BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12981
         (689 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003684_1831983 Oryza sativa (japonica cultivar-group) genom...    76   5e-13   
gb:AY085665_1570733 Arabidopsis thaliana clone 1678 mRNA, comple...    76   6e-13   
pir|T47579|T47579 hypothetical protein F24B22.160 - Arabidopsis ...    76   6e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP004573_1841805 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
pir|C84899|C84899 hypothetical protein At2g46150 [imported] - Ar...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
pir|E96563|E96563 hypothetical protein F19K6.6 [imported] - Arab...    48   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP003218_1825421 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
pir|T05593|T05593 hypothetical protein F9D16.80 - Arabidopsis th...    44   0.003   Arabidopsis thaliana [mouse-ear cress]
pir|T47428|T47428 hypothetical protein T22K7.60 - Arabidopsis th...    42   0.013   Arabidopsis thaliana [mouse-ear cress]
gb:AP003943_1835568 Oryza sativa (japonica cultivar-group) genom...    39   0.087   
gb:AY648317_1619995 Arabidopsis thaliana hypothetical protein (A...    39   0.087   
gb:AE005173_894066 Arabidopsis thaliana chromosome 1, bottom arm...    39   0.11    
gb:AC123974_1740372 Oryza sativa chromosome 3 BAC OSJNBb0021P10 ...    37   0.33    
gb:AC108499_1738454 Oryza sativa (japonica cultivar-group) chrom...    37   0.43    
pir|T00680|T00680 hypothetical protein At2g44000 [imported] - Ar...    37   0.43    Arabidopsis thaliana [mouse-ear cress]
gb:BX842650_824508 Bdellovibrio bacteriovorus complete genome, s...    35   1.3     
gb:AC136519_1743240 Oryza sativa (japonica cultivar-group) chrom...    35   1.6     
gb:BA000012_669387 Mesorhizobium loti MAFF303099 DNA, complete g...    34   2.1     
gb:HSU78550_2026189 Homo sapiens gallbladder mucin MUC5B mRNA, p...    33   3.6     
gb:AP002481_1822156 Oryza sativa (japonica cultivar-group) genom...    33   3.6     
gb:BT003320_1356831 Drosophila melanogaster AT11823 full insert ...    33   3.6     
gb:AY059166_1564529 Arabidopsis thaliana At2g01080/F23H14.5 mRNA...    33   4.8     
gb:AC006837_1534625 Arabidopsis thaliana chromosome 2 BAC F23H14...    33   4.8     
pir|D84420|D84420 hypothetical protein At2g01080 [imported] - Ar...    33   4.8     Arabidopsis thaliana [mouse-ear cress]
gb:HSMUC5BEX_2018957 H.sapiens MUC5B gene (partial).                   32   8.1     
gb:AE012819_285908 Chlorobium tepidum TLS section 40 of 194 of t...    32   8.1     
pir|T45025|T45025 mucin MUC5B, tracheobronchial [imported] - hum...    32   8.1     Homo sapiens [man]
sp|Q9HC84|MU5B_HUMAN|MU5B_HUMAN Mucin 5B precursor (Mucin 5 subtype B, trac...    32   8.1     Homo sapiens [man]


>gb:AP003684_1831983 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0485D10.
          Length = 278

 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 45/118 (38%), Positives = 58/118 (49%), Gaps = 5/118 (4%)
 Frame = -1

Query: 377 PNPSISATLNLIINVKNPNRGDFEYQ---GATASLDYRGISVAGIPVEHDTVPGRGEINV 207
           P+P I+ TL L + V NPN   F Y    G  A L YRG  V    VE   +P RG+  V
Sbjct: 141 PSPQINVTLLLTVAVHNPNPASFTYSSDSGGHADLTYRGAHVGDAVVEAGRIPSRGDGAV 200

Query: 206 TTYANVTGDKIAGN--PSFMEDMAAGSVMFTSSAALPGKVKVLRTLKIHATVFMTCDV 39
                V      G+     + D+ AG+V F +SA +PGKV V   LK+HA  +  C V
Sbjct: 201 QMEMTVLSSSFTGDVMAELIRDIEAGAVPFDASARIPGKVAVFGVLKLHAVAYSDCHV 258



>gb:AY085665_1570733 Arabidopsis thaliana clone 1678 mRNA, complete
           sequence.
          Length = 235

 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 44/181 (24%), Positives = 79/181 (43%), Gaps = 3/181 (1%)
 Frame = -1

Query: 557 GTGGKASSRKSLKICCCXXXXXXXXXXXXXXXXXXXXFKPKNPILTPYPTKLQNVHFRFD 378
           GT  K   +++ KIC C                    FKPK P  T     +  +    +
Sbjct: 40  GTAKKLRRKRNCKICICFTILLILLIAIVIVILAFTLFKPKRPTTTIDSVTVDRLQASVN 99

Query: 377 P---NPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEINV 207
           P      ++ TLN+ +++KNPNR  F Y  ++A L+YRG  +   P+  + +  R  + +
Sbjct: 100 PLLLKVLLNLTLNVDLSLKNPNRIGFSYDSSSALLNYRGQVIGEAPLPANRIAARKTVPL 159

Query: 206 TTYANVTGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKVLRTLKIHATVFMTCDVCVFI 27
                +  D++      + D+ AG +   +   + GKV VL+  KI      +CD+ + +
Sbjct: 160 NITLTLMADRLLSETQLLSDVMAGVIPLNTFVKVTGKVTVLKIFKIKVQSSSSCDLSISV 219

Query: 26  N 24
           +
Sbjct: 220 S 220



>pir|T47579|T47579 hypothetical protein F24B22.160 - Arabidopsis
           thaliana>gb:ATF24B22_1549829 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F24B22.
          Length = 235

 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 44/181 (24%), Positives = 79/181 (43%), Gaps = 3/181 (1%)
 Frame = -1

Query: 557 GTGGKASSRKSLKICCCXXXXXXXXXXXXXXXXXXXXFKPKNPILTPYPTKLQNVHFRFD 378
           GT  K   +++ KIC C                    FKPK P  T     +  +    +
Sbjct: 40  GTAKKLRRKRNCKICICFTILLILLIAIVIVILAFTLFKPKRPTTTIDSVTVDRLQASVN 99

Query: 377 P---NPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEINV 207
           P      ++ TLN+ +++KNPNR  F Y  ++A L+YRG  +   P+  + +  R  + +
Sbjct: 100 PLLLKVLLNLTLNVDLSLKNPNRIGFSYDSSSALLNYRGQVIGEAPLPANRIAARKTVPL 159

Query: 206 TTYANVTGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKVLRTLKIHATVFMTCDVCVFI 27
                +  D++      + D+ AG +   +   + GKV VL+  KI      +CD+ + +
Sbjct: 160 NITLTLMADRLLSETQLLSDVMAGVIPLNTFVKVTGKVTVLKIFKIKVQSSSSCDLSISV 219

Query: 26  N 24
           +
Sbjct: 220 S 220



>gb:AP004573_1841805 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0678G09.>gb:AP005105_1847914 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0052O11.
          Length = 213

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 40/175 (22%), Positives = 70/175 (40%)
 Frame = -1

Query: 551 GGKASSRKSLKICCCXXXXXXXXXXXXXXXXXXXXFKPKNPILTPYPTKLQNVHFRFDPN 372
           G K  ++   + CC                      +P   + TP    ++   F   P 
Sbjct: 4   GKKTKTKPHRRACCLLLAAVAVLGALVLALYLVYRPRPPRVVATPVDVTIEL--FSLVP- 60

Query: 371 PSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEINVTTYAN 192
           P + A + + + V NP+   + Y  + AS+ Y G  V    V    V  R    +     
Sbjct: 61  PKLKAAVGVHVVVTNPSNSAYRYGESLASVTYHGERVGASVVPRGEVEARSTRLIEPATA 120

Query: 191 VTGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKVLRTLKIHATVFMTCDVCVFI 27
           V   ++A +P F  D AAG + F +   + GK  VLR+ ++  +V + C V +++
Sbjct: 121 VDVVRVAESPHFAHDAAAGVLPFVAVTTVEGKALVLRSFEVSVSVEVVCFVQMYV 175



>pir|C84899|C84899 hypothetical protein At2g46150 [imported] -
           Arabidopsis thaliana>gb:AC005397_1532661 Arabidopsis
           thaliana chromosome 2 clone T3F17 map CIC02E07, complete
           sequence.>gb:AY102565_1577794 Arabidopsis thaliana
           hypothetical protein (At2g46150/T3F17.20) mRNA, complete
           cds.>gb:AY649242_1620042 Arabidopsis thaliana
           hypothetical protein (At2g46150) gene, complete cds.
          Length = 221

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 5/110 (4%)
 Frame = -1

Query: 341 INVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEINVTTYANVTG----DKI 174
           ++VKNPN   F+Y   T  + Y+G  V     E   +PG+   + T+  NVT     D+I
Sbjct: 100 VSVKNPNTASFKYSNTTTDIYYKGTLVG----EAHGLPGKARPHRTSRMNVTVDIMLDRI 155

Query: 173 AGNPSFMEDMA-AGSVMFTSSAALPGKVKVLRTLKIHATVFMTCDVCVFI 27
             +P    +++ +G V   S   + GKVK++  +K H TV M C + V I
Sbjct: 156 LSDPGLGREISRSGLVNVWSYTRVGGKVKIMGIVKKHVTVKMNCTMAVNI 205



>pir|E96563|E96563 hypothetical protein F19K6.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_893145 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC037424_1540005 Arabidopsis thaliana
           chromosome 1 BAC F19K6 genomic sequence, complete
           sequence.
          Length = 214

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 1/120 (0%)
 Frame = -1

Query: 440 PKNPILTPYPTKLQNVHFRFDPNPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISV 261
           P +P +     K+ +VH    P PSI  TL + + V N +   F++     ++DYRG ++
Sbjct: 64  PSDPRIKIIRVKISHVHVHRRPVPSIDMTLLVTLKVSNADVYSFDFTDLDVTIDYRGKTL 123

Query: 260 AGIPVEHDTVPGRGEINVTTYANVTGDKIAGNP-SFMEDMAAGSVMFTSSAALPGKVKVL 84
             +  +   V   G   +   A + G  +  +    + D+A GSV F +     GK+ VL
Sbjct: 124 GHVSSDGGHVTAFGSSYLDAEAELDGVMVFPDVIHLIHDLAKGSVEFDTVTETNGKLGVL 183



>gb:AP003218_1825421 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBb0021A09.>gb:AP003560_1830774 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1060H01.
          Length = 251

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 26/115 (22%), Positives = 51/115 (44%)
 Frame = -1

Query: 368 SISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEINVTTYANV 189
           S++ATLN  ++++NPN   F +  +     Y G +V         V     + +    +V
Sbjct: 120 SVNATLNADVSLRNPNVASFRFDRSETDFYYAGETVGVAYAPEGEVGADSTVRMNVTLDV 179

Query: 188 TGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKVLRTLKIHATVFMTCDVCVFIN 24
             D+I+ N +  + +       TS   + G+V VL   K +  + M C + + ++
Sbjct: 180 LADRISPNVNATDLIFGQGYNLTSYTEISGRVNVLGIYKRNLDIKMNCSITLEVS 234



>pir|T05593|T05593 hypothetical protein F9D16.80 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546198 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF9D16_1551285
           Arabidopsis thaliana DNA chromosome 4, BAC clone F9D16
           (ESSAII project).>gb:AY133514_1581337 Arabidopsis
           thaliana At4g23610/F9D16_80 mRNA, complete
           cds.>gb:AF372921_1792636 Arabidopsis thaliana
           AT4g23610/F9D16_80 mRNA, complete cds.
          Length = 228

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 6/128 (4%)
 Frame = -1

Query: 374 NPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEH-DTVPGRGEINVTTY 198
           N + + T+++ I++ NPN   F  +    S  +  + V G  +   +T+P +  + +   
Sbjct: 100 NTNQNTTVSVEISLHNPNPALFIVKNVNVSFYHGELVVVGESIRRSETIPAKRTVKMNLT 159

Query: 197 ANVTGDKI-AGNPSFMEDMAAGSVMFTSSAALPGKVKVL----RTLKIHATVFMTCDVCV 33
           A +   K+ A  P  MED+    V   SS  + G+VK +    +T+ +    FM      
Sbjct: 160 AEIVKTKLLASLPGLMEDLNGRGVDLKSSVEVRGRVKKMKIFRKTVHLQTDCFMKMTTNN 219

Query: 32  FINPVVLC 9
           F+ P   C
Sbjct: 220 FLTPTFQC 227



>pir|T47428|T47428 hypothetical protein T22K7.60 - Arabidopsis
           thaliana>gb:ATT22K7_1555295 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T22K7.
          Length = 186

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 4/138 (2%)
 Frame = -1

Query: 443 KPKNPILTPYPTKLQNVHFRFDPNPSISATLNLIINVKNPNRGDFEYQGATASLDYRGIS 264
           KPK+P        L ++       P + A L L ++V NPN     Y     ++ Y G  
Sbjct: 32  KPKDPTFHLISIDLTSLKLNL---PVLDAELMLTVHVTNPNIAAIHYSSTKMTILYDGTV 88

Query: 263 VAGIPVEHDTVPGRGEINVTTYANVTGDKIAGNP-SFMEDMAAGSVMFTSSAALPGKVKV 87
           +    V+  + P R    +   A + G ++A +   F  D+A   +   +   + G  KV
Sbjct: 89  LGSAEVKAGSQPARSCQLLRLPARLDGMELAQHARQFFSDVANREMKLEAKLTIEGAAKV 148

Query: 86  L---RTLKIHATVFMTCD 42
           L    + ++H   F+T D
Sbjct: 149 LWWDHSFRVHVDSFVTVD 166



>gb:AP003943_1835568 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1119_B04.
          Length = 237

 Score = 38.9 bits (89), Expect = 0.087
 Identities = 34/128 (26%), Positives = 52/128 (40%), Gaps = 8/128 (6%)
 Frame = -1

Query: 440 PKNPILTPYPTKLQNVHFRFDPNPSISATLNLIINVKNPNRG-DFEYQGATASLDYRGIS 264
           P  P+      +L        P PS+   L L + V+NP       Y+  +A++ YRG  
Sbjct: 106 PSAPVARVEGLRLDRFRVNPPPLPSVDLHLALRLRVRNPGLVLPLRYRAVSAAVSYRGHL 165

Query: 263 VAGIPVEHDTVPGRGEINV--TTYANV-----TGDKIAGNPSFMEDMAAGSVMFTSSAAL 105
           +          PG GE+    TTYA+       G  +      + D+AAGS+       +
Sbjct: 166 LGSAAAR----PGSGELGARGTTYADAEVWVDAGRVVDDVIDLIGDLAAGSLPLEIVTEV 221

Query: 104 PGKVKVLR 81
            G V+V R
Sbjct: 222 VGAVRVFR 229



>gb:AY648317_1619995 Arabidopsis thaliana hypothetical protein
           (At1g64065) mRNA, complete cds.>gb:AY773828_1628204
           Arabidopsis thaliana clone pENTR221-At1g64065
           hypothetical protein (At1g64065) gene, complete cds.
          Length = 214

 Score = 38.9 bits (89), Expect = 0.087
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 2/112 (1%)
 Frame = -1

Query: 374 NPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAG-IPVEHDTVPGRGEINVT-T 201
           NP  +ATL   I+++N N G FE++ +T  + Y    V G   +E   V     + +T  
Sbjct: 87  NPYFNATLVSDISIRNSNFGAFEFEDSTLRVVYADHGVVGETKIEGRRVEAHKTVRITGV 146

Query: 200 YANVTGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKVLRTLKIHATVFMTC 45
              +   ++       +D+  G +   S A + G++KVL   +   +V M+C
Sbjct: 147 VVEIGSFRLLDTKDLDKDLRLGFLELRSVAEVRGRIKVLGRKRWKVSV-MSC 197



>gb:AE005173_894066 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007764_1536179 Genomic sequence
           for Arabidopsis thaliana BAC F22C12 from chromosome I,
           complete sequence.
          Length = 1195

 Score = 38.5 bits (88), Expect = 0.11
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 2/99 (2%)
 Frame = -1

Query: 374 NPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAG-IPVEHDTVPGRGEINVT-T 201
           NP  +ATL   I+++N N G FE++ +T  + Y    V G   +E   V     + +T  
Sbjct: 87  NPYFNATLVSDISIRNSNFGAFEFEDSTLRVVYADHGVVGETKIEGRRVEAHKTVRITGV 146

Query: 200 YANVTGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKVL 84
              +   ++       +D+  G +   S A + G++KVL
Sbjct: 147 VVEIGSFRLLDTKDLDKDLRLGFLELRSVAEVRGRIKVL 185



>gb:AC123974_1740372 Oryza sativa chromosome 3 BAC OSJNBb0021P10
           genomic sequence, complete sequence.
          Length = 259

 Score = 37.0 bits (84), Expect = 0.33
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 1/117 (0%)
 Frame = -1

Query: 440 PKNPILTPYPTKLQNVHFRFDPNPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISV 261
           P +P ++    +L +V     P   ++ +  L + V+NP+    +Y      + YRG  +
Sbjct: 76  PADPDVSVARLRLAHVSVSARPTVRVTISAALKVRVRNPDLFALDYGRLDVDIGYRGAPL 135

Query: 260 AGIPVEHDTVPGRGEINVTTYANVTGDKIAGNPSF-MEDMAAGSVMFTSSAALPGKV 93
             +      V  R    +    ++ G  +  +  + +ED+A GSV F + A + G V
Sbjct: 136 GRVTSGGGRVRARAVSYIDANLSLDGISVVEDAIYLLEDLARGSVPFDTVAEVEGHV 192



>gb:AC108499_1738454 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1187_E11, complete
           sequence.>gb:AC109596_1738740 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1593_C11, complete
           sequence.
          Length = 253

 Score = 36.6 bits (83), Expect = 0.43
 Identities = 28/110 (25%), Positives = 49/110 (44%), Gaps = 2/110 (1%)
 Frame = -1

Query: 362 SATLNLIINVKNPNRGDFEYQGATASLDYRG--ISVAGIPVEHDTVPGRGEINVTTYANV 189
           +ATL   ++VKNPN     +  +   + Y+G  +SVA +P           +N+T   ++
Sbjct: 113 NATLTADVSVKNPNAASLRFSRSETDVYYKGKTVSVAYVPAGSVGADRTVRMNIT--LDL 170

Query: 188 TGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKVLRTLKIHATVFMTCDV 39
             D++A   +    +       T+  A+  +V VL  +K    V M C V
Sbjct: 171 LADRLASVLNGTGLILGQEYDLTTYTAMRARVSVLGIIKKSLDVRMNCSV 220



>pir|T00680|T00680 hypothetical protein At2g44000 [imported] -
           Arabidopsis thaliana>gb:AC004005_1531310 Arabidopsis
           thaliana chromosome 2 clone F6E13 map CIC10F02,
           CIC02E07, complete sequence.>gb:AY219118_1590325
           Arabidopsis thaliana hypothetical protein
           (At2g44000/F6E13.13) mRNA, complete
           cds.>gb:AY649240_1620040 Arabidopsis thaliana
           hypothetical protein (At2g44000) gene, complete cds.
          Length = 209

 Score = 36.6 bits (83), Expect = 0.43
 Identities = 30/118 (25%), Positives = 54/118 (45%), Gaps = 7/118 (5%)
 Frame = -1

Query: 425 LTPYPTKLQNVHFRFDPNPSIS------ATLNLIINVKNPNRGDFEYQGATASLDYRGIS 264
           LT   T ++  + R++ N S S      ATL + I ++NPN G FE+  +   + Y G  
Sbjct: 61  LTASLTSVEVRNLRYNNNTSSSSSLYFNATLAMEIRIENPNLGFFEFPTSRGEILYNGDV 120

Query: 263 VAGIPVEHDTVPGRGEINVTTYANVTGDKIAGNPSFME-DMAAGSVMFTSSAALPGKV 93
           V  + +    V   G++     A V       +P +++ D+    ++  + A L G+V
Sbjct: 121 VGEMRINGQRVASFGDLRTEVSAEVAYRGNQKSPVWLKNDIERRLIILETRAKLRGEV 178



>gb:BX842650_824508 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 5/11.
          Length = 506

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 28/117 (23%), Positives = 46/117 (39%), Gaps = 3/117 (2%)
 Frame = -1

Query: 380 DPNPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEINVTT 201
           D NP+++ +L  +    + N+G+F  Q     L   GIS   +   +    G  EIN   
Sbjct: 172 DGNPNVAMSLIGLCGHDDKNQGEFTNQDVEIKLSNSGISSDEL---YSPTDGNSEINTVC 228

Query: 200 YANVTGDKIAGNPSFMEDMAAGSVMFTSSAALPGKVKV---LRTLKIHATVFMTCDV 39
            +      +AG  S   D++        S   PGK  +    +   +    FMTC +
Sbjct: 229 PSQYADFYVAGGLSKASDISDDLKKKVLSIQYPGKKDIQIASKNYHVMGAAFMTCQM 285



>gb:AC136519_1743240 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0007C23, complete sequence.
          Length = 293

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 36/140 (25%), Positives = 60/140 (42%), Gaps = 15/140 (10%)
 Frame = -1

Query: 443 KPKNPILTPYPTKLQNVHFRFDP-NPSISATLNLIINVKNPNR------GDFEYQGATAS 285
           +P  P  T    KL  ++    P +PS++ ++ L +  KNPN+       DF +  +TA+
Sbjct: 91  RPHRPSFTVSSVKLTALNLSSSPTSPSLTDSIQLTVTAKNPNKKVVYLYDDFSFSASTAA 150

Query: 284 LDYRGISVAGIPVEHDTVPG----RGEINVTTYANVTGDKIAGNP----SFMEDMAAGSV 129
                     +P+   T PG     G   V T A +  + +A +P    S ++   A SV
Sbjct: 151 --------NAVPLGAATSPGFTHDAGNTTVFT-ATIAANAVAVDPAAAASDIKKSGAFSV 201

Query: 128 MFTSSAALPGKVKVLRTLKI 69
              +      +V  L+T KI
Sbjct: 202 AVDAETRAGVRVGSLKTKKI 221



>gb:BA000012_669387 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 3930

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 21/83 (25%), Positives = 37/83 (44%), Gaps = 2/83 (2%)
 Frame = -1

Query: 341 INVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEINVTTYA-NVTGDKIAGN 165
           IN+ NP  G   + G  A++    I ++G+ V           N T  + N+TG   AG 
Sbjct: 647 INITNPGAGGMSFSGVNAAVVAGNIVISGLGVGAGLDFSGSRTNFTAQSLNITGPGAAGT 706

Query: 164 PSF-MEDMAAGSVMFTSSAALPG 99
               + D   G+++ T+  ++ G
Sbjct: 707 IGIDLSDTTGGTIVVTNGGSISG 729



>gb:HSU78550_2026189 Homo sapiens gallbladder mucin MUC5B mRNA,
           partial cds.
          Length = 328

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 28/85 (32%), Positives = 40/85 (47%)
 Frame = -2

Query: 433 TPYSLPTLQNSKTSISGLTQTLQ*APLST*SSTSRIQTVGTSSTRVPRPVLITEAYLWPE 254
           TP S+P   ++ T ++  T T+    ++T SS++  QT GT       P LIT A     
Sbjct: 212 TPSSIPGTTHTPTVLTTTTTTVATGSMATPSSST--QTSGTP------PSLITTATTITA 263

Query: 253 SPSNTTPSRVEARLTSPLMLTLPAT 179
           + S T PS        P +LT  AT
Sbjct: 264 TGSTTNPSSTPGTTPIPPVLTTTAT 288



>gb:AP002481_1822156 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0702F03.
          Length = 259

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 31/135 (22%), Positives = 51/135 (37%), Gaps = 16/135 (11%)
 Frame = -1

Query: 389 FRFDPNPSISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPGRGEIN 210
           F   PN +++ T      V+NPNR    +  ++  + Y G  +  + +    + G    +
Sbjct: 113 FASGPNGTVAFTFEQTAAVRNPNRAPLAHFDSSLRVAYAGGELGSVYIPAGLIDGGRTKD 172

Query: 209 VTTYANVTGDKIAGNPSFMEDM---------------AAGSVMFTSS-AALPGKVKVLRT 78
           ++    V     A  PS  ++                AA +VM   S   + G+V VLR 
Sbjct: 173 MSASFAVPAFAAATPPSLPQEQMAAAAAASAQQQQPAAAAAVMEVDSLLVVKGRVTVLRV 232

Query: 77  LKIHATVFMTCDVCV 33
           L  H      C V V
Sbjct: 233 LTHHVEAAKVCRVGV 247



>gb:BT003320_1356831 Drosophila melanogaster AT11823 full insert
           cDNA.
          Length = 798

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 22/61 (36%), Positives = 34/61 (55%)
 Frame = -2

Query: 352 ST*SSTSRIQTVGTSSTRVPRPVLITEAYLWPESPSNTTPSRVEARLTSPLMLTLPATRS 173
           ST ++++   TVGT++T      L+ +      S S+T P+   A L SP ML+L AT +
Sbjct: 156 STNTTSTTTTTVGTTNTHRTVERLVDQRNNNHNSNSSTNPTVEGATLRSPSMLSLSATST 215

Query: 172 P 170
           P
Sbjct: 216 P 216



>gb:AY059166_1564529 Arabidopsis thaliana At2g01080/F23H14.5 mRNA,
           complete cds.>gb:AF378858_1793443 Arabidopsis thaliana
           At2g01080/F23H14.5 mRNA, complete cds.
          Length = 231

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 30/116 (25%), Positives = 45/116 (38%), Gaps = 10/116 (8%)
 Frame = -1

Query: 542 ASSRKSLKICCC---XXXXXXXXXXXXXXXXXXXXFKPKNP------ILTPYPTKLQNVH 390
           +SS  SLK CCC                        KPK P      +   Y   + N  
Sbjct: 31  SSSSASLKGCCCCLFLLFAFLALLVLAVVLIVILAVKPKKPQFDLQQVAVVY-MGISNPS 89

Query: 389 FRFDPNP-SISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPG 225
              DP   S+S T+ ++    NPN+    Y  ++ ++ Y+     G+P+   TVPG
Sbjct: 90  AVLDPTTASLSLTIRMLFTAVNPNKVGIRYGESSFTVMYK-----GMPLGRATVPG 140



>gb:AC006837_1534625 Arabidopsis thaliana chromosome 2 BAC F23H14
           genomic sequence, complete sequence.
          Length = 231

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 30/116 (25%), Positives = 45/116 (38%), Gaps = 10/116 (8%)
 Frame = -1

Query: 542 ASSRKSLKICCC---XXXXXXXXXXXXXXXXXXXXFKPKNP------ILTPYPTKLQNVH 390
           +SS  SLK CCC                        KPK P      +   Y   + N  
Sbjct: 31  SSSSASLKGCCCCLFLLFAFLALLVLAVVLIVILAVKPKKPQFDLQQVAVVY-MGISNPS 89

Query: 389 FRFDPNP-SISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPG 225
              DP   S+S T+ ++    NPN+    Y  ++ ++ Y+     G+P+   TVPG
Sbjct: 90  AVLDPTTASLSLTIRMLFTAVNPNKVGIRYGESSFTVMYK-----GMPLGRATVPG 140



>pir|D84420|D84420 hypothetical protein At2g01080 [imported] -
           Arabidopsis thaliana
          Length = 220

 Score = 33.1 bits (74), Expect = 4.8
 Identities = 30/116 (25%), Positives = 45/116 (38%), Gaps = 10/116 (8%)
 Frame = -1

Query: 542 ASSRKSLKICCC---XXXXXXXXXXXXXXXXXXXXFKPKNP------ILTPYPTKLQNVH 390
           +SS  SLK CCC                        KPK P      +   Y   + N  
Sbjct: 31  SSSSASLKGCCCCLFLLFAFLALLVLAVVLIVILAVKPKKPQFDLQQVAVVY-MGISNPS 89

Query: 389 FRFDPNP-SISATLNLIINVKNPNRGDFEYQGATASLDYRGISVAGIPVEHDTVPG 225
              DP   S+S T+ ++    NPN+    Y  ++ ++ Y+     G+P+   TVPG
Sbjct: 90  AVLDPTTASLSLTIRMLFTAVNPNKVGIRYGESSFTVMYK-----GMPLGRATVPG 140



>gb:HSMUC5BEX_2018957 H.sapiens MUC5B gene (partial).
          Length = 3570

 Score = 32.3 bits (72), Expect = 8.1
 Identities = 28/85 (32%), Positives = 39/85 (45%)
 Frame = -2

Query: 433  TPYSLPTLQNSKTSISGLTQTLQ*APLST*SSTSRIQTVGTSSTRVPRPVLITEAYLWPE 254
            TP S+P   ++ T ++  TQ +    ++T SS++  QT GT       P LIT A     
Sbjct: 2522 TPSSIPGTTHTPTVLTTTTQPVATGSMATPSSST--QTSGTP------PSLITTATTITA 2573

Query: 253  SPSNTTPSRVEARLTSPLMLTLPAT 179
            + S T PS        P  LT  AT
Sbjct: 2574 TGSTTNPSSTPGTTPIPPELTTTAT 2598



>gb:AE012819_285908 Chlorobium tepidum TLS section 40 of 194 of the
           complete genome.>gb:AE006470_933076 Chlorobium tepidum
           TLS complete genome.
          Length = 649

 Score = 32.3 bits (72), Expect = 8.1
 Identities = 20/77 (25%), Positives = 32/77 (41%), Gaps = 2/77 (2%)
 Frame = -1

Query: 347 LIINVKNPNRGDFEYQGATASLDYRGISVAG--IPVEHDTVPGRGEINVTTYANVTGDKI 174
           L++N  NP  G    +G   +     +   G  +    +   G GE+ VT   N T + +
Sbjct: 21  LLLNAVNPRIGGVLVRGEKGTAKSTAVRALGALLAAARNGSGGEGEVVVTLPLNATEEMV 80

Query: 173 AGNPSFMEDMAAGSVMF 123
           AG   F + M  G  +F
Sbjct: 81  AGGIDFQQTMKEGRRVF 97



>pir|T45025|T45025 mucin MUC5B, tracheobronchial [imported] - human
            (fragment)
          Length = 3570

 Score = 32.3 bits (72), Expect = 8.1
 Identities = 28/85 (32%), Positives = 39/85 (45%)
 Frame = -2

Query: 433  TPYSLPTLQNSKTSISGLTQTLQ*APLST*SSTSRIQTVGTSSTRVPRPVLITEAYLWPE 254
            TP S+P   ++ T ++  TQ +    ++T SS++  QT GT       P LIT A     
Sbjct: 2522 TPSSIPGTTHTPTVLTTTTQPVATGSMATPSSST--QTSGTP------PSLITTATTITA 2573

Query: 253  SPSNTTPSRVEARLTSPLMLTLPAT 179
            + S T PS        P  LT  AT
Sbjct: 2574 TGSTTNPSSTPGTTPIPPELTTTAT 2598



>sp|Q9HC84|MU5B_HUMAN Mucin 5B precursor (Mucin 5 subtype B,
            tracheobronchial) (High molecular weight salivary mucin
            MG1) (Sublingual gland mucin).
          Length = 5703

 Score = 32.3 bits (72), Expect = 8.1
 Identities = 28/85 (32%), Positives = 39/85 (45%)
 Frame = -2

Query: 433  TPYSLPTLQNSKTSISGLTQTLQ*APLST*SSTSRIQTVGTSSTRVPRPVLITEAYLWPE 254
            TP S+P   ++ T ++  TQ +    ++T SS++  QT GT       P LIT A     
Sbjct: 3847 TPSSIPGTTHTPTVLTTTTQPVATGSMATPSSST--QTSGTP------PSLITTATTITA 3898

Query: 253  SPSNTTPSRVEARLTSPLMLTLPAT 179
            + S T PS        P  LT  AT
Sbjct: 3899 TGSTTNPSSTPGTTPIPPELTTTAT 3923


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 709,093,252
Number of Sequences: 1806583
Number of extensions: 14658804
Number of successful extensions: 39728
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 38186
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39657
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 39798953635
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)