIP3 interacting protein 2,
           mRNA (cDNA clone MGC:62501 IMAGE:6404610), complete cds.
          Length = 451

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 33/155 (21%), Positives = 72/155 (46%), Gaps = 3/155 (1%)
 Frame = -1

Query: 846 VQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNL-KEKVSSPQRPQNPPILALLHAW 670
           V++ ++++++    + EY++GL+  LK   VP++  L K+++S   R     I     A 
Sbjct: 242 VEDLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEAN 301

Query: 669 QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHK 490
           Q+L          TA+     +   I+ ++ D+ K +   +  R+    R ++ E+    
Sbjct: 302 QELTAMRMSR--DTALERVQMLEQQILAYK-DDFKSE---RADRERAHSRIQELEEKIMS 355

Query: 489 YMQRRTPNDDTEQDGP--HEDNNVIERQLQLEALK 391
            M + +   D+ + GP      N   + L+++AL+
Sbjct: 356 LMYQVSQRQDSREPGPCRIHTGNKTAKYLEMDALE 390



>gb:AX011244_1456399 Sequence 4 from Patent
           WO9957133.>gb:MMU304865_2120571 Mus musculus mRNA for
           A20 binding inhibitor of NF-kappaB activation-2 (ABIN-2
           gene).
          Length = 430

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 33/155 (21%), Positives = 72/155 (46%), Gaps = 3/155 (1%)
 Frame = -1

Query: 846 VQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNL-KEKVSSPQRPQNPPILALLHAW 670
           V++ ++++++    + EY++GL+  LK   VP++  L K+++S   R     I     A 
Sbjct: 221 VEDLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEAN 280

Query: 669 QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHK 490
           Q+L          TA+     +   I+ ++ D+ K +   +  R+    R ++ E+    
Sbjct: 281 QELTAMRMSR--DTALERVQMLEQQILAYK-DDFKSE---RADRERAHSRIQELEEKIMS 334

Query: 489 YMQRRTPNDDTEQDGP--HEDNNVIERQLQLEALK 391
            M + +   D+ + GP      N   + L+++AL+
Sbjct: 335 LMYQVSQRQDSREPGPCRIHTGNKTAKYLEMDALE 369



>gb:U58760_1405415 Caenorhabditis elegans cosmid C27A2, complete
            sequence.
          Length = 1076

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 38/221 (17%), Positives = 95/221 (42%), Gaps = 6/221 (2%)
 Frame = -1

Query: 1011 LKSLVESMARMWETMKGHHEN---QCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQ 841
            +K L + + ++   ++ + +    Q ++ L  + + + +  K   E+  E     G +++
Sbjct: 204  IKRLEDEIGKIMPLVENYRKKLALQSKLRLLEKKMKIMEFEKFDREYKAELQNMDGAMIE 263

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
              + + EK I   +++ + L D +K +        + ++S  QR  N  ILA +    D 
Sbjct: 264  --YREVEKSIAECEKHRKNLEDRIKKD--------RSQISQMQRSCNE-ILAKVQEKGDK 312

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHK 490
              KL +++ + A     +      QH+ D  K +      R  L++       +E++  +
Sbjct: 313  --KLMEDMMQRAKAKLESAKKAADQHEKDVEKARKMIDQARARLQEAVDTLNGYEEFQSE 370

Query: 489  YMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
                       E+D   E++ + ++  ++  L+ + ++EE+
Sbjct: 371  MKSLEQKYSTAERDSRQEEDAIQKKSYEMRQLENKKRDEEQ 411



>gb:AY052127_1290721 Drosophila melanogaster SD07741 full insert
           cDNA.
          Length = 1062

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 24/105 (22%), Positives = 47/105 (44%)
 Frame = -1

Query: 573 EMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
           E K K + K  +KE + + ++     H    R +  D  E+D   E+     + ++ +A 
Sbjct: 241 ERKKKKKSKKHKKESKSKKKKSRKRKHSESGRDSDRDSDEEDDSSEEERRESKNVRKKAK 300

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACS 259
           K + K +++  +++  + R  S  S RT  P      S+ SR  +
Sbjct: 301 KDKKKRDKK--LKKKSRARASSSDSERTNSPSRKENKSDRSRGAN 343



>gb:BX571662_779191 Wolinella succinogenes, complete genome; segment
           6/7.
          Length = 761

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 29/118 (24%), Positives = 59/118 (50%), Gaps = 5/118 (4%)
 Frame = -1

Query: 570 MKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALK 391
           +K +   K+ +KE E++  +  +     ++  T + + EQ   HE++N   ++ +L ++ 
Sbjct: 439 VKTRTNEKNWKKEPEEKIAEIIE----ELESMTSSKEDEQSFDHEEDNEDVKE-KLGSIT 493

Query: 390 QRLKE-EEEAYMRQCMQVRVKSLTSLRTGL----PELFHAMSEFSRACSIMYQTLESI 232
           Q+LKE +EE   +Q   +  K+L  +  GL     E  H + +F  A S   + + +I
Sbjct: 494 QKLKEAQEEQKQKQQELLEEKNLLRILAGLGLTIGEFIHEIKQFQGALSADIENIRNI 551



>pir|T15650|T15650 hypothetical protein C27A2.1 - Caenorhabditis
            elegans
          Length = 1154

 Score = 34.7 bits (78), Expect = 3.1
 Identities = 38/221 (17%), Positives = 95/221 (42%), Gaps = 6/221 (2%)
 Frame = -1

Query: 1011 LKSLVESMARMWETMKGHHEN---QCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQ 841
            +K L + + ++   ++ + +    Q ++ L  + + + +  K   E+  E     G +++
Sbjct: 204  IKRLEDEIGKIMPLVENYRKKLALQSKLRLLEKKMKIMEFEKFDREYKAELQNMDGAMIE 263

Query: 840  EWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDL 661
              + + EK I   +++ + L D +K +        + ++S  QR  N  ILA +    D 
Sbjct: 264  --YREVEKSIAECEKHRKNLEDRIKKD--------RSQISQMQRSCNE-ILAKVQEKGDK 312

Query: 660  IGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRT---RQFEDWYHK 490
              KL +++ + A     +      QH+ D  K +      R  L++       +E++  +
Sbjct: 313  --KLMEDMMQRAKAKLESAKKAADQHEKDVEKARKMIDQARARLQEAVDTLNGYEEFQSE 370

Query: 489  YMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
                       E+D   E++ + ++  ++  L+ + ++EE+
Sbjct: 371  MKSLEQKYSTAERDSRQEEDAIQKKSYEMRQLENKKRDEEQ 411



>gb:HSCZCHOM_2437578 Cercopithecine herpesvirus 5 SPLF5 protein
           (SPLF5) gene, partial cds; and SPLF4 protein (SPLF4),
           SPLF3 glycoprotein (SPLF3), SPLF2 glycoprotein (SPLF2),
           and SPLF1 glycoprotein (SPLF1) genes, complete cds.
          Length = 333

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +3

Query: 792 YIPSGGLSFSQTVNATLVQQHLTGKCVHSGAHLFLW-GTATYPETSELARSDIDSHDVPS 968
           +IP G  SF  T+NAT        +C    +H  LW  T T P     A +D  ++  P 
Sbjct: 221 HIPGGSPSFQCTINAT--------ECPGLTSHSRLWSNTTTTPGPPVPAMTDCTNYSHPW 272

Query: 969 WSPTF*PST 995
           W+ T  P+T
Sbjct: 273 WTTTARPAT 281



>gb:BC039340_1982548 Homo sapiens Rho GTPase activating protein 20,
           mRNA (cDNA clone MGC:43522 IMAGE:5268598), complete cds.
          Length = 731

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)
 Frame = -1

Query: 840 EWHSQFEKMIIHQKEYIR----GLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP 694
           EWHSQ   + +H   ++R     L +W            +EK++SP+ P  PP
Sbjct: 565 EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPP 617



>gb:AY496267_1954841 Homo sapiens RhoGTPase regulating protein variant
            ARHGAP20-1be (ARHGAP20) mRNA, complete cds, alternatively
            spliced.
          Length = 1165

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)
 Frame = -1

Query: 840  EWHSQFEKMIIHQKEYIR----GLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP 694
            EWHSQ   + +H   ++R     L +W            +EK++SP+ P  PP
Sbjct: 996  EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPP 1048



>gb:AY496266_1954840 Homo sapiens RhoGTPase regulating protein variant
            ARHGAP20-1c (ARHGAP20) mRNA, complete cds, alternatively
            spliced.
          Length = 1168

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)
 Frame = -1

Query: 840  EWHSQFEKMIIHQKEYIR----GLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP 694
            EWHSQ   + +H   ++R     L +W            +EK++SP+ P  PP
Sbjct: 999  EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPP 1051



>gb:AY496264_1954838 Homo sapiens RhoGTPase regulating protein variant
            ARHGAP20-1d (ARHGAP20) mRNA, complete cds, alternatively
            spliced.>gb:AY496265_1954839 Homo sapiens RhoGTPase
            regulating protein variant ARHGAP20-1e (ARHGAP20) mRNA,
            complete cds, alternatively spliced.
          Length = 1155

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)
 Frame = -1

Query: 840  EWHSQFEKMIIHQKEYIR----GLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP 694
            EWHSQ   + +H   ++R     L +W            +EK++SP+ P  PP
Sbjct: 986  EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPP 1038



>gb:AY496263_1954837 Homo sapiens RhoGTPase regulating protein variant
            ARHGAP20-1ad (ARHGAP20) mRNA, complete cds, alternatively
            spliced.
          Length = 1191

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)
 Frame = -1

Query: 840  EWHSQFEKMIIHQKEYIR----GLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP 694
            EWHSQ   + +H   ++R     L +W            +EK++SP+ P  PP
Sbjct: 1022 EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPP 1074



>gb:PFMAL1P1_1394249 Plasmodium falciparum DNA from MAL1P1, complete
           sequence.
          Length = 1451

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 31/141 (21%), Positives = 67/141 (47%), Gaps = 4/141 (2%)
 Frame = -1

Query: 741 NLKEKVSSPQRPQNPPILALLHAWQDLIGKLP--DELAKTAIYSFSAV--VNTIVQHQLD 574
           N +E++ + + PQ     A +  +   +   P  D+    A+ S      +  I + +L+
Sbjct: 80  NRREQIRTQREPQKSNYKASMKNYLKCVKSAPYIDDAKYGALISEEEEREMKMIKKMELE 139

Query: 573 EMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
           E++ +D   + R     R R+ E    K  ++R   +  E+    E+  + E + +++  
Sbjct: 140 ELEKRDELMEKR-----RLRRIERMKKKEEEKRIKEE--EERIKEEEKRIKEEEERIKEE 192

Query: 393 KQRLKEEEEAYMRQCMQVRVK 331
           ++RLKEEEE  +++  + R+K
Sbjct: 193 EKRLKEEEERRLKEEEERRLK 213



>gb:AF304204_1260567 Strongylocentrotus purpuratus dystrophin-like
           protein mRNA, complete cds.
          Length = 3908

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 2/95 (2%)
 Frame = -1

Query: 516 RQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQ--RLKEEEEAYMRQCMQ 343
           RQFEDW  K          T+   PH D + +E   +++AL+Q   L+  E   +    Q
Sbjct: 530 RQFEDWLSKAESSLAIMRLTQ---PHSDTDAMEMLKKIKALEQVLELQHSEFCRLNTLAQ 586

Query: 342 VRVKSLTSLRTGLPELFHAMSEFSRACSIMYQTLE 238
             V+ L     G+  +  A+ +FS+    + Q +E
Sbjct: 587 NIVQHLEEDHPGVASIQTALEDFSQRWDSIVQQME 621



>gb:AE014296_1134238 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003472_1211537 Drosophila melanogaster
           chromosome 3L, section 6 of 83 of the complete sequence.
          Length = 965

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 24/102 (23%), Positives = 46/102 (45%)
 Frame = -1

Query: 573 EMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
           E K K + K  +KE + + ++     H    R +  D  E+D   E+     + ++ +A 
Sbjct: 144 ERKKKKKSKKHKKESKSKKKRSRKRKHSESGRDSDRDSDEEDDSSEEERRESKNVRKKAK 203

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSR 268
           K + K +++  +++  + R  S  S RT  P      S+ SR
Sbjct: 204 KDKKKRDKK--LKKKSRARASSSDSERTNSPSRKENKSDRSR 243



>gb:AE014296_1134237 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003472_1211536 Drosophila melanogaster
           chromosome 3L, section 6 of 83 of the complete sequence.
          Length = 1062

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 24/102 (23%), Positives = 46/102 (45%)
 Frame = -1

Query: 573 EMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
           E K K + K  +KE + + ++     H    R +  D  E+D   E+     + ++ +A 
Sbjct: 241 ERKKKKKSKKHKKESKSKKKRSRKRKHSESGRDSDRDSDEEDDSSEEERRESKNVRKKAK 300

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSR 268
           K + K +++  +++  + R  S  S RT  P      S+ SR
Sbjct: 301 KDKKKRDKK--LKKKSRARASSSDSERTNSPSRKENKSDRSR 340



>gb:AE014296_1134236 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003472_1211535 Drosophila melanogaster
           chromosome 3L, section 6 of 83 of the complete sequence.
          Length = 1107

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 24/102 (23%), Positives = 46/102 (45%)
 Frame = -1

Query: 573 EMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEAL 394
           E K K + K  +KE + + ++     H    R +  D  E+D   E+     + ++ +A 
Sbjct: 241 ERKKKKKSKKHKKESKSKKKRSRKRKHSESGRDSDRDSDEEDDSSEEERRESKNVRKKAK 300

Query: 393 KQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFSR 268
           K + K +++  +++  + R  S  S RT  P      S+ SR
Sbjct: 301 KDKKKRDKK--LKKKSRARASSSDSERTNSPSRKENKSDRSR 340



>gb:AE017199_403199 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 260

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 26/122 (21%), Positives = 57/122 (46%), Gaps = 2/122 (1%)
 Frame = -1

Query: 654 KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR 475
           KLP ++    I     ++  I+Q ++   K +    +  ++LEK+  + ++         
Sbjct: 76  KLPSDVNPKKIRREIEILERILQTEVLSYKQEKEIIERIRKLEKKLMEIQE--------- 126

Query: 474 TPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEE--EEAYMRQCMQVRVKSLTSLRTGLP 301
              +    +    +  +IE+Q +L  +K+R+++   E+  +R+ MQ  +K L  LR  L 
Sbjct: 127 ---NPIAMEFEELNRQLIEKQKELNIIKERIRDALMEKKKVRETMQELLKKLDELRARLK 183

Query: 300 EL 295
           E+
Sbjct: 184 EI 185



>pir|C59436|C59436 KIAA1391 protein [imported] -
            human>gb:AB037812_1866603 Homo sapiens mRNA for KIAA1391
            protein, partial cds.
          Length = 1194

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 4/53 (7%)
 Frame = -1

Query: 840  EWHSQFEKMIIHQKEYIR----GLNDWLKLNLVPIDTNLKEKVSSPQRPQNPP 694
            EWHSQ   + +H   ++R     L +W            +EK++SP+ P  PP
Sbjct: 1025 EWHSQMHSVTLHPSTWLRNGVASLKNWSLKKKAKAARPEEEKIASPKGPLEPP 1077



>pir|T27676|T27676 hypothetical protein ZK1058.4 - Caenorhabditis
           elegans>gb:CEZK1058_1371415 Caenorhabditis elegans
           cosmid ZK1058, complete sequence.
          Length = 442

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 8/96 (8%)
 Frame = -1

Query: 594 IVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY----HKYMQR----RTPNDDTEQDGPH 439
           +V + +D+ +     KD + + E+R ++FED +    H++ Q     R      E+    
Sbjct: 349 LVFYLIDKARKMKLSKDAKVKAERRRKEFEDAFLKQTHQFRQEAAQARREEKTRERKQKL 408

Query: 438 EDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVK 331
            D +  ERQ +LEA  + LK E +A   +  Q++VK
Sbjct: 409 MDESDPERQKRLEA--KELKREAKAKSPKMKQLKVK 442



>pir|T31504|T31504 hypothetical protein Y116A8C.36 - Caenorhabditis
           elegans>gb:CEY116A8C_1369400 Caenorhabditis elegans YAC
           Y116A8C, complete sequence.
          Length = 1097

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 24/93 (25%), Positives = 47/93 (50%), Gaps = 4/93 (4%)
 Frame = -1

Query: 564 LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
           L++  +  R E+EK+ R+ E   ++  Q +    + E+    E   +IE Q + E  K+R
Sbjct: 313 LEEEEQRRRAEVEKKEREEEAKKNRERQEKERQAEVERQAELERQRIIEAQREEEEKKRR 372

Query: 384 L----KEEEEAYMRQCMQVRVKSLTSLRTGLPE 298
           L    + EE+  MR+ +Q+    +  ++  +PE
Sbjct: 373 LEMERRREEDEKMRK-VQMEKAKVKQMQVQMPE 404



>pir|T47645|T47645 centromere protein-like - Arabidopsis
           thaliana>gb:ATT15C9_1554518 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T15C9.
          Length = 896

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 28/135 (20%), Positives = 58/135 (42%), Gaps = 11/135 (8%)
 Frame = -1

Query: 582 QLDEMKLKDRCKDTRKELEKRTRQFEDWYHK---------YMQRRTPNDDTEQDGPHEDN 430
           QL+E KL++R ++  +      R+   ++           +++RR     T  D  HE+N
Sbjct: 423 QLEEKKLRERVRELAEHNVSLQRELSAFHENETENKDMITHLERRVAELTTTADKLHEEN 482

Query: 429 NVIERQLQLEALKQRLKEEEEAY--MRQCMQVRVKSLTSLRTGLPELFHAMSEFSRACSI 256
           N +         KQ L + +E+Y    + +    ++         EL  ++++F R C  
Sbjct: 483 NYV---------KQTLSKLQESYAGATEDLDFLRRNFEEKDQECRELHKSVTKFFRTCKE 533

Query: 255 MYQTLESITHPLNRE 211
             +T+E +   ++ E
Sbjct: 534 QGKTIEGLRDGVSEE 548



>pir|T00529|T00529 hypothetical protein At2g19090 [imported] -
            Arabidopsis thaliana>gb:AC002392_1530655 Arabidopsis
            thaliana chromosome 2 clone T20K24 map CIC06E08, complete
            sequence.
          Length = 844

 Score = 34.3 bits (77), Expect = 4.1
 Identities = 40/174 (22%), Positives = 71/174 (40%), Gaps = 25/174 (14%)
 Frame = -1

Query: 1017 PKLKSLVESMA----------RMWETMKGHHENQCQIV----LALRSLDMSQSPKE---- 892
            P+L  LVE +           RMW+ M   H+ Q + +    L L    +S+  K+    
Sbjct: 586  PQLLELVEGLTNGNHDHNRLTRMWKVMAESHQIQKRTLDEAKLLLAGTPVSKRHKKRQPP 645

Query: 891  ------TSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTN-LK 733
                   S+   +    L   ++ W + FE  I  Q+ Y++ L+ WL L     D +  K
Sbjct: 646  IMPEAINSQRLAQSALNLEAQLRNWRTCFEFWITSQRSYMKALSGWL-LRCFRCDPDPEK 704

Query: 732  EKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDE 571
             ++SS       PI  +   W  L+  L ++     +  F++ + +I   Q+ E
Sbjct: 705  VRLSSCLH----PIYRVCIQWSRLLNSLNEKPVLDKLEFFASGMGSIYARQVRE 754



>gb:AP003843_1834108 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1656_E11.>gb:AP004670_1843072 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0496D04.
          Length = 306

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = -1

Query: 600 NTIVQHQLDEMKLKDRCKDTRKELEKRT-RQFEDWYHKYMQRRTPNDDTEQDGP 442
           NT  Q+Q +E K+  +CK+  +E E+    +++D  HK ++ +    DTE+  P
Sbjct: 145 NTPGQYQDEEQKIAKQCKEEEEEEEENALEKYQDEEHKSLKAQHQCQDTERKAP 198



>gb:CNS07EGC_1373414 chromosome V of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).>gb:CNS07EGH_1374181 chromosome XI
           of strain GB-M1 of Encephalitozoon cuniculi
           (Microspora).
          Length = 612

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 23/101 (22%), Positives = 49/101 (48%)
 Frame = -1

Query: 669 QDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHK 490
           Q L+GK  DE+ +  I   + V N + + Q  EM+ K+  K   +E +K   + ++   K
Sbjct: 279 QMLLGKKGDEIDRRYI---NKVANVVKERQRREMEKKEEEKKKEEEKKKEEEKRKEEKKK 335

Query: 489 YMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
             + +      +++   E+    +++ + E  K+  KEE++
Sbjct: 336 KKEEKKEEKKKKKEEKKEEKKEEKKEEKKEEKKEEKKEEKK 376



>gb:CEF22E12_1362844 Caenorhabditis elegans cosmid F22E12, complete
           sequence.>gb:CEY32F6A_1369599 Caenorhabditis elegans YAC
           Y32F6A, complete sequence.
          Length = 763

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 31/144 (21%), Positives = 62/144 (43%), Gaps = 5/144 (3%)
 Frame = -1

Query: 771 LKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTI 592
           +K    P    + E V  P   Q PP+  +    Q +   L  +   T    +  ++ T+
Sbjct: 456 IKWTAYPKGARIPEHVPVPPVAQLPPLPPMQQVIQPI---LTTQAVYTTEEPYIPLITTV 512

Query: 591 VQHQLDEMKLKDRCKDTRKELEKR----TRQFEDWYHKYMQRRTPND-DTEQDGPHEDNN 427
             H++  +K ++  +  +++LEKR     RQ E+   K  + +     + E+     +  
Sbjct: 513 PTHEISRLKHEEMQRKYKEDLEKRQEEQKRQQEEHKKKIQELKAAQQRERERMMVEREKA 572

Query: 426 VIERQLQLEALKQRLKEEEEAYMR 355
             +R+L+ E   ++  EE +A MR
Sbjct: 573 ENDRRLKYENEMKQRAEEYQARMR 596



>gb:AF438161_510754 Streptococcus pyogenes M protein precursor
           (emm3) gene, emm3.4 allele, partial cds.
          Length = 238

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 35/163 (21%), Positives = 72/163 (44%), Gaps = 4/163 (2%)
 Frame = -1

Query: 843 QEWHSQFEKMIIHQK-EYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQ 667
           Q++++Q  ++ + QK EY++GLNDW +  L  ++    +KV      +   +   +   +
Sbjct: 61  QQYNAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELK 120

Query: 666 DLIGKLPDE---LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY 496
           + I K   E   L K    +    V +  +HQ +  + + +  +   ++ + + + E   
Sbjct: 121 EKIDKKEKEYQDLDKDFDLAKQGYVLSDKRHQQELEEKEKKVTEATAKVGQISEELETVK 180

Query: 495 HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
            K        + T QD   + N V + + +L   KQ  KE+ E
Sbjct: 181 QKV-------ESTMQDLTEKQNRVSQLEQELATTKQNAKEDFE 216



>gb:AF288753_496102 Streptococcus pyogenes isolate 7203-99 M protein
           (emm) gene, partial cds.
          Length = 231

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 35/163 (21%), Positives = 72/163 (44%), Gaps = 4/163 (2%)
 Frame = -1

Query: 843 QEWHSQFEKMIIHQK-EYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQ 667
           Q++++Q  ++ + QK EY++GLNDW +  L  ++    +KV      +   +   +   +
Sbjct: 66  QQYNAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELK 125

Query: 666 DLIGKLPDE---LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY 496
           + I K   E   L K    +    V +  +HQ +  + + +  +   ++ + + + E   
Sbjct: 126 EKIDKKEKEYQDLDKDFDLAKQGYVLSDKRHQQELEEKEKKVTEATAKVGQISEELETVK 185

Query: 495 HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
            K        + T QD   + N V + + +L   KQ  KE+ E
Sbjct: 186 QKV-------ESTMQDLTEKQNRVSQLEQELATTKQNAKEDFE 221



>gb:AF288752_496101 Streptococcus pyogenes isolate 3148-00 M protein
           (emm) gene, partial cds.
          Length = 272

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 35/163 (21%), Positives = 72/163 (44%), Gaps = 4/163 (2%)
 Frame = -1

Query: 843 QEWHSQFEKMIIHQK-EYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQ 667
           Q++++Q  ++ + QK EY++GLNDW +  L  ++    +KV      +   +   +   +
Sbjct: 65  QQYNAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELK 124

Query: 666 DLIGKLPDE---LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY 496
           + I K   E   L K    +    V +  +HQ +  + + +  +   ++ + + + E   
Sbjct: 125 EKIDKKEKEYQDLDKDFDLAKQGYVLSDKRHQQELEEKEKKVTEATAKVGQISEELETVK 184

Query: 495 HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
            K        + T QD   + N V + + +L   KQ  KE+ E
Sbjct: 185 QKV-------ESTMQDLTEKQNRVSQLEQELATTKQNAKEDFE 220



>gb:AE014170_305204 Streptococcus pyogenes MGAS315, section 35 of 37
           of the complete genome.>gb:BA000034_714649 Streptococcus
           pyogenes SSI-1 DNA, complete genome.>gb:AE014074_928383
           Streptococcus pyogenes MGAS315, complete genome.
          Length = 581

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 35/163 (21%), Positives = 72/163 (44%), Gaps = 4/163 (2%)
 Frame = -1

Query: 843 QEWHSQFEKMIIHQK-EYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQ 667
           Q++++Q  ++ + QK EY++GLNDW +  L  ++    +KV      +   +   +   +
Sbjct: 79  QQYNAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELK 138

Query: 666 DLIGKLPDE---LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY 496
           + I K   E   L K    +    V +  +HQ +  + + +  +   ++ + + + E   
Sbjct: 139 EKIDKKEKEYQDLDKDFDLAKQGYVLSDKRHQQELEEKEKKVTEATAKVGQISEELETVK 198

Query: 495 HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
            K        + T QD   + N V + + +L   KQ  KE+ E
Sbjct: 199 QKV-------ESTMQDLTEKQNRVSQLEQELATTKQNAKEDFE 234



>gb:SPU40231_189531 Streptococcus pyogenes M3 protein (emm3.1) gene,
           complete cds.
          Length = 539

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 35/163 (21%), Positives = 72/163 (44%), Gaps = 4/163 (2%)
 Frame = -1

Query: 843 QEWHSQFEKMIIHQK-EYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQ 667
           Q++++Q  ++ + QK EY++GLNDW +  L  ++    +KV      +   +   +   +
Sbjct: 79  QQYNAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELK 138

Query: 666 DLIGKLPDE---LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY 496
           + I K   E   L K    +    V +  +HQ +  + + +  +   ++ + + + E   
Sbjct: 139 EKIDKKEKEYQDLDKDFDLAKQGYVLSDKRHQQELEEKEKKVTEATAKVGQISEELETVK 198

Query: 495 HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
            K        + T QD   + N V + + +L   KQ  KE+ E
Sbjct: 199 QKV-------ESTMQDLTEKQNRVSQLEQELATTKQNAKEDFE 234



>pir|T21275|T21275 hypothetical protein F22E12.1 - Caenorhabditis
           elegans
          Length = 1203

 Score = 33.9 bits (76), Expect = 5.3
 Identities = 31/144 (21%), Positives = 62/144 (43%), Gaps = 5/144 (3%)
 Frame = -1

Query: 771 LKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTI 592
           +K    P    + E V  P   Q PP+  +    Q +   L  +   T    +  ++ T+
Sbjct: 456 IKWTAYPKGARIPEHVPVPPVAQLPPLPPMQQVIQPI---LTTQAVYTTEEPYIPLITTV 512

Query: 591 VQHQLDEMKLKDRCKDTRKELEKR----TRQFEDWYHKYMQRRTPND-DTEQDGPHEDNN 427
             H++  +K ++  +  +++LEKR     RQ E+   K  + +     + E+     +  
Sbjct: 513 PTHEISRLKHEEMQRKYKEDLEKRQEEQKRQQEEHKKKIQELKAAQQRERERMMVEREKA 572

Query: 426 VIERQLQLEALKQRLKEEEEAYMR 355
             +R+L+ E   ++  EE +A MR
Sbjct: 573 ENDRRLKYENEMKQRAEEYQARMR 596



>gb:AF056035_2052674 Rattus norvegicus s-nexilin mRNA, complete cds.
          Length = 606

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 10/117 (8%)
 Frame = -1

Query: 591 VQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ 412
           ++ Q  E + K   ++ R+ LE+  R FE+     +     + DTE     ++    + +
Sbjct: 184 LERQRQENRKKQAEEEARRRLEEERRAFEEARRNMVNEEDESQDTET--VFKEYRPGKLR 241

Query: 411 LQLEALKQRLKEEE----EAYMRQCMQVRVKSLTSLRTGL------PELFHAMSEFS 271
           L  E ++++ +EEE    E   R+ M+   K+    R  +      PE++ A+S+ S
Sbjct: 242 LSFEEIERQRREEEKRKAEEEARRRMEEEKKAFAEARRSMVLDDDSPEIYKAVSQES 298



>gb:AF056034_2052673 Rattus norvegicus F-actin binding protein
           b-Nexilin mRNA, complete cds.
          Length = 656

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 10/117 (8%)
 Frame = -1

Query: 591 VQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ 412
           ++ Q  E + K   ++ R+ LE+  R FE+     +     + DTE     ++    + +
Sbjct: 234 LERQRQENRKKQAEEEARRRLEEERRAFEEARRNMVNEEDESQDTET--VFKEYRPGKLR 291

Query: 411 LQLEALKQRLKEEE----EAYMRQCMQVRVKSLTSLRTGL------PELFHAMSEFS 271
           L  E ++++ +EEE    E   R+ M+   K+    R  +      PE++ A+S+ S
Sbjct: 292 LSFEEIERQRREEEKRKAEEEARRRMEEEKKAFAEARRSMVLDDDSPEIYKAVSQES 348



>gb:AB053469_1868221 Homo sapiens mRNA for ELKS gamma, complete cds.
          Length = 720

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 29/111 (26%), Positives = 58/111 (52%), Gaps = 4/111 (3%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQL 409
           ++Q+D ++L+   K+T   L K+T+Q +D   +   +     D +     ++  V   Q 
Sbjct: 221 ENQVDALRLRLEEKETM--LNKKTKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQK 278

Query: 408 QLEALKQRLKEEEEAYMRQCMQVRVKSL----TSLRTGLPELFHAMSEFSR 268
           ++E L+++L+++E+      ++ RVKSL    T+  T L  L  A++E  R
Sbjct: 279 KIENLQEQLRDKEK--QMSSLKERVKSLQADTTNTDTALTTLEEALAEKER 327



>gb:AX877984_1477246 Sequence 12889 from Patent
           EP1074617.>gb:AK002004_1908776 Homo sapiens cDNA
           FLJ11142 fis, clone PLACE1006552.
          Length = 401

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 30/145 (20%), Positives = 67/145 (46%), Gaps = 20/145 (13%)
 Frame = -1

Query: 864 YQLGVVVQEWHSQFEKMIIHQKEYIRGLN---DWLKLNLVPIDTNL---KEKVSSPQRPQ 703
           ++L + ++E     E+ ++ +K+ +  L    D L   +  + TNL   +E + + QR +
Sbjct: 152 FELALHLREKRLDIEEALVEEKKIVDNLKKEYDTLSKKVKIVATNLNAAEEALEAYQREK 211

Query: 702 NPPILALL-------HAWQDLI-GKLPDELAKTAIYSFSAV------VNTIVQHQLDEMK 565
              +  LL       H  + ++ G++P +L+ T ++S  A+      +  + +    + K
Sbjct: 212 QQRLNELLVVIPLKLHQIEYVVFGEIPSDLSGTLVFSNHALRRLQERIRELQEENSKQQK 271

Query: 564 LKDRCKDTRKELEKRTRQFEDWYHK 490
           L    ++ RK+L +  R+     HK
Sbjct: 272 LNKEWRERRKQLIREKREMTKTIHK 296



>gb:AC116984_1207263 Dictyostelium discoideum chromosome 2 map
           2567470-3108875 strain AX4, complete sequence.
          Length = 680

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 4/128 (3%)
 Frame = -1

Query: 696 PILALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKR- 520
           P L LL +  DL  K+     K  I S  A+ +   +   D  ++    KD   +L  R 
Sbjct: 346 PHLVLLPSVLDLASKMLTLDPKKRINSLEALEHPWFKSSNDMDQIVPFSKDFT-DLANRY 404

Query: 519 ---TRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQC 349
              TRQ +   H + Q++      +Q        +I+RQ Q +  +Q ++ ++E   +Q 
Sbjct: 405 IASTRQLQQQQHHHQQQQQQQQQQQQQQQPHQQQLIQRQHQEQQQQQLIQRQQEQSKQQL 464

Query: 348 MQVRVKSL 325
           +Q   +S+
Sbjct: 465 IQHHQQSV 472



>gb:AC115592_1205726 Dictyostelium discoideum chromosome 2 map
            1-125959 strain AX4, complete sequence.
          Length = 2084

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 46/188 (24%), Positives = 75/188 (39%), Gaps = 8/188 (4%)
 Frame = -1

Query: 822  EKMIIHQKEYIRGLND----WLK-LNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQDLI 658
            +KM I+ KEY R        W + L LV +D  +   + S Q       L +L    D  
Sbjct: 683  KKMQIYSKEYERIKTPRQLIWKQHLGLVDLDLEIGNNIQSFQVSPIHATLIMLFESDDGD 742

Query: 657  GKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQR 478
                 EL    +     +   +V+ +L         K+T  E  K   + E    K  Q+
Sbjct: 743  DDDEKELTLEYLSKQLEISKDLVKKKLIFWLNNQIIKETSHETYKINNK-EKEEQKQRQQ 801

Query: 477  RTPNDDTEQ---DGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG 307
            +  NDD ++   D   +DNN++  + + E  K    +E+E  MR      +  L + +T 
Sbjct: 802  QIENDDQDESSSDDDDDDNNIVVEEEEEE--KSTSAKEKEEQMRVVESFIIGMLINFKTL 859

Query: 306  LPELFHAM 283
              E  H+M
Sbjct: 860  PLERIHSM 867



>gb:HSM801462_1186187 Homo sapiens mRNA; cDNA DKFZp434A2017 (from
            clone DKFZp434A2017).
          Length = 990

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 30/145 (20%), Positives = 67/145 (46%), Gaps = 20/145 (13%)
 Frame = -1

Query: 864  YQLGVVVQEWHSQFEKMIIHQKEYIRGLN---DWLKLNLVPIDTNL---KEKVSSPQRPQ 703
            ++L + ++E     E+ ++ +K+ +  L    D L   +  + TNL   +E + + QR +
Sbjct: 685  FELALHLREKRLDIEEALVEEKKIVDNLKKEYDTLSKKVKIVATNLNAAEEALEAYQREK 744

Query: 702  NPPILALL-------HAWQDLI-GKLPDELAKTAIYSFSAV------VNTIVQHQLDEMK 565
               +  LL       H  + ++ G++P +L+ T ++S  A+      +  + +    + K
Sbjct: 745  QQRLNELLVVIPLKPHQIEYVVFGEIPSDLSGTLVFSNHALRRLQERIRELQEENSKQQK 804

Query: 564  LKDRCKDTRKELEKRTRQFEDWYHK 490
            L    ++ RK+L +  R+     HK
Sbjct: 805  LNKEWRERRKQLIREKREMTKTIHK 829



>gb:AE014134_1127620 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003608_1217727 Drosophila melanogaster
            chromosome 2L, section 17 of 83 of the complete sequence.
          Length = 7500

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 41/194 (21%), Positives = 85/194 (43%), Gaps = 17/194 (8%)
 Frame = -1

Query: 735  KEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIY-----SFSAVVNTIVQHQLDE 571
            K K+   Q    P + ++L    D+I  + D+LA           F A++N I+   +  
Sbjct: 6424 KSKMGDMQMDDLPELQSILAQQDDMIKLIEDQLAHLRQLLLLREQFIALINEIIAFIMKY 6483

Query: 570  MKLKDRCKDTRKELEKRTRQFEDWYHKYMQ----RRTPNDDTEQ---DGPHEDNNVIERQ 412
              +    +++   LE +  +++D   K  +      + ND  ++   +G   D N I  Q
Sbjct: 6484 TDVIIDIENSPDSLEDKINKYDDVIVKIQECEGVLASANDKGQKIASEGNAADKNSITEQ 6543

Query: 411  LQLEALKQRLKEEEEAY--MRQCMQVRVKSLTSLRTGLPEL---FHAMSEFSRACSIMYQ 247
            LQ  +LK +L+   +A    RQ  Q++++S   +   L E+    H+    +++  ++ +
Sbjct: 6544 LQ--SLKNQLQNLRKAVESQRQKHQLQLESHKKMAAELSEILDWLHSHEGAAKSRPLLDR 6601

Query: 246  TLESITHPLNREST 205
              ES+   L +  +
Sbjct: 6602 DPESVERELQKHQS 6615



>gb:AE014134_1127619 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003608_1217726 Drosophila melanogaster
            chromosome 2L, section 17 of 83 of the complete sequence.
          Length = 7735

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 41/194 (21%), Positives = 85/194 (43%), Gaps = 17/194 (8%)
 Frame = -1

Query: 735  KEKVSSPQRPQNPPILALLHAWQDLIGKLPDELAKTAIY-----SFSAVVNTIVQHQLDE 571
            K K+   Q    P + ++L    D+I  + D+LA           F A++N I+   +  
Sbjct: 6659 KSKMGDMQMDDLPELQSILAQQDDMIKLIEDQLAHLRQLLLLREQFIALINEIIAFIMKY 6718

Query: 570  MKLKDRCKDTRKELEKRTRQFEDWYHKYMQ----RRTPNDDTEQ---DGPHEDNNVIERQ 412
              +    +++   LE +  +++D   K  +      + ND  ++   +G   D N I  Q
Sbjct: 6719 TDVIIDIENSPDSLEDKINKYDDVIVKIQECEGVLASANDKGQKIASEGNAADKNSITEQ 6778

Query: 411  LQLEALKQRLKEEEEAY--MRQCMQVRVKSLTSLRTGLPEL---FHAMSEFSRACSIMYQ 247
            LQ  +LK +L+   +A    RQ  Q++++S   +   L E+    H+    +++  ++ +
Sbjct: 6779 LQ--SLKNQLQNLRKAVESQRQKHQLQLESHKKMAAELSEILDWLHSHEGAAKSRPLLDR 6836

Query: 246  TLESITHPLNREST 205
              ES+   L +  +
Sbjct: 6837 DPESVERELQKHQS 6850



>gb:AE014186_938241 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014840_1228975 Plasmodium falciparum 3D7
           chromosome 11 section 5 of 8 of the complete sequence.
          Length = 479

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 39/162 (24%), Positives = 75/162 (46%), Gaps = 11/162 (6%)
 Frame = -1

Query: 822 EKMIIHQKEYIRGLNDWLKLNLVPIDTNL----KEKVSSPQRPQNPPILAL-LHAWQDLI 658
           E+ + ++KE ++   + LK+    IDTN     KEK    +  +   ++   L+  ++ I
Sbjct: 262 EETLKNEKEKVKQCKEVLKIEEKQIDTNKQVLDKEKEQIEKNKEELKLMQQNLNKEKEQI 321

Query: 657 GKLPDELAKTAIYSFSAVVNTIVQHQ-----LDEMKLKDRCKDTR-KELEKRTRQFEDWY 496
            K   EL K      +   N +++++     LDE K +   K+   K++E++    ED  
Sbjct: 322 EKNKQELDKEKQIYENDKKNIMLKNEDLKKLLDEYKEEIMNKEGHIKQIEEKILLLEDEK 381

Query: 495 HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEE 370
             +  +    D+  Q+  +E  N  +   QL+ L  +LKE+E
Sbjct: 382 KNFQNKIDILDNKMQEFKNEITNEKKLNYQLKILYNKLKEKE 423



>gb:AE017354_460836 Legionella pneumophila subsp. pneumophila str.
            Philadelphia 1, complete genome.>gb:AY261386_603652
            Legionella pneumophila effector protein B (lepB) gene,
            complete cds.
          Length = 1294

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 56/238 (23%), Positives = 97/238 (40%), Gaps = 7/238 (2%)
 Frame = -1

Query: 1005 SLVESMAR-MWETMKGHHENQCQIVLALRSLDMSQSPKETSEHHYERTYQLGVVVQEWHS 829
            S +ES+ + M+E  + + ENQ ++   + SL      K+     +E+  Q     ++   
Sbjct: 888  SALESLRKEMYELTRKNEENQLKLTKQVHSLSEQLEEKQLQIREFEKQLQ---EKEKRVE 944

Query: 828  QFEKMIIHQKEYIRGLNDW---LKLNLVPIDTNL--KEKVSSPQRPQNPPILALLHAWQD 664
            Q EK     K  +  L +    LKL L  +   +  KEK SS    Q+  I+AL    +D
Sbjct: 945  QSEKGKASAKRTVASLREQVSNLKLQLQQLGEVIQEKEKGSSLISQQSKQIIALQEIIED 1004

Query: 663  LIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLK-DRCKDTRKELEKRTRQFEDWYHKY 487
                                     + QL+E+K+K        +EL K+ +         
Sbjct: 1005 ------------------------QKRQLEELKIKIQELVSANQELGKQNQSLS------ 1034

Query: 486  MQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLR 313
             +    N +T +D   + N   E  +QLE L Q   E+E+  +R+  +  +K  +SL+
Sbjct: 1035 -KENLHNKNTVEDLKKKLN---ELNVQLEQLHQSSNEKEQT-IRKLREELIKKDSSLK 1087



>gb:SCO939108_174929 Streptomyces coelicolor A3(2) complete genome;
           segment 5/29.
          Length = 480

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 31/107 (28%), Positives = 51/107 (47%), Gaps = 5/107 (4%)
 Frame = -1

Query: 690 LALLHAWQDLIGKLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQ 511
           LA+L A +DL  ++PD     AI  +  V+N     Q+D   + +R K TR +++ R  +
Sbjct: 41  LAVLRAQKDLGIEVPD----AAIADYERVLN-----QVDLASIAEREKVTRHDVKARIEE 91

Query: 510 FED-----WYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
           F D       HK M  R   ++ EQ         ++ +L LE ++ R
Sbjct: 92  FNDLAGHEHVHKGMTSRDLTENVEQ---------LQIRLSLELVRDR 129



>pir|T43445|T43445 hypothetical protein DKFZp434A2017.1 - human
            (fragment)
          Length = 990

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 30/145 (20%), Positives = 67/145 (46%), Gaps = 20/145 (13%)
 Frame = -1

Query: 864  YQLGVVVQEWHSQFEKMIIHQKEYIRGLN---DWLKLNLVPIDTNL---KEKVSSPQRPQ 703
            ++L + ++E     E+ ++ +K+ +  L    D L   +  + TNL   +E + + QR +
Sbjct: 685  FELALHLREKRLDIEEALVEEKKIVDNLKKEYDTLSKKVKIVATNLNAAEEALEAYQREK 744

Query: 702  NPPILALL-------HAWQDLI-GKLPDELAKTAIYSFSAV------VNTIVQHQLDEMK 565
               +  LL       H  + ++ G++P +L+ T ++S  A+      +  + +    + K
Sbjct: 745  QQRLNELLVVIPLKPHQIEYVVFGEIPSDLSGTLVFSNHALRRLQERIRELQEENSKQQK 804

Query: 564  LKDRCKDTRKELEKRTRQFEDWYHK 490
            L    ++ RK+L +  R+     HK
Sbjct: 805  LNKEWRERRKQLIREKREMTKTIHK 829



>pir|A32264|A32264 parathymosin - human>gb:HUMTHYP_2037770 Human
           parathymosin mRNA, complete cds.
          Length = 102

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = -1

Query: 579 LDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQD-GPHEDNNVIERQLQL 403
           L E K K   K +RKE +K   + E+   +  +  T  D  E+D G  ED    E   + 
Sbjct: 17  LKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEG 76

Query: 402 EALKQRLKEEEEA 364
            ALK+  +EE+EA
Sbjct: 77  PALKRAAEEEDEA 89



>pir|JC5738|JC5738 membrane-bound proton-translocating ATPase (EC
           3.6.1.-) delta chain - Streptococcus
           mutans>gb:SMU31170_187563 Streptococcus mutans ATPase
           operon, complete sequence.
          Length = 177

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 33/138 (23%), Positives = 70/138 (50%), Gaps = 7/138 (5%)
 Frame = -1

Query: 954 ENQCQIVLALRSLDMSQSPK-----ETSEHHYERTYQLGVVVQEWHSQFEKMIIHQKEYI 790
           + Q Q  LA +++D+S   +     + S  +Y + + L +++Q    Q   +I+  KE +
Sbjct: 42  DQQVQDFLASKAIDLSAKAEVVRLFQESCSNYMKQF-LEIILQNERQQLLYLIM--KEVL 98

Query: 789 RGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAW--QDLIGKLPDELAKTAIYS 616
           + L+  LK ++  I+      +S  Q+ +   ++    A   ++LI K  DE+    I +
Sbjct: 99  KELS--LKTHIFDIEVTTAVALSDDQKERLTALVEKKFALTKRNLIEKXDDEIIGGFIKA 156

Query: 615 FSAVVNTIVQHQLDEMKL 562
            + V++T ++ QL E+K+
Sbjct: 157 NNKVIDTSIRSQLQELKM 174



>sp|P20962|THYP_HUMAN Parathymosin.
          Length = 101

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = -1

Query: 579 LDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQD-GPHEDNNVIERQLQL 403
           L E K K   K +RKE +K   + E+   +  +  T  D  E+D G  ED    E   + 
Sbjct: 16  LKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEG 75

Query: 402 EALKQRLKEEEEA 364
            ALK+  +EE+EA
Sbjct: 76  PALKRAAEEEDEA 88



>sp|P19515|LIP_RHIMI Lipase precursor (EC 3.1.1.3) (Triacylglycerol
           lipase).
          Length = 363

 Score = 33.5 bits (75), Expect = 6.9
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 16/90 (17%)
 Frame = +3

Query: 738 DLYQ*EPDLASTN---------RSG----L*YIPSGGLSFSQTVNATLVQQHLTGKC--- 869
           DLYQ E  L+S+N         R G      Y+ S G+ + +TVN   +  HL       
Sbjct: 250 DLYQREEGLSSSNLFLYTQGQPRVGDPAFANYVVSTGIPYRRTVNERDIVPHLPPAAFGF 309

Query: 870 VHSGAHLFLWGTATYPETSELARSDIDSHD 959
           +H+G     W T   PET ++  SD+++ D
Sbjct: 310 LHAGEEY--WITDNSPETVQVCTSDLETSD 337



>gb:BC073415_2557256 Xenopus laevis MGC80881 protein, mRNA (cDNA
           clone MGC:80881 IMAGE:5515171), complete cds.
          Length = 722

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 38/155 (24%), Positives = 72/155 (46%), Gaps = 5/155 (3%)
 Frame = -1

Query: 654 KLPDELAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRR 475
           +L ++L +  + S +  + +++Q          R K+T++EL +   + E W        
Sbjct: 219 RLENQLLRNEVQSLNQEMASLIQ----------RSKETQEELNEARTRMEKWNGD----N 264

Query: 474 TPNDDTEQDGPHEDNNVIE----RQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTG 307
           + ND T ++   + +++ E    +  QL  LK RL+E +     Q ++ R ++L SL+  
Sbjct: 265 SKNDRTARELRAQVDDLSEAMAAKDSQLAVLKVRLQEAD-----QLLKSRTETLESLQIE 319

Query: 306 LPELFHAMSEFSRACSIMYQTLESITHPLNR-EST 205
              +    SE S   SI  Q L+++   L   EST
Sbjct: 320 KSRILQDQSEGS---SIHNQALQTMQERLREAEST 351



>gb:BC072844_2556770 Xenopus laevis hypothetical protein LOC443585,
            mRNA (cDNA clone IMAGE:4971062), partial cds.
          Length = 1388

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 50/210 (23%), Positives = 88/210 (41%), Gaps = 6/210 (2%)
 Frame = -1

Query: 885  EHHYERTYQLGVVVQEWHSQFEKMIIHQKEYIRGLNDWLKLNLVPIDTNLKEKVSSPQRP 706
            E   ERT QL    ++ H   + +   Q E   G    L+L  V  ++ LK+   +    
Sbjct: 939  EEEEERTLQLQNEKKKMHQHIQDLE-EQLEEEEGARQKLQLEKVTTESKLKKMEEN---- 993

Query: 705  QNPPILALLHAWQDLIGKLPDE--LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKE 532
                IL L    +D   KL  E  L    I  F++ +    +      KL+++ +    +
Sbjct: 994  ----ILLL----EDQNAKLAKERKLLDERISDFTSTMAEEEEKVKSLNKLRNKYEAVIAD 1045

Query: 531  LEKRTRQFEDWYHKY--MQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEEAYM 358
            LE R ++ E    +   M+R+   + T+       + ++E Q Q+E LKQ+L  +EE   
Sbjct: 1046 LEDRLKKEEKGRQEMEKMKRKLDGETTDLQ-----DQLLELQQQIEELKQQLARKEEELQ 1100

Query: 357  RQCMQV--RVKSLTSLRTGLPELFHAMSEF 274
                ++   V    +L   L +L   ++EF
Sbjct: 1101 AALARIDDEVGQKNNLLKQLRDLQSQLAEF 1130



>gb:AX961932_1484460 Sequence 143 from Patent
           WO03104277.>gb:AK056434_1911733 Homo sapiens cDNA
           FLJ31872 fis, clone NT2RP7002376, weakly similar to M
           PROTEIN, SEROTYPE 2.1 PRECURSOR.
          Length = 1066

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/71 (22%), Positives = 39/71 (54%)
 Frame = -1

Query: 582 QLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQL 403
           +LD ++ +   +D + +++++  + E WY K    R   +   +    E+  +I+++ +L
Sbjct: 699 ELDYLRERQTVEDMQAKVDQQRVEDEAWYQKQELLRKAEETRREMLLQEEEKMIQQRQRL 758

Query: 402 EALKQRLKEEE 370
            A+K+ LK +E
Sbjct: 759 AAVKRELKVKE 769



>gb:AF131221_1243493 Dictyostelium discoideum p21-activated protein
           kinase PakA (pakA) mRNA, complete cds.
          Length = 1191

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 2/81 (2%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTR--KELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIER 415
           Q +++ ++ ++   + R  +EL  R RQ ED        R   ++ E++   E  N + R
Sbjct: 417 QREIERLREEEEENEDRVERELASRRRQEED--------RIKREEEEEE--EEQRNYLRR 466

Query: 414 QLQLEALKQRLKEEEEAYMRQ 352
             +LE +KQ  +EEEE   RQ
Sbjct: 467 LKELERIKQIEEEEEEERERQ 487



>gb:CR858097_1182284 Pongo pygmaeus mRNA; cDNA DKFZp459O0833 (from
           clone DKFZp459O0833).
          Length = 944

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 16/71 (22%), Positives = 39/71 (54%)
 Frame = -1

Query: 582 QLDEMKLKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQL 403
           +LD ++ +   +D + +++++  + E WY K    R   +   +    E+  +I+++ +L
Sbjct: 576 ELDYLRERQTVEDMQAKVDQQRVEDEAWYQKQELLRKAEETRREMLLQEEEKMIQQRQRL 635

Query: 402 EALKQRLKEEE 370
            A+K+ LK +E
Sbjct: 636 AAVKRELKVKE 646



>gb:AK078225_1172233 Mus musculus adult male olfactory brain cDNA,
           RIKEN full-length enriched library, clone:6430524H16
           product:similar to HYPOTHETICAL 139.5 KDA PROTEIN [Homo
           sapiens], full insert sequence.
          Length = 734

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = -1

Query: 588 QHQLDEMKLKDRCKDTRKELEK-RTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQ 412
           + + +  + ++R K+  +ELE+ R R+ E    K  +R    +  ++D  H+     ER+
Sbjct: 659 EREREREREREREKERERELERERAREREREREKERERERERERDQRDRDHDRERERERE 718

Query: 411 LQLEALKQRLKEEEE 367
            + E  ++R +EE E
Sbjct: 719 REREKEREREREERE 733



>gb:BA000028_695678 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 623

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 28/119 (23%), Positives = 48/119 (40%), Gaps = 5/119 (4%)
 Frame = -1

Query: 612 SAVVNTIVQHQLDEMKL-----KDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQD 448
           S ++N +    +DE++      K +      E+E     + D   K++     N    Q 
Sbjct: 505 STMINNLENAVIDEIQTAFNEEKQKVMSKINEMEASPGLYRDLLRKHIYFPRLNKTVRQI 564

Query: 447 GPHEDNNVIERQLQLEALKQRLKEEEEAYMRQCMQVRVKSLTSLRTGLPELFHAMSEFS 271
             HE             L+Q   +EE +YMRQ ++   K + + RT + +LF A    S
Sbjct: 565 NVHE---------AFLPLEQADLDEEISYMRQSVEKGKKHIETYRTSIEDLFEAEDHVS 614



>gb:SPEMM3G_188147 S.pyogenes emm3 gene.
          Length = 581

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 35/163 (21%), Positives = 71/163 (43%), Gaps = 4/163 (2%)
 Frame = -1

Query: 843 QEWHSQFEKMIIHQK-EYIRGLNDWLKLNLVPIDTNLKEKVSSPQRPQNPPILALLHAWQ 667
           Q++ +Q  ++ + QK EY++GLNDW +  L  ++    +KV      +   +   +   +
Sbjct: 79  QQYSAQAGRLDLRQKAEYLKGLNDWAERLLQELNGEDVKKVLGKVAFEKDDLEKEVKELK 138

Query: 666 DLIGKLPDE---LAKTAIYSFSAVVNTIVQHQLDEMKLKDRCKDTRKELEKRTRQFEDWY 496
           + I K   E   L K    +    V +  +HQ +  + + +  +   ++ + + + E   
Sbjct: 139 EKIDKKEKEYQDLDKDFDLAKQGYVLSDKRHQQELEEKEKKVTEATAKVGQISEELETVK 198

Query: 495 HKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQRLKEEEE 367
            K        + T QD   + N V + + +L   KQ  KE+ E
Sbjct: 199 QKV-------ESTMQDLTEKQNRVSQLEQELATTKQNAKEDFE 234



>pir|I48176|I48176 synaptonemal complex protein - golden hamster
           (fragment)
          Length = 845

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 17/81 (20%), Positives = 43/81 (53%)
 Frame = -1

Query: 564 LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
           L+++C + RK+ E +++  E+ + +    +  +    +     +  V + QL+LE+ KQ+
Sbjct: 471 LENKCNNLRKQAENKSKYIEELHQENKALKKKSSAESKQLNAYEIKVNKLQLELESAKQK 530

Query: 384 LKEEEEAYMRQCMQVRVKSLT 322
            +E  + Y +   ++ VK ++
Sbjct: 531 FQEMTDNYQK---EIEVKKIS 548



>sp|Q60563|SCP1_MESAU Synaptonemal complex protein 1 (SCP-1 protein)
           (Meiotic chromosome synaptic protein)
           (Fragment).>gb:HAMSYN1A_2113136 Mesocricetus auratus
           synaptonemal complex protein (syn1) mRNA, partial cds.
          Length = 845

 Score = 33.1 bits (74), Expect = 9.1
 Identities = 17/81 (20%), Positives = 43/81 (53%)
 Frame = -1

Query: 564 LKDRCKDTRKELEKRTRQFEDWYHKYMQRRTPNDDTEQDGPHEDNNVIERQLQLEALKQR 385
           L+++C + RK+ E +++  E+ + +    +  +    +     +  V + QL+LE+ KQ+
Sbjct: 471 LENKCNNLRKQAENKSKYIEELHQENKALKKKSSAESKQLNAYEIKVNKLQLELESAKQK 530

Query: 384 LKEEEEAYMRQCMQVRVKSLT 322
            +E  + Y +   ++ VK ++
Sbjct: 531 FQEMTDNYQK---EIEVKKIS 548


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,038,866,299
Number of Sequences: 1806583
Number of extensions: 22185841
Number of successful extensions: 64119
Number of sequences better than 10.0: 128
Number of HSP's better than 10.0 without gapping: 60498
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 63881
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 75848256300
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)