BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12959
         (659 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|F86196|F86196 hypothetical protein [imported] - Arabidopsis ...   144   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AY099584_1576610 Arabidopsis thaliana glyoxalase II isozyme, ...   144   2e-43   
gb:AY085754_1570821 Arabidopsis thaliana clone 17756 mRNA, compl...   144   2e-43   
gb:CAR299063_1645236 Cicer arietinum partial mRNA for putative m...   143   7e-43   
pir|F84719|F84719 probable glyoxalase II [imported] - Arabidopsi...   140   7e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AF508863_1807019 Pennisetum glaucum glyoxalase II (GLXII) mRN...   141   1e-41   
gb:AY054407_1563114 Oryza sativa glyoxalase II (GLXII) mRNA, com...   141   1e-41   
gb:AY185202_1588031 Brassica juncea glyoxalase II (GLXII) mRNA, ...   141   1e-41   
gb:ATU90928_1557380 Arabidopsis thaliana glyoxalase II mitochond...   130   2e-36   
sp|O24495|GL2M_ARATH|GL2M_ARATH Hydroxyacylglutathione hydrolase, mitochond...   130   2e-36   Arabidopsis thaliana [mouse-ear cress]
pir|A84866|A84866 probable glyoxalase II [imported] - Arabidopsi...   130   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb:BX897699_828242 Bartonella henselae strain Houston-1, complet...    89   9e-25   
gb:CR378672_96240 Photobacterium profundum SS9; segment 10/12.         90   3e-24   
gb:BA000031_707755 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    92   3e-24   
gb:BA000012_668701 Mesorhizobium loti MAFF303099 DNA, complete g...    93   6e-23   
gb:CP000020_872114 Vibrio fischeri ES114 chromosome I, complete ...    89   2e-22   
pir|AD3268|AD3268 hydroxyacylglutathione hydrolase (EC 3.1.2.6) ...    84   3e-22   Brucella suis
gb:BX897700_829550 Bartonella quintana str. Toulouse, complete g...    82   3e-22   
gb:CP000031_87169 Silicibacter pomeroyi DSS-3, complete genome.        83   5e-22   
gb:SME591791_186682 Sinorhizobium meliloti 1021 complete chromos...    89   9e-22   
gb:AE012557_284618 Xylella fastidiosa Temecula1, section 5 of 9 ...    78   1e-21   
gb:AE017282_427172 Methylococcus capsulatus str. Bath, complete ...    86   2e-21   
gb:BX572594_800226 Rhodopseudomonas palustris CGA009 complete ge...    89   5e-21   
gb:CP000010_865142 Burkholderia mallei ATCC 23344 chromosome 1, ...    78   7e-21   
gb:BX571965_791130 Burkholderia pseudomallei strain K96243, chro...    78   7e-21   
pir|H82591|H82591 hydroxyacylglutathione hydrolase XF2160 [impor...    76   7e-21   Xylella fastidiosa
gb:AE016803_336538 Vibrio vulnificus CMCP6 chromosome I section ...    85   9e-21   
gb:BX640434_812071 Bordetella parapertussis strain 12822, comple...    80   1e-20   
gb:BX640420_807607 Bordetella pertussis strain Tohama I, complet...    80   1e-20   
sp|P96981|GLO2_RHOCA|GLO2_RHOCA Probable hydroxyacylglutathione hydrolase (...    84   3e-20   Rhodobacter capsulatus
gb:BX936398_837610 Yersinia pseudotuberculosis IP32953 genome, c...    78   5e-20   
gb:AP008231_579847 Synechococcus elongatus PCC 6301 DNA, complet...    79   5e-20   
sp|O24496|GL2C_ARATH|GL2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmi...    81   6e-20   Arabidopsis thaliana [mouse-ear cress]
gb:ATU90929_1557381 Arabidopsis thaliana glyoxalase II cytoplasm...    81   6e-20   
pir|A82102|A82102 probable hydroxyacylglutathione hydrolase GloB...    80   8e-20   Vibrio cholerae
gb:AF346500_503339 Photorhabdus luminescens strain W14 toxin com...    77   1e-19   
pir|D98282|D98282 hypothetical protein AGR_L_2423 [imported] - A...    91   1e-19   Agrobacterium fabrum str. C58
pir|AD3001|AD3001 glyoxalase II [imported] - Agrobacterium tumef...    91   1e-19   Agrobacterium fabrum str. C58
gb:AE013910_301389 Yersinia pestis KIM section 310 of 415 of the...    76   2e-19   
pir|AG0132|AG0132 probable hydroxyacylglutathione hydrolase (EC ...    76   2e-19   Yersinia pestis Nepal516
gb:BX571862_785799 Photorhabdus luminescens subsp. laumondii TTO...    79   2e-19   
gb:BX950851_842077 Erwinia carotovora subsp. atroseptica SCRI104...    76   2e-19   
gb:AE016869_353095 Pseudomonas syringae pv. tomato str. DC3000 s...    75   3e-19   
pir|AC1879|AC1879 hypothetical protein all0580 [imported] - Nost...    76   4e-19   Nostoc sp. PCC 7120
gb:AL646065_546443 Ralstonia solanacearum GMI1000 chromosome, co...    75   6e-19   
gb:AE015698_316932 Shewanella oneidensis MR-1 section 247 of 457...    75   8e-19   
gb:AE008692_240497 Zymomonas mobilis subsp. mobilis ZM4, complet...    78   8e-19   
pir|F87313|F87313 hydroxyacylglutathione hydrolase, probable [im...    76   1e-18   Caulobacter vibrioides
gb:AY398356_2531886 Danio rerio clone RK068A3B01 hydroxyacyl glu...    77   1e-18   
sp|Q99KB8|GLO2_MOUSE|GLO2_MOUSE Hydroxyacylglutathione hydrolase (EC 3.1.2....    78   2e-18   Mus musculus [mouse]
sp|P72933|GLO2_SYNY3|GLO2_SYNY3 Probable hydroxyacylglutathione hydrolase (...    75   2e-18   Synechocystis sp.
gb:AE012196_280243 Xanthomonas campestris pv. campestris str. AT...    72   2e-18   
gb:AE017340_457452 Idiomarina loihiensis L2TR, complete genome.        74   4e-18   
gb:AY223455_1176914 Schistosoma japonicum clone ZZZ476 mRNA sequ...    78   5e-18   
sp|Q16775|GLO2_HUMAN|GLO2_HUMAN Hydroxyacylglutathione hydrolase (EC 3.1.2....    77   5e-18   Homo sapiens [man]
gb:BA000040_728482 Bradyrhizobium japonicum USDA 110 DNA, comple...    80   5e-18   
gb:AE011738_276033 Xanthomonas axonopodis pv. citri str. 306, se...    72   7e-18   
sp|O35952|GLO2_RAT|GLO2_RAT Hydroxyacylglutathione hydrolase (EC 3.1.2.6)...    75   1e-17   Rattus norvegicus [brown rat]
gb:AE016789_333540 Pseudomonas putida KT2440 section 16 of 21 of...    72   1e-17   
gb:AE016755_324308 Escherichia coli CFT073 section 1 of 18 of th...    69   1e-17   
gb:AJ720961_2503148 Gallus gallus mRNA for hypothetical protein,...    72   2e-17   
gb:BX321856_772466 Nitrosomonas europaea ATCC 19718, complete ge...    74   2e-17   
gb:AE008707_241990 Salmonella typhimurium LT2, section 15 of 220...    69   2e-17   
gb:CP000026_77266 Salmonella enterica subsp. enterica serovar Pa...    69   2e-17   
gb:AE016914_356215 Chromobacterium violaceum ATCC 12472 section ...    64   4e-17   
sp|Q47677|GLO2_ECOLI|GLO2_ECOLI Probable hydroxyacylglutathione hydrolase (...    69   7e-17   Escherichia coli [E. coli]
gb:AJ719602_2501789 Gallus gallus mRNA for hypothetical protein,...    78   9e-17   
pir|G83417|G83417 probable hydroxyacylglutathione hydrolase PA18...    70   9e-17   Pseudomonas aeruginosa
gb:AE014296_1137245 Drosophila melanogaster chromosome 3L, compl...    71   1e-16   
gb:AE014296_1137246 Drosophila melanogaster chromosome 3L, compl...    71   1e-16   
gb:AE014296_1137247 Drosophila melanogaster chromosome 3L, compl...    71   1e-16   
gb:AE005674_69780 Shigella flexneri 2a str. 301, complete genome...    70   1e-16   
gb:AE013598_294740 Xanthomonas oryzae pv. oryzae KACC10331, comp...    68   1e-16   
gb:PFMAL4P1_1394706 Plasmodium falciparum MAL4P1.                      75   2e-16   
gb:AY494055_1330611 Plasmodium falciparum 3D7 glyoxalase IIB (gl...    75   2e-16   
gb:BA000045_743414 Gloeobacter violaceus PCC 7421 DNA, complete ...    74   2e-16   
sp|Q28333|GLO2_CALJA|GLO2_CALJA Hydroxyacylglutathione hydrolase (EC 3.1.2....    71   2e-16   Callithrix jacchus [common marmoset]
gb:AE016960_367561 Coxiella burnetii strain RSA 493, section 1 o...    67   2e-16   
gb:CR555306_109101 Azoarcus sp. EbN1 complete genome.                  72   3e-16   
pir|AC0534|AC0534 probable hydroxyacylglutathione hydrolase (EC ...    65   3e-16   Salmonella enterica subsp. enterica serovar Typhi
gb:CR543861_104320 Acinetobacter sp. ADP1 complete genome.             70   6e-16   
sp|Q26547|GLO2_SCHMA|GLO2_SCHMA Probable hydroxyacylglutathione hydrolase (...    70   8e-16   Schistosoma mansoni
sp|P05446|GLO2_RHOBL|GLO2_RHOBL Probable hydroxyacylglutathione hydrolase (...    65   1e-15   Rhodobacter blasticus
gb:BX248584_763839 Blochmannia floridanus complete genome; segme...    77   3e-15   
gb:BA000039_727423 Thermosynechococcus elongatus BP-1 DNA, compl...    65   4e-15   
gb:CR628336_111373 Legionella pneumophila str. Paris complete ge...    67   3e-14   
pir|T26496|T26496 hypothetical protein Y17G7B.3 - Caenorhabditis...    65   6e-14   Caenorhabditis elegans [roundworm]
gb:AE017354_459664 Legionella pneumophila subsp. pneumophila str...    66   6e-14   
gb:CR628337_114460 Legionella pneumophila str. Lens complete gen...    66   6e-14   
gb:BA000021_686813 Wigglesworthia glossinidia endosymbiont of Gl...    62   2e-13   
gb:CP000009_862307 Gluconobacter oxydans 621H, complete genome.        61   9e-13   
gb:AX394700_1466917 Sequence 1 from Patent WO0218559.>gb:AX39470...    70   1e-12   
gb:AE017162_395018 Prochlorococcus marinus subsp. marinus str. C...    53   2e-12   
sp|Q08889|GLO2_BUCAP|GLO2_BUCAP Probable hydroxyacylglutathione hydrolase (...    68   4e-12   
gb:AE014188_967867 Plasmodium falciparum 3D7 chromosome 12, comp...    73   5e-12   
gb:BX572091_796185 Prochlorococcus marinus MED4 complete genome;...    55   7e-12   
sp|P57336|GLO2_BUCAI|GLO2_BUCAI Probable hydroxyacylglutathione hydrolase (...    64   9e-12   
gb:AE017344_1756207 Cryptococcus neoformans var. neoformans JEC2...    51   1e-11   
gb:BX572098_798536 Prochlorococcus marinus MIT9313 complete geno...    54   3e-11   
pir|H81017|H81017 hydroxyacylglutathione hydrolase NMB1997 [impo...    57   3e-11   Neisseria meningitidis serogroup B
gb:AK047517_1168126 Mus musculus 10 days neonate cerebellum cDNA...    67   3e-11   
gb:AK005274_1152919 Mus musculus adult male cerebellum cDNA, RIK...    65   7e-11   
pir|F81961|F81961 probable hydroxyacylglutathione hydrolase (EC ...    55   1e-10   Neisseria meningitidis serogroup A
gb:AE017154_392649 Haemophilus ducreyi strain 35000HP section 4 ...    62   1e-10   
gb:BX569693_776445 Synechococcus sp. WH8102 complete genome; seg...    49   3e-10   
gb:BX842652_825068 Bdellovibrio bacteriovorus complete genome, s...    53   3e-10   
gb:AE004969_60876 Neisseria gonorrhoeae FA 1090, complete genome.      54   4e-10   
sp|Q89AN4|GLO2_BUCBP|GLO2_BUCBP Probable hydroxyacylglutathione hydrolase (...    59   3e-09   
gb:AE016827_342575 Mannheimia succiniciproducens MBEL55E, comple...    52   3e-09   
gb:AE006464_1875633 Homo sapiens 16p13.3 sequence section 3 of 8.      59   3e-09   
gb:BA000037_720979 Vibrio vulnificus YJ016 DNA, chromosome I, co...    55   1e-07   
gb:AE006105_215573 Pasteurella multocida subsp. multocida str. P...    58   2e-07   
gb:CR382134_1667038 Debaryomyces hansenii chromosome B of strain...    45   3e-07   
gb:BC058945_2103525 Mus musculus brain protein 17, mRNA (cDNA cl...    55   1e-06   
gb:AK173125_2070059 Mus musculus mRNA for mKIAA1184 protein.           55   1e-06   
gb:AB041609_2045478 Mus musculus brain cDNA, clone MNCb-5687, si...    55   1e-06   
gb:AK041238_1165918 Mus musculus adult male aorta and vein cDNA,...    55   1e-06   
sp|P71374|GLO2_HAEIN|GLO2_HAEIN Probable hydroxyacylglutathione hydrolase (...    47   2e-06   Haemophilus influenzae
gb:AF402098_507621 Azotobacter vinelandii hydroxyacylglutathione...    54   3e-06   
gb:BC036457_1981938 Homo sapiens myofibrillogenesis regulator 1,...    53   4e-06   
gb:AY358753_1947632 Homo sapiens clone DNA96894 AWQG2491 (UNQ249...    53   4e-06   
gb:AB033010_1866190 Homo sapiens mRNA for KIAA1184 protein, part...    53   4e-06   
gb:CR857281_1181525 Pongo pygmaeus mRNA; cDNA DKFZp469H1021 (fro...    53   4e-06   
gb:HSM802017_1186583 Homo sapiens mRNA; cDNA DKFZp434O1772 (from...    52   9e-06   
gb:NC93G11_1688804 Neurospora crassa DNA linkage group V Cosmid ...    42   9e-06   
gb:AC104496_1192350 Trypanosoma cruzi strain CL Brener chromosom...    42   2e-05   
gb:TBR492819_1399336 Trypanosoma brucei brucei glxII gene for gl...    41   4e-05   
gb:BC033796_1981065 Homo sapiens hydroxyacylglutathione hydrolas...    43   1e-04   
gb:CR382130_1662589 Yarrowia lipolytica chromosome D of strain C...    46   6e-04   
pir|T40964|T40964 probable hydroxyacylglutathione hydrolase - fi...    46   6e-04   Schizosaccharomyces pombe
gb:AJ749949_531862 Francisella tularensis subsp. tularensis comp...    44   0.003   
gb:AE011383_272353 Leptospira interrogans serovar lai str. 56601...    41   0.021   
pir|T39108|T39108 probable hydroxyacylglutathione hydrolase - fi...    39   0.079   Schizosaccharomyces pombe
gb:CR380955_1651557 Candida glabrata strain CBS138 chromosome I ...    39   0.10    
sp|P70030|PO3B_XENLA|PO3B_XENLA Transcription factor POU3B (XLPOU3B).>gb:BC...    38   0.18    Xenopus laevis [clawed frog]
gb:AF091043_2472705 Coturnix coturnix japonica POU-box protein b...    37   0.23    
gb:AB001869_2460207 Anolis carolinensis Brain-2 gene, complete cds.    37   0.23    
gb:AB001868_2460206 Anolis carolinensis Brain-1 gene, complete cds.    37   0.23    
gb:HS273N12_1997839 Human DNA sequence from clone RP1-273N12 on ...    37   0.23    
gb:BC051699_1984626 Homo sapiens POU domain, class 3, transcript...    37   0.23    
gb:AY650385_1958332 Macaca fascicularis pou domain class 3 trans...    37   0.23    
pir|S29334|S29334 transcription factor Brn-2 [validated] - human...    37   0.23    Homo sapiens [man]
pir|A49447|A49447 transcription factor Brn-2 - rat                     37   0.23    Rattus norvegicus [brown rat]
sp|P79746|ZP47_BRARE|ZP47_BRARE POU domain protein ZP-47.>gb:BC067373_25547...    37   0.23    Danio rerio [leopard danio]
sp|P31360|PO32_MOUSE|PO32_MOUSE POU domain, class 3, transcription factor 2...    37   0.23    Mus musculus [mouse]
sp|P20265|PO32_HUMAN|PO32_HUMAN POU domain, class 3, transcription factor 2...    37   0.23    Homo sapiens [man]
gb:AE016816_1746774 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.30    
gb:CNS07EG9_1372814 chromosome II of strain GB-M1 of Encephalito...    37   0.30    
sp|P56222|PO32_RAT|PO32_RAT POU domain, class 3, transcription factor 2 (...    37   0.30    Rattus norvegicus [brown rat]
gb:BC041298_2547925 Xenopus laevis similar to POU domain, class ...    37   0.39    
gb:AY078995_1296501 Branchiostoma floridae transcription factor ...    37   0.39    
sp|P31365|PO3A_XENLA|PO3A_XENLA Transcription factor POU3A (XLPOU3).>pir|S2...    37   0.39    Xenopus laevis [clawed frog]
gb:DRU77736_2571383 Danio rerio class III POU domain protein (ta...    36   0.51    
gb:BC070001_2555480 Danio rerio POU domain gene 12, mRNA (cDNA c...    36   0.51    
gb:BC065961_2554215 Danio rerio POU domain gene 12, mRNA (cDNA c...    36   0.51    
gb:BC058318_2552289 Danio rerio POU domain gene 12, mRNA (cDNA c...    36   0.51    
gb:BC056549_2551822 Danio rerio POU domain gene 23, mRNA (cDNA c...    36   0.51    
gb:BC056320_2551760 Danio rerio POU domain gene 23, mRNA (cDNA c...    36   0.51    
gb:BC044354_2548664 Danio rerio POU domain gene 12, mRNA (cDNA c...    36   0.51    
gb:AF039952_2470029 Danio rerio type III POU domain protein (zp-...    36   0.51    
gb:AF469664_2066685 Mesocricetus auratus POU homeodomain protein...    36   0.51    
gb:HS326L13_1998059 Human DNA sequence from clone RP3-326L13 on ...    36   0.51    
gb:AF273264_1257682 Steatoda triangulosa VvlB protein (cf1a) mRN...    36   0.51    
pir|A44144|A44144 transcription factor Brn-4 - rat (fragment)          36   0.51    Rattus norvegicus [brown rat]
pir|A55557|A55557 transcription factor Brn-4 - human                   36   0.51    Homo sapiens [man]
sp|P79745|ZP23_BRARE|ZP23_BRARE POU domain protein ZP-23.>gb:DRZP23POU_2571...    36   0.51    Danio rerio [leopard danio]
sp|P56224|ZP12_BRARE|ZP12_BRARE POU domain protein ZP-12 (Class III POU dom...    36   0.51    Danio rerio [leopard danio]
sp|P31366|POU1_BRARE|POU1_BRARE POU domain protein 1 (ZFPOU1).>pir|JH0710|J...    36   0.51    Danio rerio [leopard danio]
sp|P25216|PO34_MOUSE|PO34_MOUSE POU domain, class 3, transcription factor 4...    36   0.51    Mus musculus [mouse]
sp|P49335|PO34_HUMAN|PO34_HUMAN POU domain, class 3, transcription factor 4...    36   0.51    Homo sapiens [man]
sp|Q63262|PO33_RAT|PO33_RAT POU domain, class 3, transcription factor 3 (...    36   0.51    Rattus norvegicus [brown rat]
sp|Q29087|PO33_PIG|PO33_PIG POU domain, class 3, transcription factor 3 (...    36   0.51    Sus scrofa [pigs]
sp|P31361|PO33_MOUSE|PO33_MOUSE POU domain, class 3, transcription factor 3...    36   0.51    Mus musculus [mouse]
sp|P20264|PO33_HUMAN|PO33_HUMAN POU domain, class 3, transcription factor 3...    36   0.51    Homo sapiens [man]
sp|Q90436|PO33_BRARE|PO33_BRARE Brain-specific homeobox/POU domain protein ...    36   0.51    Danio rerio [leopard danio]
gb:BC043847_2548301 Xenopus laevis similar to POU domain gene, m...    36   0.67    
gb:AF276075_2483851 Ambystoma mexicanum POU domain transcription...    36   0.67    
gb:AF064608_2471402 Gallus gallus POU class III transcription fa...    36   0.67    
gb:AY557739_1613966 Saccharomyces cerevisiae clone FLH002078.01X...    36   0.67    
gb:DMCF1A_1378541 Drosophila melanogaster Cf1a gene for DNA-bind...    36   0.67    
gb:BT003517_1356919 Drosophila melanogaster RE27192 full insert ...    36   0.67    
gb:AY513764_1332265 Helicoverpa armigera POU-domain transcriptio...    36   0.67    
gb:AY334012_1320414 Bombyx mori POU-M2 (POU-M2) mRNA, complete cds.    36   0.67    
pir|S05042|S05042 transcription factor Brn-1, brain - human (fra...    36   0.67    Homo sapiens [man]
pir|S19095|S19095 transcription factor Cf1a - fruit fly (Drosoph...    36   0.67    Drosophila melanogaster
pir|S23248|S23248 transcription factor POU1 - African clawed fro...    36   0.67    Xenopus laevis [clawed frog]
sp|Q17237|SGF3_BOMMO|SGF3_BOMMO Silk gland factor 3 (SGF-3) (POU domain pro...    36   0.67    Bombyx mori [silk moth]
sp|P31363|POU1_XENLA|POU1_XENLA Transcription factor POU1 (XLPOU1) (Homeoti...    36   0.67    Xenopus laevis [clawed frog]
sp|Q05584|GLO2_YEAST|GLO2_YEAST Hydroxyacylglutathione hydrolase, cytoplasm...    36   0.67    Saccharomyces cerevisiae [brewer's yeast]
sp|P16241|CF1A_DROME|CF1A_DROME POU-domain protein CF1A (Chorion factor 1A)...    36   0.67    Drosophila melanogaster
gb:BC076747_2559492 Xenopus laevis POU 2 transcription factor, m...    35   0.87    
gb:BC067685_2554856 Danio rerio cDNA clone IMAGE:6972273, partia...    35   0.87    
gb:AB001870_2460208 Anolis carolinensis Brain-4 gene, complete cds.    35   0.87    
gb:AF273265_1257683 Steatoda triangulosa VvlC protein (cf1a) mRN...    35   0.87    
pir|S23249|S23249 transcription factor POU2 - African clawed fro...    35   0.87    Xenopus laevis [clawed frog]
sp|P31364|POU2_XENLA|POU2_XENLA Transcription factor POU2 (XLPOU2).>gb:XLPO...    35   0.87    Xenopus laevis [clawed frog]
gb:BC075142_2558255 Xenopus laevis MGC81954 protein, mRNA (cDNA ...    35   1.1     
gb:RATTST1POU_2134177 Rat POU domain protein (Tst-1) mRNA, 3' end.     35   1.5     
gb:MMOCT6R_2116814 M.musculus Oct-6 mRNA for octamer binding pro...    35   1.5     
gb:HSOCT6TR_2019258 Homo sapiens Oct-6 transcription factor.           35   1.5     
gb:AL139158_1920366 Human DNA sequence from clone RP5-884C9 on c...    35   1.5     
pir|A40168|A40168 transcription factor Oct-6 - rat>gb:RATSCIP_21...    35   1.5     Rattus norvegicus [brown rat]
sp|P20267|PO31_RAT|PO31_RAT POU domain, class 3, transcription factor 1 (...    35   1.5     Rattus norvegicus [brown rat]
sp|P21952|PO31_MOUSE|PO31_MOUSE POU domain, class 3, transcription factor 1...    35   1.5     Mus musculus [mouse]
sp|Q03052|PO31_HUMAN|PO31_HUMAN POU domain, class 3, transcription factor 1...    35   1.5     Homo sapiens [man]
gb:AF273266_1257684 Porcellio scaber Vvl protein (cf1a) mRNA, pa...    34   1.9     
gb:AF273260_1257678 Procambarus clarkii Vvl protein (cf1a) mRNA,...    34   1.9     
gb:CR382126_1659065 Kluyveromyces lactis strain NRRL Y-1140 chro...    34   2.5     
gb:AF231942_1253214 Haliotis asinina class III POU protein mRNA,...    33   3.3     
gb:S81257_2041984 OCT6=transcriptional regulator [human, tripron...    33   4.3     
gb:AY071583_1295667 Drosophila melanogaster RE63964 full length ...    33   4.3     
sp|Q9VXY0|C4S3_DROME|C4S3_DROME Probable cytochrome P450 4s3 (EC 1.14.-.-) ...    33   4.3     Drosophila melanogaster
gb:CSA420131_1375693 Cupiennius salei partial mRNA for nubbin (p...    32   7.4     
gb:RATRHS1POU_2133716 Sprague-Dawley class III POU protein POU-d...    32   9.6     
gb:AE016818_1748421 Ashbya gossypii (= Eremothecium gossypii) AT...    32   9.6     
gb:AF297550_1259962 Sacculina carcini class III POU protein (Pou...    32   9.6     
gb:AF273259_1257677 Porcellio scaber Pdm protein mRNA, partial cds.    32   9.6     
pir|S12181|S12181 transcription factor nrl-20 - African clawed f...    32   9.6     Xenopus laevis [clawed frog]
sp|P20914|HM20_XENLA|HM20_XENLA Homeotic protein NRL-20 (Fragment).>gb:XLNR...    32   9.6     Xenopus laevis [clawed frog]


>pir|F86196|F86196 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889630 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T21E18_1723763 Sequence of BAC T21E18 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 512

 Score =  144 bits (364), Expect(2) = 2e-43
 Identities = 68/100 (68%), Positives = 85/100 (85%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           RI+ LP+DT++YCGHEYTLSNSKFALSIEP N+ LQSYAA +  LR K LPTIPTT++ E
Sbjct: 411 RIIALPDDTSVYCGHEYTLSNSKFALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKME 470

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+RT + +IR++L IP++AD+AEAL  IR+AKDNF
Sbjct: 471 KACNPFLRTENTDIRRALGIPETADEAEALGIIRRAKDNF 510



 Score = 53.9 bits (128), Expect(2) = 2e-43
 Identities = 24/27 (88%), Positives = 27/27 (100%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLFSLSCGKLFEGTP+QMLASL++
Sbjct: 385 TGDTLFSLSCGKLFEGTPEQMLASLQR 411



>gb:AY099584_1576610 Arabidopsis thaliana glyoxalase II isozyme,
           putative (At1g06130) mRNA, complete
           cds.>gb:AY128833_1580913 Arabidopsis thaliana glyoxalase
           II isozyme, putative (At1g06130) mRNA, complete cds.
          Length = 330

 Score =  144 bits (364), Expect(2) = 2e-43
 Identities = 68/100 (68%), Positives = 85/100 (85%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           RI+ LP+DT++YCGHEYTLSNSKFALSIEP N+ LQSYAA +  LR K LPTIPTT++ E
Sbjct: 229 RIIALPDDTSVYCGHEYTLSNSKFALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKME 288

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+RT + +IR++L IP++AD+AEAL  IR+AKDNF
Sbjct: 289 KACNPFLRTENTDIRRALGIPETADEAEALGIIRRAKDNF 328



 Score = 53.9 bits (128), Expect(2) = 2e-43
 Identities = 24/27 (88%), Positives = 27/27 (100%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLFSLSCGKLFEGTP+QMLASL++
Sbjct: 203 TGDTLFSLSCGKLFEGTPEQMLASLQR 229



>gb:AY085754_1570821 Arabidopsis thaliana clone 17756 mRNA, complete
           sequence.
          Length = 331

 Score =  144 bits (364), Expect(2) = 2e-43
 Identities = 68/100 (68%), Positives = 85/100 (85%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           RI+ LP+DT++YCGHEYTLSNSKFALSIEP N+ LQSYAA +  LR K LPTIPTT++ E
Sbjct: 230 RIIALPDDTSVYCGHEYTLSNSKFALSIEPTNEVLQSYAAYVAELRDKKLPTIPTTMKME 289

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+RT + +IR++L IP++AD+AEAL  IR+AKDNF
Sbjct: 290 KACNPFLRTENTDIRRALGIPETADEAEALGIIRRAKDNF 329



 Score = 53.9 bits (128), Expect(2) = 2e-43
 Identities = 24/27 (88%), Positives = 27/27 (100%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLFSLSCGKLFEGTP+QMLASL++
Sbjct: 204 TGDTLFSLSCGKLFEGTPEQMLASLQR 230



>gb:CAR299063_1645236 Cicer arietinum partial mRNA for putative
           mitochondrial glyoxalase II (ORF1), clone CanGLXII.
          Length = 271

 Score =  143 bits (361), Expect(2) = 7e-43
 Identities = 67/100 (67%), Positives = 84/100 (84%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +IM L +DT+IYCGHEYTL+NSKFALSIEP N+ELQSYA+ + +LR KGLPT+PTTL+ E
Sbjct: 172 KIMSLADDTSIYCGHEYTLNNSKFALSIEPENKELQSYASHVAHLRNKGLPTVPTTLKME 231

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+RT+S EIR+ L +  +A+DAEAL  IRQA+D F
Sbjct: 232 KACNPFLRTWSTEIRQKLKVAATAEDAEALSVIRQAEDTF 271



 Score = 53.1 bits (126), Expect(2) = 7e-43
 Identities = 23/27 (85%), Positives = 27/27 (100%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLFSLSCGKL+EGTP+QML+SL+K
Sbjct: 146 TGDTLFSLSCGKLYEGTPEQMLSSLKK 172



>pir|F84719|F84719 probable glyoxalase II [imported] - Arabidopsis
           thaliana>gb:AC007169_1535452 Arabidopsis thaliana
           chromosome 2 clone T28P16 map nga361, complete
           sequence.>gb:AY072200_1567088 Arabidopsis thaliana
           putative glyoxalase II (At2g31350) mRNA, complete
           cds.>gb:AY096672_1576208 Arabidopsis thaliana putative
           glyoxalase II (At2g31350) mRNA, complete cds.
          Length = 324

 Score =  140 bits (352), Expect(2) = 7e-42
 Identities = 65/100 (65%), Positives = 84/100 (84%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP+DT+IYCGHEYTLSNSKFALS+EP N+ LQSYAA +  LR K LPTIPTT++ E
Sbjct: 225 KITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKME 284

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+R+ + +IR++L IP++AD+AEAL  IR+AKD+F
Sbjct: 285 KACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF 324



 Score = 53.1 bits (126), Expect(2) = 7e-42
 Identities = 24/27 (88%), Positives = 26/27 (96%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDT+FSLSCGKLFEGTP QMLASL+K
Sbjct: 199 TGDTMFSLSCGKLFEGTPKQMLASLQK 225



>gb:AF508863_1807019 Pennisetum glaucum glyoxalase II (GLXII) mRNA,
           complete cds.
          Length = 336

 Score =  141 bits (355), Expect(2) = 1e-41
 Identities = 63/100 (63%), Positives = 82/100 (82%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I+ LP++T +YCGHEYTLSNSKFALSIEPGN++LQ YAA   +LRK+  PT+PTT+ +E
Sbjct: 237 KIIALPDETRVYCGHEYTLSNSKFALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGRE 296

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+RT S EI+ +L+IPD  DDA  L+ +R+AKDNF
Sbjct: 297 KQCNPFLRTSSPEIKNTLSIPDHFDDARVLEVVRRAKDNF 336



 Score = 51.2 bits (121), Expect(2) = 1e-41
 Identities = 23/27 (85%), Positives = 25/27 (92%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLFSLSCGKLFEGTP QM +SL+K
Sbjct: 211 TGDTLFSLSCGKLFEGTPQQMYSSLQK 237



>gb:AY054407_1563114 Oryza sativa glyoxalase II (GLXII) mRNA,
           complete cds.>gb:AP005735_1856858 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OSJNBb0034B12.
          Length = 336

 Score =  141 bits (355), Expect(2) = 1e-41
 Identities = 63/100 (63%), Positives = 82/100 (82%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I+ LP++T +YCGHEYTLSNSKFALSIEPGN++LQ YAA   +LRK+  PT+PTT+ +E
Sbjct: 237 KIIALPDETRVYCGHEYTLSNSKFALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGRE 296

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+RT S EI+ +L+IPD  DDA  L+ +R+AKDNF
Sbjct: 297 KQCNPFLRTSSPEIKNTLSIPDHFDDARVLEVVRRAKDNF 336



 Score = 51.2 bits (121), Expect(2) = 1e-41
 Identities = 23/27 (85%), Positives = 25/27 (92%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLFSLSCGKLFEGTP QM +SL+K
Sbjct: 211 TGDTLFSLSCGKLFEGTPQQMYSSLQK 237



>gb:AY185202_1588031 Brassica juncea glyoxalase II (GLXII) mRNA,
           complete cds.
          Length = 335

 Score =  141 bits (355), Expect(2) = 1e-41
 Identities = 63/100 (63%), Positives = 82/100 (82%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I+ LP++T +YCGHEYTLSNSKFALSIEPGN++LQ YAA   +LRK+  PT+PTT+ +E
Sbjct: 236 KIIALPDETRVYCGHEYTLSNSKFALSIEPGNKDLQEYAANAADLRKRNTPTVPTTIGRE 295

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+RT S EI+ +L+IPD  DDA  L+ +R+AKDNF
Sbjct: 296 KQCNPFLRTSSPEIKNTLSIPDHFDDARVLEVVRRAKDNF 335



 Score = 51.2 bits (121), Expect(2) = 1e-41
 Identities = 23/27 (85%), Positives = 25/27 (92%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLFSLSCGKLFEGTP QM +SL+K
Sbjct: 210 TGDTLFSLSCGKLFEGTPQQMYSSLQK 236



>gb:ATU90928_1557380 Arabidopsis thaliana glyoxalase II
           mitochondrial isozyme (Glx2-1) mRNA, nuclear gene
           encoding mitochondrial protein, complete cds.
          Length = 331

 Score =  130 bits (328), Expect(2) = 2e-36
 Identities = 61/100 (61%), Positives = 81/100 (81%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I+ LP+DTNIYCG E T  N KFALS+EP N+ LQSYA ++ +LR +GLP+IPTT++ E
Sbjct: 232 KIVSLPDDTNIYCGRENTAGNLKFALSVEPKNETLQSYATRVAHLRSQGLPSIPTTVKVE 291

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+R  S +IRKSL+IPDSA +AEAL+ I++A+D F
Sbjct: 292 KACNPFLRISSKDIRKSLSIPDSATEAEALRRIQRARDRF 331



 Score = 44.3 bits (103), Expect(2) = 2e-36
 Identities = 19/27 (70%), Positives = 24/27 (88%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGD ++SLSCG L EGTP+QML+SL+K
Sbjct: 206 TGDLIYSLSCGTLSEGTPEQMLSSLQK 232



>sp|O24495|GL2M_ARATH Hydroxyacylglutathione hydrolase,
           mitochondrial precursor (EC 3.1.2.6) (Glyoxalase II)
           (Glx II).>gb:AC002335_1530409 Arabidopsis thaliana
           chromosome 2 clone T1O24 map CIC10F02, complete
           sequence.>gb:ATU90927_1557379 Arabidopsis thaliana
           glyoxalase II isozyme (Glx2-1) gene, nuclear gene
           encoding mitochondrial protein, complete
           cds.>gb:AY063806_1565760 Arabidopsis thaliana putative
           glyoxalase II (At2g43430) mRNA, complete
           cds.>gb:AY091278_1574484 Arabidopsis thaliana putative
           glyoxalase II (At2g43430) mRNA, complete cds.
          Length = 331

 Score =  130 bits (328), Expect(2) = 2e-36
 Identities = 61/100 (61%), Positives = 81/100 (81%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I+ LP+DTNIYCG E T  N KFALS+EP N+ LQSYA ++ +LR +GLP+IPTT++ E
Sbjct: 232 KIVSLPDDTNIYCGRENTAGNLKFALSVEPKNETLQSYATRVAHLRSQGLPSIPTTVKVE 291

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+R  S +IRKSL+IPDSA +AEAL+ I++A+D F
Sbjct: 292 KACNPFLRISSKDIRKSLSIPDSATEAEALRRIQRARDRF 331



 Score = 44.3 bits (103), Expect(2) = 2e-36
 Identities = 19/27 (70%), Positives = 24/27 (88%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGD ++SLSCG L EGTP+QML+SL+K
Sbjct: 206 TGDLIYSLSCGTLSEGTPEQMLSSLQK 232



>pir|A84866|A84866 probable glyoxalase II [imported] - Arabidopsis
           thaliana
          Length = 252

 Score =  130 bits (328), Expect(2) = 2e-36
 Identities = 61/100 (61%), Positives = 81/100 (81%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I+ LP+DTNIYCG E T  N KFALS+EP N+ LQSYA ++ +LR +GLP+IPTT++ E
Sbjct: 153 KIVSLPDDTNIYCGRENTAGNLKFALSVEPKNETLQSYATRVAHLRSQGLPSIPTTVKVE 212

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K CNPF+R  S +IRKSL+IPDSA +AEAL+ I++A+D F
Sbjct: 213 KACNPFLRISSKDIRKSLSIPDSATEAEALRRIQRARDRF 252



 Score = 44.3 bits (103), Expect(2) = 2e-36
 Identities = 19/27 (70%), Positives = 24/27 (88%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGD ++SLSCG L EGTP+QML+SL+K
Sbjct: 127 TGDLIYSLSCGTLSEGTPEQMLSSLQK 153



>gb:BX897699_828242 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 253

 Score = 89.0 bits (219), Expect(2) = 9e-25
 Identities = 45/100 (45%), Positives = 65/100 (65%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP++T +YCGHEYT SN+ FAL+++P NQ+LQ  A  +  LR K   T+P TL +E
Sbjct: 155 KLRQLPDETLLYCGHEYTKSNALFALTLDPYNQKLQQRAEDVFLLRAKNAMTLPVTLGQE 214

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R  +  +RK+L +    D+ E    IR+ KDNF
Sbjct: 215 KKNNPFLRWDNRTLRKTLRMEKETDE-EVFAEIRKRKDNF 253



 Score = 47.0 bits (110), Expect(2) = 9e-25
 Identities = 21/26 (80%), Positives = 23/26 (88%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFSL CG+LFEGTP QML SL+K
Sbjct: 130 GDTLFSLGCGRLFEGTPAQMLNSLKK 155



>gb:CR378672_96240 Photobacterium profundum SS9; segment 10/12.
          Length = 264

 Score = 89.7 bits (221), Expect(2) = 3e-24
 Identities = 47/103 (45%), Positives = 63/103 (61%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP++T IYC HEYT SN  FAL  E  N  LQ Y   ++ +R +G+ TIP+TL +E
Sbjct: 164 KLAALPDETEIYCAHEYTSSNLAFALVAEQDNPHLQRYREDVSRMRAQGISTIPSTLRQE 223

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSA---DDAEALKAIRQAKDNF 281
           KL NPF+R     I+KS  + D A    D E   A+R+ KDNF
Sbjct: 224 KLVNPFLRCEQPSIKKS--VADKAFDDSDLETFAALRRWKDNF 264



 Score = 44.7 bits (104), Expect(2) = 3e-24
 Identities = 19/26 (73%), Positives = 22/26 (84%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS+ CG+LFEGTP QM  SL+K
Sbjct: 139 GDTLFSVGCGRLFEGTPAQMFQSLKK 164



>gb:BA000031_707755 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 252

 Score = 92.4 bits (228), Expect(2) = 3e-24
 Identities = 43/101 (42%), Positives = 65/101 (64%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP +T ++C HEYT SN  FAL++EP N++L+ Y   +  LR   +PT+PTTL KE
Sbjct: 152 KIAALPEETQVFCAHEYTASNVAFALAVEPDNEQLRQYRDDVNRLRALNIPTLPTTLRKE 211

Query: 400 KLCNPFVRTFSMEIRKSL-NIPDSADDAEALKAIRQAKDNF 281
           K  NPF+RT + ++ KS+ N   ++D      A+R+ K+ F
Sbjct: 212 KWINPFLRTTNPDVVKSVANRIKNSDPCSVFTALREWKNEF 252



 Score = 41.6 bits (96), Expect(2) = 3e-24
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFS  CG++FEGTP+QM  SL K
Sbjct: 127 GDVLFSAGCGRIFEGTPEQMFESLSK 152



>gb:BA000012_668701 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 255

 Score = 92.8 bits (229), Expect(2) = 6e-23
 Identities = 47/100 (47%), Positives = 64/100 (64%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP  T IYCGHEYTL+N++FAL+++P N  L+  A +I  LR    PT+PTT+ +E
Sbjct: 157 KLAALPAATTIYCGHEYTLANARFALTVDPTNSALKERATRIEALRVDNKPTLPTTIGEE 216

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
              NPF+R     IRK L + + A DAE    IR+ KDNF
Sbjct: 217 LSTNPFLRWHDPAIRKHLGM-EKAGDAEVFAEIRKRKDNF 255



 Score = 37.0 bits (84), Expect(2) = 6e-23
 Identities = 17/27 (62%), Positives = 19/27 (70%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           T DTLF+L CG+LFE  P  M  SLRK
Sbjct: 131 TADTLFALGCGRLFECKPPVMYESLRK 157



>gb:CP000020_872114 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 252

 Score = 88.6 bits (218), Expect(2) = 2e-22
 Identities = 44/102 (43%), Positives = 64/102 (62%), Gaps = 2/102 (1%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+ T +YC HEY  SN  FAL++EP N  L  Y  ++ +LR  G  TIP+TL++E
Sbjct: 152 KMAALPDXTEVYCAHEYAASNLAFALAVEPDNDYLLRYREKVLHLRAHGKSTIPSTLQRE 211

Query: 400 KLCNPFVRTFSMEIRKSL--NIPDSADDAEALKAIRQAKDNF 281
           KL NPF+RT    ++KS+   + DS  + E   A+R+ KD F
Sbjct: 212 KLINPFLRTSEANVKKSVASKVQDST-EVEIFTALRRWKDEF 252



 Score = 39.7 bits (91), Expect(2) = 2e-22
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFS  CG+LFEGT +QM  SL+K
Sbjct: 127 GDALFSAGCGRLFEGTAEQMFNSLQK 152



>pir|AD3268|AD3268 hydroxyacylglutathione hydrolase (EC 3.1.2.6)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009456_252048 Brucella melitensis 16M
           chromosome I, section 13 of 195 of the complete
           sequence.>gb:AE014291_309342 Brucella suis 1330
           chromosome I, complete sequence.>gb:AE008917_977960
           Brucella melitensis 16M chromosome I, complete sequence.
          Length = 257

 Score = 84.3 bits (207), Expect(2) = 3e-22
 Identities = 42/100 (42%), Positives = 61/100 (61%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +++ LP DT +YCGHEYT +N++FAL+I+P N  L+  A +I  LR     T+P+T+  E
Sbjct: 159 KLVALPGDTALYCGHEYTQNNARFALTIDPDNSALKERAKEIARLRAHERMTLPSTIALE 218

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
              NPF+R     IR  L + D+ D+A     IR+ KD F
Sbjct: 219 MATNPFLRWHDRTIRARLGLQDAPDEA-VFAEIRKRKDMF 257



 Score = 43.1 bits (100), Expect(2) = 3e-22
 Identities = 19/27 (70%), Positives = 21/27 (77%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF+L CG+LFEGTP  M  SL K
Sbjct: 133 TGDTLFALGCGRLFEGTPATMFHSLEK 159



>gb:BX897700_829550 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 253

 Score = 81.6 bits (200), Expect(2) = 3e-22
 Identities = 41/100 (41%), Positives = 61/100 (61%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP++T +YCGHEYT +N+ FAL+++  NQ+L      +  LR K   T+P TL +E
Sbjct: 155 KLRQLPDETLLYCGHEYTKTNALFALTLDSHNQKLHQRVEDVFLLRAKNAMTLPVTLGQE 214

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R     +RK+L +    D+ E    IR+ KDNF
Sbjct: 215 KATNPFLRWDDRTLRKNLAMEKETDE-EVFAEIRKRKDNF 253



 Score = 45.8 bits (107), Expect(2) = 3e-22
 Identities = 20/27 (74%), Positives = 23/27 (85%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GDTLFSL CG+LFEGTP QML S +K
Sbjct: 129 SGDTLFSLGCGRLFEGTPAQMLNSFKK 155



>gb:CP000031_87169 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 255

 Score = 83.2 bits (204), Expect(2) = 5e-22
 Identities = 43/100 (43%), Positives = 61/100 (61%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+DT +  GHEYT SN++FALS++P N  L++ AA+I   R +G PT+P+ L  E
Sbjct: 157 KLAALPDDTLVCSGHEYTQSNARFALSVDPDNAALKTRAAEIDQARAEGRPTVPSLLSLE 216

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R     I+  L +   AD A     IR  KD+F
Sbjct: 217 KSTNPFLRAADPGIQSLLGM-QGADPARVFAEIRARKDHF 255



 Score = 43.5 bits (101), Expect(2) = 5e-22
 Identities = 19/27 (70%), Positives = 22/27 (81%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           T D+L +L CG+LFEGTPDQM ASL K
Sbjct: 131 TADSLMALGCGRLFEGTPDQMWASLSK 157



>gb:SME591791_186682 Sinorhizobium meliloti 1021 complete
           chromosome; segment 10/12.
          Length = 256

 Score = 89.0 bits (219), Expect(2) = 9e-22
 Identities = 47/100 (47%), Positives = 63/100 (63%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+M LP+DT IY GHEYTL+N+ FA++++P N  L+  AA+I   R  G  T PTT+  E
Sbjct: 158 RLMALPDDTAIYFGHEYTLANAHFAITVDPENSALKERAAEIEETRSDGGFTAPTTMGLE 217

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R    +IR  L + + A DA     IR+ KDNF
Sbjct: 218 KRTNPFLRAGDPKIRALLGM-EKASDAAVFAEIRKRKDNF 256



 Score = 37.0 bits (84), Expect(2) = 9e-22
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = -1

Query: 653 DTLFSLSCGKLFEGTPDQMLASLRK 579
           DTLF+L CG+LFEGT D M  SL +
Sbjct: 134 DTLFALGCGRLFEGTADTMWQSLSR 158



>gb:AE012557_284618 Xylella fastidiosa Temecula1, section 5 of 9 of
           the complete genome.>gb:AE009442_961194 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 258

 Score = 78.2 bits (191), Expect(2) = 1e-21
 Identities = 42/103 (40%), Positives = 56/103 (54%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP  T + CGHEYTLSN+ FAL ++P N  LQ    Q   +R  GLPT+P +LE E
Sbjct: 150 RLAALPIQTRVCCGHEYTLSNAAFALHVDPTNTALQKRRQQANAMRLAGLPTLPISLESE 209

Query: 400 KLCNPFVRTFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
              NPF+RT +  I  +          D+ E    +R  K+NF
Sbjct: 210 LNTNPFLRTAAPTIHAATATHLQRTPIDEVEVFATLRHWKNNF 252



 Score = 47.0 bits (110), Expect(2) = 1e-21
 Identities = 20/26 (76%), Positives = 24/26 (92%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFSL CG++FEGTP QMLASL++
Sbjct: 125 GDTLFSLGCGQIFEGTPTQMLASLQR 150



>gb:AE017282_427172 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 256

 Score = 85.5 bits (210), Expect(2) = 2e-21
 Identities = 41/100 (41%), Positives = 62/100 (62%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP +T ++C HEYT +N++FA++IEPGN  L+    ++  LR++G  T+P+ L +E
Sbjct: 156 RLRALPAETKVFCAHEYTQANARFAVTIEPGNAALRERVERVEALRREGAATVPSILSEE 215

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
              NPF+R  S EIR  L +P    + E    IR+ KD F
Sbjct: 216 LATNPFLRPESPEIRARLGLP-GVPEVEVFAEIRRRKDVF 254



 Score = 38.9 bits (89), Expect(2) = 2e-21
 Identities = 16/26 (61%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+L CG+LFEG+ +QM  SL +
Sbjct: 131 GDTLFALGCGRLFEGSAEQMWRSLER 156



>gb:BX572594_800226 Rhodopseudomonas palustris CGA009 complete
           genome; segment 2/16.
          Length = 255

 Score = 89.4 bits (220), Expect(2) = 5e-21
 Identities = 46/99 (46%), Positives = 62/99 (62%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+D  +YCGHEYT SN KFAL IEP N  LQ+ A Q+ +LR +G PTIP TL +E
Sbjct: 157 KLRALPDDFKLYCGHEYTASNVKFALGIEPDNAALQARAKQVESLRAEGKPTIPVTLGEE 216

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDN 284
           K  N F+R     +  ++ +P  A  AE    IR+ K+N
Sbjct: 217 KQANVFLRADVPSVAAAVGMP-GAPAAEVFGEIRERKNN 254



 Score = 33.9 bits (76), Expect(2) = 5e-21
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 653 DTLFSLSCGKLFEGTPDQMLASLRK 579
           DTLFS+ CG++FEGT   M  SL K
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWESLLK 157



>gb:CP000010_865142 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 268

 Score = 78.2 bits (191), Expect(2) = 7e-21
 Identities = 42/99 (42%), Positives = 60/99 (60%), Gaps = 3/99 (3%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP DT ++C HEYTLSN +FAL+ EPGN  L ++  +    R +G PT+PTT+  E   N
Sbjct: 169 LPGDTRVHCAHEYTLSNIQFALACEPGNAALAAWRDEALARRARGEPTLPTTIAHECAVN 228

Query: 388 PFVRTFSMEIRKSL--NIPDSADD-AEALKAIRQAKDNF 281
           PF+R  S  IR +L   + ++A D   A   +R+ K+ F
Sbjct: 229 PFLRADSASIRATLEARLHEAAPDRLAAFTLMREWKNRF 267



 Score = 44.7 bits (104), Expect(2) = 7e-21
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLFS  CG+LFEGTP QMLASL
Sbjct: 140 GDTLFSCGCGRLFEGTPAQMLASL 163



>gb:BX571965_791130 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 268

 Score = 78.2 bits (191), Expect(2) = 7e-21
 Identities = 42/99 (42%), Positives = 60/99 (60%), Gaps = 3/99 (3%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP DT ++C HEYTLSN +FAL+ EPGN  L ++  +    R +G PT+PTT+  E   N
Sbjct: 169 LPGDTRVHCAHEYTLSNIQFALACEPGNAALAAWRDEARARRARGEPTLPTTIAHECAVN 228

Query: 388 PFVRTFSMEIRKSL--NIPDSADD-AEALKAIRQAKDNF 281
           PF+R  S  IR +L   + ++A D   A   +R+ K+ F
Sbjct: 229 PFLRADSASIRATLEARLHEAAPDRLAAFTLMREWKNRF 267



 Score = 44.7 bits (104), Expect(2) = 7e-21
 Identities = 20/24 (83%), Positives = 21/24 (87%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLFS  CG+LFEGTP QMLASL
Sbjct: 140 GDTLFSCGCGRLFEGTPAQMLASL 163



>pir|H82591|H82591 hydroxyacylglutathione hydrolase XF2160
           [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE004030_49788 Xylella fastidiosa 9a5c, section
           176 of 229 of the complete genome.>gb:AE003849_1116998
           Xylella fastidiosa 9a5c, complete genome.
          Length = 258

 Score = 75.9 bits (185), Expect(2) = 7e-21
 Identities = 41/103 (39%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP  T + CGHEYTLSN+ FAL ++P N  LQ    Q   +R   LPT+P +LE E
Sbjct: 150 RLAALPIQTRVCCGHEYTLSNAAFALHVDPTNTALQKRRQQANAMRLANLPTLPISLESE 209

Query: 400 KLCNPFVRTFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
              NPF+RT +  I  +          D+ E    +R  K+NF
Sbjct: 210 LNTNPFLRTAAPTIHAATATHLQRTPIDEVEVFATLRHWKNNF 252



 Score = 47.0 bits (110), Expect(2) = 7e-21
 Identities = 20/26 (76%), Positives = 24/26 (92%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFSL CG++FEGTP QMLASL++
Sbjct: 125 GDTLFSLGCGQIFEGTPTQMLASLQR 150



>gb:AE016803_336538 Vibrio vulnificus CMCP6 chromosome I section 7
           of 11 of the complete sequence.>gb:BA000037_723358
           Vibrio vulnificus YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1046262 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 252

 Score = 84.7 bits (208), Expect(2) = 9e-21
 Identities = 40/101 (39%), Positives = 61/101 (60%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +++ LP +T ++C HEYT SN  FAL++EP N+ L  Y   +  LR + LPTIPTTL +E
Sbjct: 152 KLLALPEETEVFCAHEYTASNVAFALAVEPDNELLHQYRDTVNRLRAQNLPTIPTTLRQE 211

Query: 400 KLCNPFVRTFSMEIRKSLNI-PDSADDAEALKAIRQAKDNF 281
           K  NPF+R     +  S++    ++D      A+R+ K+ F
Sbjct: 212 KWINPFLRYLQPSVIHSVSSRTKNSDPLSVFTALREWKNEF 252



 Score = 37.7 bits (86), Expect(2) = 9e-21
 Identities = 16/26 (61%), Positives = 18/26 (69%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFS  CG++FEGT  QM  SL K
Sbjct: 127 GDVLFSAGCGRIFEGTAQQMFDSLNK 152



>gb:BX640434_812071 Bordetella parapertussis strain 12822, complete
           genome; segment 12/14.
          Length = 266

 Score = 80.1 bits (196), Expect(2) = 1e-20
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP DT + C HEYTL+N ++AL++EP N+ LQ +  +   LR +G PT+P+T+ +E
Sbjct: 163 KLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQE 222

Query: 400 KLCNPFVRTFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
           +  NPF+RT    +  +  +      A   E   A+RQ K+NF
Sbjct: 223 RETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNF 265



 Score = 42.0 bits (97), Expect(2) = 1e-20
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG+LFEGTP QML SL K
Sbjct: 138 GDTLFAGGCGRLFEGTPAQMLDSLEK 163



>gb:BX640420_807607 Bordetella pertussis strain Tohama I, complete
           genome; segment 10/12.>gb:BX640450_816929 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           14/16.
          Length = 266

 Score = 80.1 bits (196), Expect(2) = 1e-20
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP DT + C HEYTL+N ++AL++EP N+ LQ +  +   LR +G PT+P+T+ +E
Sbjct: 163 KLSALPADTQVCCAHEYTLANLRWALAVEPANRTLQQWYQRAQELRNEGTPTLPSTIGQE 222

Query: 400 KLCNPFVRTFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
           +  NPF+RT    +  +  +      A   E   A+RQ K+NF
Sbjct: 223 RETNPFLRTPHAAVAHAAAVWSGRSLATPVEVFAALRQWKNNF 265



 Score = 42.0 bits (97), Expect(2) = 1e-20
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG+LFEGTP QML SL K
Sbjct: 138 GDTLFAGGCGRLFEGTPAQMLDSLEK 163



>sp|P96981|GLO2_RHOCA Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>gb:RCATP1OPN_162581
           R.capsulatus complete atp1 operon.
          Length = 256

 Score = 84.3 bits (207), Expect(2) = 3e-20
 Identities = 41/100 (41%), Positives = 57/100 (57%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP +T +  GHEYT +N +FALS+EPGN  L     ++T LR  G P++P TL +E
Sbjct: 157 RLAALPPETRVCSGHEYTAANGRFALSLEPGNGRLHDRMDRVTALRLAGEPSLPVTLGEE 216

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           +  NPF+R     +R +L +P  A       A R  KD F
Sbjct: 217 RATNPFLRADDAALRAALGLPGDAAPLAVFTAARARKDRF 256



 Score = 36.2 bits (82), Expect(2) = 3e-20
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GD+L S  CG+LFEGTP QM  +L +
Sbjct: 131 SGDSLMSWGCGRLFEGTPAQMFDTLTR 157



>gb:BX936398_837610 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 251

 Score = 77.8 bits (190), Expect(2) = 5e-20
 Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP++T I C HEYTLSN KFA +I P +Q++ +Y  QI  LR K LP++P  L+ E
Sbjct: 151 RLAQLPDETLICCAHEYTLSNLKFAHAILPADQDIATYQQQIEQLRSKNLPSLPVKLQFE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADD-AEALKAIRQAKDNF 281
           +  N F+R   +++++ + I    D        +R  KD+F
Sbjct: 211 RKINVFLRCNDIDLQRKIGITSPPDSLVSVFCELRSRKDSF 251



 Score = 42.4 bits (98), Expect(2) = 5e-20
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+L EGTP+QM AS+++
Sbjct: 126 GDTLFSAGCGRLLEGTPEQMYASIQR 151



>gb:AP008231_579847 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 223

 Score = 79.3 bits (194), Expect(2) = 5e-20
 Identities = 40/96 (41%), Positives = 59/96 (61%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP+DT IYC HEYTL+N +FAL++EP N +LQ     +   R++G  TIP+ L+ EK  N
Sbjct: 131 LPDDTAIYCAHEYTLNNLRFALTVEPDNFDLQQRYQAVAIARQQGQATIPSRLDIEKATN 190

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R     ++ +++   S D  + L  +R  KD F
Sbjct: 191 PFLRWDQAALQAAVS---SQDPVQTLARLRSRKDQF 223



 Score = 40.8 bits (94), Expect(2) = 5e-20
 Identities = 18/26 (69%), Positives = 22/26 (84%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG+LFEGTP QML SL++
Sbjct: 102 GDTLFAGGCGRLFEGTPAQMLDSLQQ 127



>sp|O24496|GL2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic
           (EC 3.1.2.6) (Glyoxalase II) (Glx
           II).>gb:ATAC011708_1543390 Arabidopsis thaliana
           chromosome III BAC T7M13 genomic sequence, complete
           sequence.>gb:ATGLYII_1551862 A.thaliana mRNA for
           glyoxalase II.>gb:AY052329_1562702 Arabidopsis thaliana
           AT3g10850/T7M13_7 mRNA, complete
           cds.>gb:BT000849_1635104 Arabidopsis thaliana
           At3g10850/T7M13_7 mRNA, complete cds.
          Length = 258

 Score = 81.3 bits (199), Expect(2) = 6e-20
 Identities = 40/96 (41%), Positives = 57/96 (59%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP  T +YCGHEYT+ N +FAL++EP N ++Q   A     R+  LPTIP+TLE+E   N
Sbjct: 164 LPKPTQVYCGHEYTVKNLEFALTVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETN 223

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R    EI++ L      D    ++ +R  KD +
Sbjct: 224 PFMRVDKPEIQEKLGCKSPID---TMREVRNKKDQW 256



 Score = 38.5 bits (88), Expect(2) = 6e-20
 Identities = 17/25 (68%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK FEGT +QM  SL
Sbjct: 133 TGDTLFVAGCGKFFEGTAEQMYQSL 157



>gb:ATU90929_1557381 Arabidopsis thaliana glyoxalase II cytoplasmic
           isozyme (Glx2-2) mRNA, complete cds.
          Length = 256

 Score = 81.3 bits (199), Expect(2) = 6e-20
 Identities = 40/96 (41%), Positives = 57/96 (59%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP  T +YCGHEYT+ N +FAL++EP N ++Q   A     R+  LPTIP+TLE+E   N
Sbjct: 162 LPKPTQVYCGHEYTVKNLEFALTVEPNNGKIQQKLAWARQQRQADLPTIPSTLEEELETN 221

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R    EI++ L      D    ++ +R  KD +
Sbjct: 222 PFMRVDKPEIQEKLGCKSPID---TMREVRNKKDQW 254



 Score = 38.5 bits (88), Expect(2) = 6e-20
 Identities = 17/25 (68%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK FEGT +QM  SL
Sbjct: 131 TGDTLFVAGCGKFFEGTAEQMYQSL 155



>pir|A82102|A82102 probable hydroxyacylglutathione hydrolase GloB
           VC2236 [imported] - Vibrio cholerae (strain N16961
           serogroup O1)>gb:AE004295_52610 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, section 203 of
           251 of the complete chromosome.>gb:AE003852_1053384
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, complete chromosome.
          Length = 252

 Score = 80.5 bits (197), Expect(2) = 8e-20
 Identities = 38/101 (37%), Positives = 63/101 (62%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +++ LP +T +Y  HEYT +N  FAL++EP N++L  Y  +++ LR +  PT+PTTL +E
Sbjct: 152 KLLSLPEETQVYSAHEYTAANVAFALAVEPENEQLHIYRDEVSRLRAQNQPTLPTTLGRE 211

Query: 400 KLCNPFVRTFSMEIRKSL-NIPDSADDAEALKAIRQAKDNF 281
           K  NPF+RT    + +S+ +   + D      A+R+ K+ F
Sbjct: 212 KWVNPFLRTQEPSVIRSVASQVSTLDPLTIFTALREWKNEF 252



 Score = 38.9 bits (89), Expect(2) = 8e-20
 Identities = 16/26 (61%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFS  CG++FEGT +QM +SL K
Sbjct: 127 GDVLFSAGCGRVFEGTMEQMFSSLNK 152



>gb:AF346500_503339 Photorhabdus luminescens strain W14 toxin
           complex pathogenicity island 1, partial sequence.
          Length = 250

 Score = 77.4 bits (189), Expect(2) = 1e-19
 Identities = 39/101 (38%), Positives = 64/101 (63%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP+DT I C HEYT+SN KFA ++ P NQ +  Y  ++T +R+   PT+PTTL+ E
Sbjct: 151 KIAELPDDTLICCAHEYTVSNMKFAHAVLP-NQTISEYQQKVTQMRESNQPTVPTTLQTE 209

Query: 400 KLCNPFVRTFSMEIRKSLNI-PDSADDAEALKAIRQAKDNF 281
           K  N F++   +++++++ I P+S   +     +R+ KD F
Sbjct: 210 KKINIFLKCDDVDLQRNIGIVPNSQPLSAVFCQLRRRKDQF 250



 Score = 41.6 bits (96), Expect(2) = 1e-19
 Identities = 19/26 (73%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGT +QM ASL K
Sbjct: 126 GDTLFSGGCGRLFEGTAEQMYASLSK 151



>pir|D98282|D98282 hypothetical protein AGR_L_2423 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008322_235724 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 126 of 187 of the
           complete sequence.>gb:AE007870_1080837 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 275

 Score = 90.5 bits (223), Expect(2) = 1e-19
 Identities = 45/100 (45%), Positives = 65/100 (65%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++M LP+DT +Y GHEYTLSN++FAL+++P N  L+  AA++   R+    TIPTT+  E
Sbjct: 177 KLMALPDDTRVYFGHEYTLSNARFALTVDPDNAVLRERAARVETARQANEFTIPTTIGLE 236

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NP++R     IR+ L + + A DA+    IR  KDNF
Sbjct: 237 KQTNPYMRVADAGIRRHLGL-EGAADADVFAEIRTRKDNF 275



 Score = 28.1 bits (61), Expect(2) = 1e-19
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -1

Query: 653 DTLFSLSCGKLFEGTPDQMLASLRK 579
           DTLF++ CG+LFE     M  S +K
Sbjct: 153 DTLFAMGCGRLFERPAADMWHSFQK 177



>pir|AD3001|AD3001 glyoxalase II [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>gb:AE009290_250453
           Agrobacterium tumefaciens str. C58 linear chromosome,
           section 60 of 187 of the complete
           sequence.>gb:AE008689_1088296 Agrobacterium tumefaciens
           str. C58 linear chromosome, complete sequence.
          Length = 256

 Score = 90.5 bits (223), Expect(2) = 1e-19
 Identities = 45/100 (45%), Positives = 65/100 (65%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++M LP+DT +Y GHEYTLSN++FAL+++P N  L+  AA++   R+    TIPTT+  E
Sbjct: 158 KLMALPDDTRVYFGHEYTLSNARFALTVDPDNAVLRERAARVETARQANEFTIPTTIGLE 217

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NP++R     IR+ L + + A DA+    IR  KDNF
Sbjct: 218 KQTNPYMRVADAGIRRHLGL-EGAADADVFAEIRTRKDNF 256



 Score = 28.1 bits (61), Expect(2) = 1e-19
 Identities = 12/25 (48%), Positives = 16/25 (64%)
 Frame = -1

Query: 653 DTLFSLSCGKLFEGTPDQMLASLRK 579
           DTLF++ CG+LFE     M  S +K
Sbjct: 134 DTLFAMGCGRLFERPAADMWHSFQK 158



>gb:AE013910_301389 Yersinia pestis KIM section 310 of 415 of the
           complete genome.>gb:AE017137_388531 Yersinia pestis
           biovar Medievalis str. 91001 section 11 of 16 of the
           complete genome.>gb:AE009952_931572 Yersinia pestis KIM
           complete genome.>gb:AE017042_1145097 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 280

 Score = 75.9 bits (185), Expect(2) = 2e-19
 Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP++T I C HEYTLSN KFA +I P +Q++ +Y  QI  LR K LP++P  L+ E
Sbjct: 180 RLAQLPDETLICCAHEYTLSNLKFAHAILPADQDIATYQQQIEQLRSKNLPSLPVKLQFE 239

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADD-AEALKAIRQAKDNF 281
           +  N F+R   +++++ +      D        +R  KD+F
Sbjct: 240 RKINVFLRCNDIDLQRKIGTTSPPDSLVSVFCELRSRKDSF 280



 Score = 42.4 bits (98), Expect(2) = 2e-19
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+L EGTP+QM AS+++
Sbjct: 155 GDTLFSAGCGRLLEGTPEQMYASIQR 180



>pir|AG0132|AG0132 probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) [imported] - Yersinia pestis (strain
           CO92)>gb:AJ414146_522915 Yersinia pestis strain CO92
           complete genome; segment 6/20.
          Length = 251

 Score = 75.9 bits (185), Expect(2) = 2e-19
 Identities = 38/101 (37%), Positives = 59/101 (58%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP++T I C HEYTLSN KFA +I P +Q++ +Y  QI  LR K LP++P  L+ E
Sbjct: 151 RLAQLPDETLICCAHEYTLSNLKFAHAILPADQDIATYQQQIEQLRSKNLPSLPVKLQFE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADD-AEALKAIRQAKDNF 281
           +  N F+R   +++++ +      D        +R  KD+F
Sbjct: 211 RKINVFLRCNDIDLQRKIGTTSPPDSLVSVFCELRSRKDSF 251



 Score = 42.4 bits (98), Expect(2) = 2e-19
 Identities = 17/26 (65%), Positives = 22/26 (84%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+L EGTP+QM AS+++
Sbjct: 126 GDTLFSAGCGRLLEGTPEQMYASIQR 151



>gb:BX571862_785799 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 4/17.
          Length = 250

 Score = 79.0 bits (193), Expect(2) = 2e-19
 Identities = 40/102 (39%), Positives = 64/102 (62%), Gaps = 1/102 (0%)
 Frame = -2

Query: 583 GRIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEK 404
           G+I  LP+DT I C HEYT+SN KFA ++ P NQ +  Y  ++  +R+   PTIPTTL+ 
Sbjct: 150 GKIAELPDDTLICCAHEYTISNMKFAHAVLP-NQTISEYQQKVIRMRENNQPTIPTTLQT 208

Query: 403 EKLCNPFVRTFSMEIRKSLNI-PDSADDAEALKAIRQAKDNF 281
           EK  N F++   +++++++ I P+S   +     +R+ KD F
Sbjct: 209 EKKINIFLKCDDIDLQRNIGITPNSQPLSAVFHQLRRQKDQF 250



 Score = 38.9 bits (89), Expect(2) = 2e-19
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGT +QM  S+ K
Sbjct: 126 GDTLFSGGCGRLFEGTAEQMYTSIGK 151



>gb:BX950851_842077 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 251

 Score = 75.9 bits (185), Expect(2) = 2e-19
 Identities = 38/101 (37%), Positives = 64/101 (63%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP+DT + C HEYTLSN +F+  I P + +++SY  +I+ +R+K   ++PTTL  E
Sbjct: 151 KIAELPDDTVVCCAHEYTLSNLRFSNDIWPEDPDIESYLHKISQIREKSQSSLPTTLGLE 210

Query: 400 KLCNPFVRTFSMEI-RKSLNIPDSADDAEALKAIRQAKDNF 281
           +  N F+R   +++ RK  N P++ ++ +  K +R  KD F
Sbjct: 211 RRINLFLRCHEIDLKRKISNEPENIENWQVFKMLRSKKDCF 251



 Score = 42.0 bits (97), Expect(2) = 2e-19
 Identities = 17/26 (65%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG++FEGTP QM  S++K
Sbjct: 126 GDTLFSAGCGRIFEGTPKQMYESIQK 151



>gb:AE016869_353095 Pseudomonas syringae pv. tomato str. DC3000
           section 14 of 21 of the complete
           genome.>gb:AE016853_1038270 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 259

 Score = 75.1 bits (183), Expect(2) = 3e-19
 Identities = 37/103 (35%), Positives = 60/103 (58%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP+ T IYC HEYTLSN +FA ++EP NQ++    AQ+T +R +   ++P++L  E
Sbjct: 157 RLAALPDSTLIYCAHEYTLSNLRFAQAVEPDNQDIAERLAQVTLMRSENRISLPSSLALE 216

Query: 400 KLCNPFVRTFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
           K  NPF+RT    +++  +      +   +    ++R  KD F
Sbjct: 217 KRTNPFLRTRETSVKEKADERSGGQNTSQSAVFASLRAWKDKF 259



 Score = 42.4 bits (98), Expect(2) = 3e-19
 Identities = 18/27 (66%), Positives = 22/27 (81%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GDTLF+  CG+LFEGTP QM ASL +
Sbjct: 131 SGDTLFAAGCGRLFEGTPGQMHASLER 157



>pir|AC1879|AC1879 hypothetical protein all0580 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_681572 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 257

 Score = 76.3 bits (186), Expect(2) = 4e-19
 Identities = 38/100 (38%), Positives = 58/100 (58%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP +T ++C HEYTL N +FALS++  N ELQ    ++   R +G+ T+P+ L  E
Sbjct: 161 KLRSLPENTRVWCAHEYTLKNLQFALSVDSKNTELQKRLDEVKTKRSQGIATVPSLLGVE 220

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           KL NPF+R     ++ ++N   S D  +    IR  KD F
Sbjct: 221 KLTNPFLRWEQPSLQLAVN---SNDPVQTFARIRGLKDKF 257



 Score = 40.8 bits (94), Expect(2) = 4e-19
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG+LFEGTP QM+ SL K
Sbjct: 136 GDTLFAGGCGRLFEGTPAQMVESLTK 161



>gb:AL646065_546443 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 9/19.
          Length = 284

 Score = 75.5 bits (184), Expect(2) = 6e-19
 Identities = 38/103 (36%), Positives = 62/103 (60%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP DT +YC HEYT +N +FA ++EPGN  L ++  ++ +LR  G  T+PTT+  E
Sbjct: 181 KLAALPPDTRVYCAHEYTAANVRFARAVEPGNAALAAWEDEVASLRTDGRATVPTTVGHE 240

Query: 400 KLCNPFVRTFSMEIRKSL--NIPDSADDAEAL-KAIRQAKDNF 281
           +  NPF+R+    +  S+  +     DD  A+  A+R+ K+ F
Sbjct: 241 RATNPFMRSNEPAVAASVAQHAGIGVDDPVAVFAALREWKNGF 283



 Score = 40.8 bits (94), Expect(2) = 6e-19
 Identities = 18/26 (69%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG+LFEGTP QM  SL K
Sbjct: 156 GDTLFATGCGRLFEGTPAQMRLSLSK 181



>gb:AE015698_316932 Shewanella oneidensis MR-1 section 247 of 457 of
           the complete genome.>gb:AE014299_952529 Shewanella
           oneidensis MR-1 complete genome.
          Length = 267

 Score = 74.7 bits (182), Expect(2) = 8e-19
 Identities = 40/102 (39%), Positives = 58/102 (56%), Gaps = 6/102 (5%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T +YC HEYTL+N KFA + +P N +L++Y  Q T LR +G  TIP+T+  E+  N
Sbjct: 166 LPAETRVYCAHEYTLANLKFAQAADPSNAKLKAYNEQATALRAQGKATIPSTIGLERSIN 225

Query: 388 PFVRTFSMEIRKSLNIP------DSADDAEALKAIRQAKDNF 281
           PF+R  +  I  S+          + D+      +RQ KD F
Sbjct: 226 PFLRGLTPTIVDSIKQQFCDQDLSNVDELTYFTLLRQWKDIF 267



 Score = 41.2 bits (95), Expect(2) = 8e-19
 Identities = 19/25 (76%), Positives = 20/25 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLR 582
           GDTLFS  CG+LFEGTP QM  SLR
Sbjct: 137 GDTLFSGGCGRLFEGTPAQMCHSLR 161



>gb:AE008692_240497 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 241

 Score = 77.8 bits (190), Expect(2) = 8e-19
 Identities = 41/100 (41%), Positives = 55/100 (55%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R   LP +T +YCGHEYT  N  FAL+++P NQ LQ    ++  LR +G  T+PTT+  E
Sbjct: 157 RFAALPPETKVYCGHEYTQDNGHFALTVDPDNQALQKRVKEVDLLRAQGKITLPTTIALE 216

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R               A + E L  +R+AKD F
Sbjct: 217 KATNPFMR---------------AKNPEELAKLRKAKDIF 241



 Score = 38.1 bits (87), Expect(2) = 8e-19
 Identities = 14/26 (53%), Positives = 22/26 (84%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF++ CG++FEGT +QM  +L++
Sbjct: 132 GDTLFAMGCGRIFEGTAEQMWQALQR 157



>pir|F87313|F87313 hydroxyacylglutathione hydrolase, probable
           [imported] - Caulobacter crescentus>gb:AE005724_74536
           Caulobacter crescentus CB15 section 50 of 359 of the
           complete genome.>gb:AE005673_921568 Caulobacter
           crescentus CB15 complete genome.
          Length = 249

 Score = 76.3 bits (186), Expect(2) = 1e-18
 Identities = 41/101 (40%), Positives = 60/101 (59%)
 Frame = -2

Query: 583 GRIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEK 404
           GR++ LP++T +YC HEYT SN++FALS++  +  L + A  +   R +   T+PTT+  
Sbjct: 155 GRLIALPDETTVYCAHEYTASNARFALSVD-SSAALAARAEAVFAARARDEATVPTTIGV 213

Query: 403 EKLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           EK  NPF       +R  L  PD+   A+A   IR AKD+F
Sbjct: 214 EKATNPF-------LRAPLLRPDAPSPAQAFAEIRAAKDSF 247



 Score = 39.3 bits (90), Expect(2) = 1e-18
 Identities = 17/24 (70%), Positives = 20/24 (83%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLF+L CG+LFEGT +QM  SL
Sbjct: 131 GDTLFALGCGRLFEGTAEQMWDSL 154



>gb:AY398356_2531886 Danio rerio clone RK068A3B01 hydroxyacyl
           glutathione hydrolase (HAGH) mRNA, complete
           cds.>gb:BC060913_2553006 Danio rerio zgc:73161, mRNA
           (cDNA clone MGC:73161 IMAGE:4145411), complete
           cds.>gb:BC066607_2554474 Danio rerio zgc:73161, mRNA
           (cDNA clone MGC:77521 IMAGE:6525711), complete cds.
          Length = 260

 Score = 77.4 bits (189), Expect(2) = 1e-18
 Identities = 38/96 (39%), Positives = 58/96 (60%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T +YCGHEYT++N KFA  +EP N+ +++  A        G PTIP+T+ +E   N
Sbjct: 163 LPPETRVYCGHEYTINNLKFARHVEPNNEVIRTKLAWAKEKYDNGEPTIPSTVAEEFTFN 222

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R     +   L    ++D  EA+++IR+ KD F
Sbjct: 223 PFMRVREKSV---LEHAGTSDPIEAMRSIRKEKDGF 255



 Score = 37.7 bits (86), Expect(2) = 1e-18
 Identities = 16/25 (64%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK FEGT D+M  +L
Sbjct: 132 TGDTLFVAGCGKFFEGTADEMYKAL 156



>sp|Q99KB8|GLO2_MOUSE Hydroxyacylglutathione hydrolase (EC 3.1.2.6)
           (Glyoxalase II) (Glx II).>gb:BC004749_2089758 Mus
           musculus hydroxyacyl glutathione hydrolase, mRNA (cDNA
           clone MGC:6697 IMAGE:3583919), complete
           cds.>gb:BC019817_2093131 Mus musculus hydroxyacyl
           glutathione hydrolase, mRNA (cDNA clone MGC:29966
           IMAGE:5123648), complete cds.
          Length = 260

 Score = 77.8 bits (190), Expect(2) = 2e-18
 Identities = 39/96 (40%), Positives = 54/96 (56%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP DT +YCGHEYT++N KFA  +EPGN  +Q   A        G PT+P+TL +E   N
Sbjct: 163 LPPDTKVYCGHEYTVNNLKFARHVEPGNAAIQEKLAWAKEKYAIGEPTVPSTLAEEFTYN 222

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R     +++        D    ++AIR+ KD F
Sbjct: 223 PFMRVKEKTVQQHAG---ETDPVTTMRAIRREKDQF 255



 Score = 36.6 bits (83), Expect(2) = 2e-18
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK +EGT D+M  +L
Sbjct: 132 TGDTLFVAGCGKFYEGTADEMYKAL 156



>sp|P72933|GLO2_SYNY3 Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>pir|S74799|S74799
           glyoxalase II - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_687729 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 257

 Score = 75.5 bits (184), Expect(2) = 2e-18
 Identities = 38/101 (37%), Positives = 59/101 (58%)
 Frame = -2

Query: 583 GRIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEK 404
           G++  LP+ T ++C HEYTL N KFAL+++P N++LQ     +   R++G  TIP+ L  
Sbjct: 160 GKLRQLPDQTRLWCAHEYTLGNLKFALTVDPSNKDLQERFQTVQGDRQRGQATIPSWLGT 219

Query: 403 EKLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           EK  NPF+R  +  I+  + +    + A     +R  KDNF
Sbjct: 220 EKRTNPFLRWDNPAIQARVGM---TEPARVFGKLRGMKDNF 257



 Score = 38.9 bits (89), Expect(2) = 2e-18
 Identities = 16/26 (61%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDT+F+  CG+LFEGTP QM+ S+ K
Sbjct: 136 GDTIFAGGCGRLFEGTPAQMVQSIGK 161



>gb:AE012196_280243 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 104 of 460 of the complete
           genome.>gb:AE008922_913525 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 255

 Score = 71.6 bits (174), Expect(2) = 2e-18
 Identities = 38/103 (36%), Positives = 56/103 (54%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP +T + CGHEYTL+N+ FAL ++P N  LQ    +   +R    PT+P +L+ E
Sbjct: 151 RLASLPGETLVCCGHEYTLANAAFALHVDPTNAALQRRQQEAQAMRHAARPTLPISLKSE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDS---ADDAEALKAIRQAKDNF 281
              NPF+R  + EIR +     S     D +    +R+ KD F
Sbjct: 211 LATNPFLRLHTPEIRAAAAAHASISITSDVDVFAELRRWKDAF 253



 Score = 42.7 bits (99), Expect(2) = 2e-18
 Identities = 17/27 (62%), Positives = 23/27 (85%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GDTLFSL CG++FEGTP QM  +L++
Sbjct: 125 SGDTLFSLGCGRMFEGTPPQMFDALQR 151



>gb:AE017340_457452 Idiomarina loihiensis L2TR, complete genome.
          Length = 253

 Score = 73.9 bits (180), Expect(2) = 4e-18
 Identities = 40/104 (38%), Positives = 60/104 (57%), Gaps = 5/104 (4%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP +T ++C HEYT +N  FAL +EP N  LQSYA ++  LR++   T+P+TL+ E
Sbjct: 151 KLRKLPGETRVFCAHEYTQANVNFALKVEPENAVLQSYAEKVRMLREQEQITLPSTLQLE 210

Query: 400 KLCNPFVRTFSMEIRKSLN-----IPDSADDAEALKAIRQAKDN 284
              NPF+R     +  + N     + +S +D      IRQ KDN
Sbjct: 211 LAINPFLRFDQKSVIAAANKHAESVKNSPED--VFYTIRQWKDN 252



 Score = 39.7 bits (91), Expect(2) = 4e-18
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG++FEGTP+Q   SL K
Sbjct: 126 GDTLFSGGCGRMFEGTPEQFTQSLLK 151



>gb:AY223455_1176914 Schistosoma japonicum clone ZZZ476 mRNA
           sequence.
          Length = 261

 Score = 77.8 bits (190), Expect(2) = 5e-18
 Identities = 37/96 (38%), Positives = 57/96 (59%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP  T +YCGHEYT+ N +F L+IEP N+ L+     +  LR    P++P T+ +E   N
Sbjct: 169 LPTATKVYCGHEYTVKNLEFGLTIEPKNEALKHRLEAVKRLRASNQPSVPGTIGEELATN 228

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R   +++   L    + D  +A+K IR+ KD+F
Sbjct: 229 PFMRVSEVDV---LTHAKTTDPIKAMKIIREEKDHF 261



 Score = 35.4 bits (80), Expect(2) = 5e-18
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CG+ FEGT +QM  +L
Sbjct: 138 TGDTLFLGGCGRFFEGTAEQMFKAL 162



>sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase (EC 3.1.2.6)
           (Glyoxalase II) (GLX II).>gb:AE006639_1875678 Homo
           sapiens 16p13.3 sequence section 7 of
           8.>gb:BC000840_1967067 Homo sapiens
           hydroxyacylglutathione hydrolase, mRNA (cDNA clone
           MGC:5303 IMAGE:3457214), complete
           cds.>gb:BC002627_1968270 Homo sapiens
           hydroxyacylglutathione hydrolase, mRNA (cDNA clone
           MGC:3589 IMAGE:3608098), complete
           cds.>gb:HS429E7_1998606 Human DNA sequence from clone
           LA16-429E7 on chromosome 16 Contains the HAGH
           (hydroxyacyl glutathione hydrolase) gene, ESTs, STSs,
           GSSs and CpG Islands, complete
           sequence.>gb:HSHAGH1_2013684 H.sapiens mRNA for
           Glyoxalase II.
          Length = 260

 Score = 76.6 bits (187), Expect(2) = 5e-18
 Identities = 37/96 (38%), Positives = 54/96 (56%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP DT +YCGHEYT++N KFA  +EPGN  ++   A        G PT+P+TL +E   N
Sbjct: 163 LPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYN 222

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R     +++        D    ++A+R+ KD F
Sbjct: 223 PFMRVREKTVQQHAG---ETDPVTTMRAVRREKDQF 255



 Score = 36.6 bits (83), Expect(2) = 5e-18
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK +EGT D+M  +L
Sbjct: 132 TGDTLFVAGCGKFYEGTADEMCKAL 156



>gb:BA000040_728482 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 255

 Score = 79.7 bits (195), Expect(2) = 5e-18
 Identities = 40/98 (40%), Positives = 59/98 (60%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+D  +YCGHEYT SN KFAL+++P N  LQ+ AA++  LR +  PTIP+ L  E
Sbjct: 157 KLRALPDDFKLYCGHEYTASNVKFALTVDPDNAALQARAAEVAKLRAENKPTIPSLLGDE 216

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKD 287
           K  N F+R     +   L++   AD A     +R+ K+
Sbjct: 217 KRANVFLRADDPSVAARLHM-KGADAAAVFGELRERKN 253



 Score = 33.5 bits (75), Expect(2) = 5e-18
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 653 DTLFSLSCGKLFEGTPDQMLASLRK 579
           DTLFS+ CG++FEGT   M  SL K
Sbjct: 133 DTLFSIGCGRVFEGTYPMMWDSLLK 157



>gb:AE011738_276033 Xanthomonas axonopodis pv. citri str. 306,
           section 116 of 469 of the complete
           genome.>gb:AE008923_917808 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 255

 Score = 72.0 bits (175), Expect(2) = 7e-18
 Identities = 39/104 (37%), Positives = 59/104 (56%), Gaps = 4/104 (3%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP +T + CGHEYTL+N+ FAL ++P N  LQ    +   +R    PT+P +L+ E
Sbjct: 151 RLASLPGETLVCCGHEYTLANAAFALHVDPTNAALQRRQQEAQAMRHAARPTLPISLKSE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSA----DDAEALKAIRQAKDNF 281
              NPF+RT   EIR ++  P +A     + +    +R+ KD F
Sbjct: 211 LATNPFLRTSHPEIRAAV-APRAASALSSEVDIFAELRRWKDEF 253



 Score = 40.8 bits (94), Expect(2) = 7e-18
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GDTLFSL CG++FEGT  QM  SL++
Sbjct: 125 SGDTLFSLGCGRMFEGTAPQMFDSLQR 151



>sp|O35952|GLO2_RAT Hydroxyacylglutathione hydrolase (EC 3.1.2.6)
           (Glyoxalase II) (Glx II) (Round spermatid protein
           RSP29).>pir|JC5826|JC5826 hydroxyacylglutathione
           hydrolase (EC 3.1.2.6) - rat>gb:U97667_2140352 Rattus
           norvegicus round spermatid protein RSP29 gene, complete
           cds.
          Length = 260

 Score = 75.1 bits (183), Expect(2) = 1e-17
 Identities = 38/96 (39%), Positives = 53/96 (55%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP DT + CGHEYT++N KFA  +EPGN  +Q   A        G PT+P+TL +E   N
Sbjct: 163 LPPDTKVICGHEYTVNNLKFARHVEPGNTAVQEKLAWAKEKNAIGEPTVPSTLAEEFTYN 222

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R     +++        D    ++AIR+ KD F
Sbjct: 223 PFMRVKEKTVQQHAG---ETDPVTTMRAIRREKDQF 255



 Score = 36.6 bits (83), Expect(2) = 1e-17
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK +EGT D+M  +L
Sbjct: 132 TGDTLFVAGCGKFYEGTADEMYKAL 156



>gb:AE016789_333540 Pseudomonas putida KT2440 section 16 of 21 of
           the complete genome.>gb:AE015451_948617 Pseudomonas
           putida KT2440 complete genome.
          Length = 259

 Score = 72.0 bits (175), Expect(2) = 1e-17
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP  T +YC HEYTLSN +FA ++EP N  +Q     +T LR +   ++P+T+  E
Sbjct: 157 RLAALPEQTQVYCAHEYTLSNLRFAKAVEPTNPHVQQRFEDVTRLRAENRISLPSTIGLE 216

Query: 400 KLCNPFVRTFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
           +L NPF+RT    +++  +      +        A+R  KD F
Sbjct: 217 RLTNPFLRTAETLVKQKADEWKGHSNNSHVAVFAALRSWKDTF 259



 Score = 39.7 bits (91), Expect(2) = 1e-17
 Identities = 15/27 (55%), Positives = 22/27 (81%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GDTLF+  CG++FEGTP+QM  +L +
Sbjct: 131 SGDTLFAAGCGRMFEGTPEQMQPALAR 157



>gb:AE016755_324308 Escherichia coli CFT073 section 1 of 18 of the
           complete genome.>gb:AE014075_954892 Escherichia coli
           CFT073 complete genome.
          Length = 251

 Score = 69.3 bits (168), Expect(2) = 1e-17
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+DT + C HEYTLSN KFALSI P +  +  Y  ++  LR K   T+P  L+ E
Sbjct: 151 KLSALPDDTLVCCAHEYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKA-IRQAKDNF 281
           +  N F+RT  +++   +N        E   A +R  KD F
Sbjct: 211 RQINVFLRTEDIDLINVINEETLLQQPEERFAWLRSKKDRF 251



 Score = 42.4 bits (98), Expect(2) = 1e-17
 Identities = 18/26 (69%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGTP QM  S++K
Sbjct: 126 GDTLFSGGCGRLFEGTPSQMYQSIKK 151



>gb:AJ720961_2503148 Gallus gallus mRNA for hypothetical protein,
           clone 31d24.
          Length = 310

 Score = 72.0 bits (175), Expect(2) = 2e-17
 Identities = 37/96 (38%), Positives = 52/96 (54%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           L  +T +YCGHEYT++N KFA  +EP N  +Q   A        G PTIP+T+ +E   N
Sbjct: 213 LDPETRVYCGHEYTINNLKFARHVEPNNVSIQEKLAWAKAKYDSGEPTIPSTIAEEFTYN 272

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R     +++        D    + AIR+ KDNF
Sbjct: 273 PFMRVREKTVQEHAG---ETDPIRTMGAIRKEKDNF 305



 Score = 39.3 bits (90), Expect(2) = 2e-17
 Identities = 16/25 (64%), Positives = 19/25 (76%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK FEGTP++M  +L
Sbjct: 182 TGDTLFVAGCGKFFEGTPEEMYRAL 206



>gb:BX321856_772466 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 1/10.
          Length = 262

 Score = 74.3 bits (181), Expect(2) = 2e-17
 Identities = 38/99 (38%), Positives = 56/99 (56%), Gaps = 3/99 (3%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP++T +YC HEYTL N +FA +I+P N EL    + +   R++ +PT+P++L  EK  N
Sbjct: 156 LPDETQVYCAHEYTLDNIRFARAIDPDNPELIELESNVEEKREQNMPTLPSSLAAEKATN 215

Query: 388 PFVRTFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
           PF+R     I +S +        D      AIR  K+NF
Sbjct: 216 PFLRCNQPAIIQSASRYAGRQLTDPVSVFAAIRDWKNNF 254



 Score = 37.0 bits (84), Expect(2) = 2e-17
 Identities = 15/26 (57%), Positives = 19/26 (73%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG++FEG   QM  SL+K
Sbjct: 127 GDTLFACGCGRIFEGNAQQMFDSLQK 152



>gb:AE008707_241990 Salmonella typhimurium LT2, section 15 of 220 of
           the complete genome.>gb:AE006468_999072 Salmonella
           typhimurium LT2, complete genome.
          Length = 251

 Score = 69.3 bits (168), Expect(2) = 2e-17
 Identities = 40/101 (39%), Positives = 56/101 (55%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP+DT I C HEYTL+N KFALSI P +  +  Y  ++  LR K   T+P  L+ E
Sbjct: 151 KINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKA-IRQAKDNF 281
           +  N F+RT  +++   +N        EA  A +R  KD F
Sbjct: 211 RKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDTF 251



 Score = 42.0 bits (97), Expect(2) = 2e-17
 Identities = 19/26 (73%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGTP QM  SL K
Sbjct: 126 GDTLFSGGCGRLFEGTPSQMYQSLMK 151



>gb:CP000026_77266 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 251

 Score = 69.3 bits (168), Expect(2) = 2e-17
 Identities = 40/101 (39%), Positives = 56/101 (55%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP+DT I C HEYTL+N KFALSI P +  +  Y  ++  LR K   T+P  L+ E
Sbjct: 151 KINSLPDDTLICCAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKA-IRQAKDNF 281
           +  N F+RT  +++   +N        EA  A +R  KD F
Sbjct: 211 RKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDTF 251



 Score = 42.0 bits (97), Expect(2) = 2e-17
 Identities = 19/26 (73%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGTP QM  SL K
Sbjct: 126 GDTLFSGGCGRLFEGTPSQMYQSLMK 151



>gb:AE016914_356215 Chromobacterium violaceum ATCC 12472 section 5
           of 16 of the complete genome.>gb:AE016825_1041369
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 260

 Score = 63.5 bits (153), Expect(2) = 4e-17
 Identities = 31/74 (41%), Positives = 48/74 (64%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T +Y  HEYTLSN +FAL+ +  N  L    ++ + LR +GLPT+P+T+  E   N
Sbjct: 161 LPPNTKVYPAHEYTLSNLRFALAADQHNPILAMRHSRDSALRDRGLPTLPSTIALETASN 220

Query: 388 PFVRTFSMEIRKSL 347
           PF+R+    +R++L
Sbjct: 221 PFLRSGEPALREAL 234



 Score = 46.6 bits (109), Expect(2) = 4e-17
 Identities = 20/26 (76%), Positives = 23/26 (88%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG+LFEGTP QMLASL+K
Sbjct: 132 GDTLFAAGCGRLFEGTPGQMLASLKK 157



>sp|Q47677|GLO2_ECOLI Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>pir|F64745|F64745
           probable hydroxyacylglutathione hydrolase (EC 3.1.2.6)
           gloB - Escherichia coli (strain K-12)>pir|H90654|H90654
           probable hydroxyacylglutathione hydrolase [imported] -
           Escherichia coli (strain O157:H7, substrain RIMD
           0509952)>pir|H85505|H85505 probable
           hydroxyacylglutathione hydrolase [imported] -
           Escherichia coli (strain O157:H7, substrain
           EDL933)>gb:AE005174_64441 Escherichia coli O157:H7
           EDL933, complete genome.>gb:ECOTSF_130498 Escherichia
           coli genomic DNA. (4.1 - 6.1 min).>gb:ECU70214_134386
           Escherichia coli chromosome minutes
           4-6.>gb:U00096_199313 Escherichia coli K-12 MG1655
           complete genome.>gb:BA000007_658220 Escherichia coli
           O157:H7 DNA, complete genome.
          Length = 251

 Score = 69.3 bits (168), Expect(2) = 7e-17
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+DT + C HEYTLSN KFALSI P +  +  Y  ++  LR K   T+P  L+ E
Sbjct: 151 KLSALPDDTLVCCAHEYTLSNMKFALSILPHDLSINDYYRKVKELRAKNQITLPVILKNE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKA-IRQAKDNF 281
           +  N F+RT  +++   +N        E   A +R  KD F
Sbjct: 211 RQINVFLRTEDIDLINVINEETLLQQPEERFAWLRSKKDRF 251



 Score = 40.0 bits (92), Expect(2) = 7e-17
 Identities = 18/26 (69%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGT  QM  SL+K
Sbjct: 126 GDTLFSGGCGRLFEGTASQMYQSLKK 151



>gb:AJ719602_2501789 Gallus gallus mRNA for hypothetical protein,
           clone 4h5.
          Length = 282

 Score = 77.8 bits (190), Expect(2) = 9e-17
 Identities = 38/96 (39%), Positives = 57/96 (59%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++CGHE T+ N KFAL +EP N+ ++   A       + LPT+P+TL++E L N
Sbjct: 163 LPKETKVFCGHECTVRNLKFALKVEPENEAVKKKLAWARQRDDEDLPTVPSTLQEEFLYN 222

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R     ++K        +  E L+A+R  KDNF
Sbjct: 223 PFLRVTEEAVQK---FTGRKEPVEVLRALRTEKDNF 255



 Score = 31.2 bits (69), Expect(2) = 9e-17
 Identities = 13/25 (52%), Positives = 17/25 (68%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           +GDTLF   CG+  EGT +QM  +L
Sbjct: 132 SGDTLFVGGCGQFLEGTAEQMYTNL 156



>pir|G83417|G83417 probable hydroxyacylglutathione hydrolase PA1813
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004608_56049 Pseudomonas aeruginosa PAO1,
           section 169 of 529 of the complete
           genome.>gb:AE004091_970149 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 258

 Score = 70.1 bits (170), Expect(2) = 9e-17
 Identities = 36/103 (34%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP +T +YC HEYTLSN +FAL++EP N  L+    + T LR++   T+P+ +  E
Sbjct: 156 RLAALPANTRVYCTHEYTLSNLRFALAVEPDNAALRERFEEATRLRERDRITLPSEISLE 215

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADD---AEALKAIRQAKDNF 281
              NPF+R     ++K  +      +    E    +R  KD F
Sbjct: 216 LSTNPFLRVSENSVKKKADQRSGQQNRTPEEVFAVLRAWKDQF 258



 Score = 38.9 bits (89), Expect(2) = 9e-17
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF+  CG+LFEGTP QM  SL +
Sbjct: 131 GDTLFAAGCGRLFEGTPAQMHHSLAR 156



>gb:AE014296_1137245 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003592_1216944 Drosophila melanogaster
           chromosome 3L, section 73 of 83 of the complete
           sequence.
          Length = 348

 Score = 70.9 bits (172), Expect(2) = 1e-16
 Identities = 34/100 (34%), Positives = 55/100 (55%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+ T ++CGHEYTL N  FA  +EP N+ +Q       + R    PT+P+T+ +E
Sbjct: 249 KLSALPDATKVFCGHEYTLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEE 308

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R     ++K  +   + D    +  +R+ KD F
Sbjct: 309 KSWNPFMRVHEATVQK--HAGGATDPVVTMGKLRKEKDTF 346



 Score = 37.7 bits (86), Expect(2) = 1e-16
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CG+ FEGTP++M  +L
Sbjct: 222 TGDTLFQGGCGRFFEGTPEEMYEAL 246



>gb:AE014296_1137246 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003592_1216945 Drosophila melanogaster
           chromosome 3L, section 73 of 83 of the complete
           sequence.>gb:AY061337_1293140 Drosophila melanogaster
           LD26447 full length cDNA.
          Length = 305

 Score = 70.9 bits (172), Expect(2) = 1e-16
 Identities = 34/100 (34%), Positives = 55/100 (55%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+ T ++CGHEYTL N  FA  +EP N+ +Q       + R    PT+P+T+ +E
Sbjct: 206 KLSALPDATKVFCGHEYTLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEE 265

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R     ++K  +   + D    +  +R+ KD F
Sbjct: 266 KSWNPFMRVHEATVQK--HAGGATDPVVTMGKLRKEKDTF 303



 Score = 37.7 bits (86), Expect(2) = 1e-16
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CG+ FEGTP++M  +L
Sbjct: 179 TGDTLFQGGCGRFFEGTPEEMYEAL 203



>gb:AE014296_1137247 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003592_1216946 Drosophila melanogaster
           chromosome 3L, section 73 of 83 of the complete
           sequence.
          Length = 271

 Score = 70.9 bits (172), Expect(2) = 1e-16
 Identities = 34/100 (34%), Positives = 55/100 (55%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+ T ++CGHEYTL N  FA  +EP N+ +Q       + R    PT+P+T+ +E
Sbjct: 172 KLSALPDATKVFCGHEYTLQNMSFARHVEPDNEVIQQRIEWAKHRRASQDPTVPSTIGEE 231

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R     ++K  +   + D    +  +R+ KD F
Sbjct: 232 KSWNPFMRVHEATVQK--HAGGATDPVVTMGKLRKEKDTF 269



 Score = 37.7 bits (86), Expect(2) = 1e-16
 Identities = 15/25 (60%), Positives = 19/25 (76%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CG+ FEGTP++M  +L
Sbjct: 145 TGDTLFQGGCGRFFEGTPEEMYEAL 169



>gb:AE005674_69780 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016978_370188 Shigella flexneri 2a str.
           2457T section 1 of 16 of the complete
           genome.>gb:AE014073_994938 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 251

 Score = 70.1 bits (170), Expect(2) = 1e-16
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP+DT + C HEYTLSN KFALSI P +  +  Y  ++  LR K   T+P  L+ E
Sbjct: 151 KLSALPDDTLVCCAHEYTLSNMKFALSIFPHDLSINDYYRKVKELRAKNQITLPVILKNE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKA-IRQAKDNF 281
           +  N F+RT  +++   +N        E   A +R  KD F
Sbjct: 211 RQINVFLRTEDIDLINGINEETLLQQPEERFAWLRSKKDRF 251



 Score = 38.5 bits (88), Expect(2) = 1e-16
 Identities = 18/26 (69%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGT  QM  SL+K
Sbjct: 126 GDTLFSGGCGRLFEGTALQMYQSLKK 151



>gb:AE013598_294740 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 149

 Score = 67.8 bits (164), Expect(2) = 1e-16
 Identities = 36/103 (34%), Positives = 56/103 (54%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP +T + CGHEYTL+N+ FAL ++  N  LQ    +   +R    PT+P +L+ E
Sbjct: 45  RLACLPGETLVCCGHEYTLANAAFALHVDSTNAALQRRQQEAQAMRHAARPTLPISLKSE 104

Query: 400 KLCNPFVRTFSMEIRKSLNIPDS---ADDAEALKAIRQAKDNF 281
              NPF+RT   EIR  +    +   + + +    +R+ KD F
Sbjct: 105 LATNPFLRTNRPEIRAVVAARAAGALSSEVDVFAELRRWKDEF 147



 Score = 40.8 bits (94), Expect(2) = 1e-16
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GDTLFSL CG++FEGT  QM  SL++
Sbjct: 19  SGDTLFSLGCGRMFEGTAPQMFDSLQR 45



>gb:PFMAL4P1_1394706 Plasmodium falciparum MAL4P1.
          Length = 272

 Score = 75.1 bits (183), Expect(2) = 2e-16
 Identities = 38/100 (38%), Positives = 62/100 (62%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  +  +T IYCGHEYTL+N +FALSIE  N+ +++   ++T   K    ++P+T+E+E
Sbjct: 178 KVKNMRKETLIYCGHEYTLNNLRFALSIENDNEYMKNKLNEVTEKLKNKEHSVPSTIEEE 237

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
            L NPF RT     + ++N     D+ + L  +RQ K+NF
Sbjct: 238 NLINPFFRTHCYVNKFNMN-----DEIKILDKLRQLKNNF 272



 Score = 33.1 bits (74), Expect(2) = 2e-16
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF   CG+ FEG+   M  ++ K
Sbjct: 152 TGDTLFIAGCGRFFEGSAKDMFKNIEK 178



>gb:AY494055_1330611 Plasmodium falciparum 3D7 glyoxalase IIB
           (glxIIb) mRNA, complete cds.
          Length = 263

 Score = 75.1 bits (183), Expect(2) = 2e-16
 Identities = 38/100 (38%), Positives = 62/100 (62%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  +  +T IYCGHEYTL+N +FALSIE  N+ +++   ++T   K    ++P+T+E+E
Sbjct: 169 KVKNMRKETLIYCGHEYTLNNLRFALSIENDNEYMKNKLNEVTEKLKNKEHSVPSTIEEE 228

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
            L NPF RT     + ++N     D+ + L  +RQ K+NF
Sbjct: 229 NLINPFFRTHCYVNKFNMN-----DEIKILDKLRQLKNNF 263



 Score = 33.1 bits (74), Expect(2) = 2e-16
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF   CG+ FEG+   M  ++ K
Sbjct: 143 TGDTLFIAGCGRFFEGSAKDMFKNIEK 169



>gb:BA000045_743414 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 252

 Score = 73.6 bits (179), Expect(2) = 2e-16
 Identities = 35/101 (34%), Positives = 58/101 (57%)
 Frame = -2

Query: 583 GRIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEK 404
           GR+  LP +T ++C HEYTL N +FA ++EP N EL      +  LR + + T+P+T+  
Sbjct: 155 GRLRELPGETQVWCAHEYTLGNLRFAHTLEPDNAELAERLRTVEVLRARKIATVPSTMAA 214

Query: 403 EKLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           E+  NPF+R  S +++++     + +  E    +R  KD F
Sbjct: 215 ERATNPFLRWESRQLQRAAG---AIEPEEVFAHLRALKDRF 252



 Score = 34.7 bits (78), Expect(2) = 2e-16
 Identities = 16/24 (66%), Positives = 18/24 (75%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLF+  CG+LFEGT  QM  SL
Sbjct: 131 GDTLFAGGCGRLFEGTARQMQHSL 154



>sp|Q28333|GLO2_CALJA Hydroxyacylglutathione hydrolase (EC 3.1.2.6)
           (Glyoxalase II) (Glx II) (Germ cell specific
           protein).>gb:CJGCS_1992368 C.jacchus mRNA for germ cell
           specific protein.
          Length = 260

 Score = 71.2 bits (173), Expect(2) = 2e-16
 Identities = 35/95 (36%), Positives = 51/95 (53%)
 Frame = -2

Query: 565 PNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCNP 386
           P DT +YCGHEYT++N KFA  +E GN  +Q   A        G P +P+TL +E   NP
Sbjct: 164 PPDTRVYCGHEYTINNLKFARHVESGNAAVQEKLAWAKEKYSIGEPAVPSTLAEEFTYNP 223

Query: 385 FVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           F+R     +++        D    ++A+R+ KD F
Sbjct: 224 FMRVREKTVQQHAG---ETDPVPTMRAVRREKDQF 255



 Score = 36.6 bits (83), Expect(2) = 2e-16
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CGK +EGT D+M  +L
Sbjct: 132 TGDTLFVAGCGKFYEGTADEMCKAL 156



>gb:AE016960_367561 Coxiella burnetii strain RSA 493, section 1 of 7
           of the complete genome.>gb:AE016828_1008297 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 257

 Score = 66.6 bits (161), Expect(2) = 2e-16
 Identities = 34/95 (35%), Positives = 52/95 (54%), Gaps = 3/95 (3%)
 Frame = -2

Query: 556 TNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCNPFVR 377
           T +YCGHEYT+ N +FA ++EP N +L+    +      + LPT+P+TL+ E   NPF+R
Sbjct: 163 TRVYCGHEYTVKNLEFAETVEPDNPKLKQRIVETGQKASQNLPTLPSTLQVELDTNPFLR 222

Query: 376 TFSMEIRKSLNI---PDSADDAEALKAIRQAKDNF 281
                I++ +        AD      A+R+ KD F
Sbjct: 223 CHQKNIQRRVQEYCGYPLADTVAVFSALRRWKDEF 257



 Score = 41.2 bits (95), Expect(2) = 2e-16
 Identities = 17/27 (62%), Positives = 22/27 (81%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF+  CG++FEG+PDQ   SL+K
Sbjct: 129 TGDTLFAGGCGRIFEGSPDQFYHSLQK 155



>gb:CR555306_109101 Azoarcus sp. EbN1 complete genome.
          Length = 263

 Score = 72.0 bits (175), Expect(2) = 3e-16
 Identities = 40/103 (38%), Positives = 53/103 (51%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP DT +YC HEYTL+N  FA   +PGN E   +  +    R  G PT+PTT+ +E
Sbjct: 161 RLADLPGDTAVYCTHEYTLANLAFARVADPGNPERDEWLVECEARRDAGRPTLPTTIARE 220

Query: 400 KLCNPFVRTFS---MEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           +  NPF+RT     M +          D  E   A+R  KD F
Sbjct: 221 RRVNPFLRTGEPAVMGVIADRTGVRPRDSLECFAALRAWKDVF 263



 Score = 35.4 bits (80), Expect(2) = 3e-16
 Identities = 16/26 (61%), Positives = 19/26 (73%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+L  GT  Q+ ASLR+
Sbjct: 136 GDTLFSAGCGRLLGGTAAQLHASLRR 161



>pir|AC0534|AC0534 probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)>gb:AE016842_346636
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           section 9 of 16 of the complete
           genome.>gb:AL627266_540586 Salmonella enterica serovar
           Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 2/20.>gb:AE014613_983968 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.
          Length = 251

 Score = 65.5 bits (158), Expect(2) = 3e-16
 Identities = 39/101 (38%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP+DT I   HEYTL+N KFALSI P +  +  Y  ++  LR K   T+P  L+ E
Sbjct: 151 KINSLPDDTLICSAHEYTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKA-IRQAKDNF 281
           +  N F+RT  +++   +N        EA  A +R  KD F
Sbjct: 211 RKINLFLRTEDIDLINEINKETILQQPEARFAWLRSKKDTF 251



 Score = 42.0 bits (97), Expect(2) = 3e-16
 Identities = 19/26 (73%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGTP QM  SL K
Sbjct: 126 GDTLFSGGCGRLFEGTPSQMYQSLMK 151



>gb:CR543861_104320 Acinetobacter sp. ADP1 complete genome.
          Length = 244

 Score = 70.5 bits (171), Expect(2) = 6e-16
 Identities = 31/73 (42%), Positives = 49/73 (67%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP  T +YC HEYTL+N++FA+++EP N  L+    ++ +LR +   T+P+T+  E
Sbjct: 160 RLAALPTTTKVYCTHEYTLANAEFAVTVEPDNLALKERLKEVQSLRSRHQITLPSTIALE 219

Query: 400 KLCNPFVRTFSME 362
              NPF+RT S+E
Sbjct: 220 LATNPFLRTESVE 232



 Score = 35.8 bits (81), Expect(2) = 6e-16
 Identities = 14/26 (53%), Positives = 21/26 (80%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF++ CG++FEG+ +QM  SL +
Sbjct: 135 GDTLFAMGCGRVFEGSFEQMYHSLNR 160



>sp|Q26547|GLO2_SCHMA Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>gb:SMU30264_1397848
           Schistosoma mansoni trans-spliced mRNA, clone SL cDNA-6,
           complete cds.
          Length = 240

 Score = 70.5 bits (171), Expect(2) = 8e-16
 Identities = 34/96 (35%), Positives = 53/96 (55%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP  T +YCGHEYT+ N +F L++EP N+ L+     +  LR     ++P T+ +E   N
Sbjct: 148 LPTTTKVYCGHEYTVKNLEFGLTVEPKNEALKHRLEAVKRLRASNQASVPGTIGEELATN 207

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           P +R    ++   L    + D  +A+K IR+ KD F
Sbjct: 208 PLMRVSEPDV---LAHAKTTDPIKAMKTIREEKDRF 240



 Score = 35.4 bits (80), Expect(2) = 8e-16
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF   CG+ FEGT +QM  +L
Sbjct: 117 TGDTLFLGGCGRFFEGTAEQMFKAL 141



>sp|P05446|GLO2_RHOBL Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>pir|S04668|S04668
           hypothetical protein 3 - Rhodopseudomonas
           blastica>gb:RBATP_162365 R.blasticus atp operon coding
           for the 5 subunits of F1-ATPase and 8URFs.
          Length = 255

 Score = 65.5 bits (158), Expect(2) = 1e-15
 Identities = 35/100 (35%), Positives = 57/100 (57%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           ++  LP +T I  GH+Y   N +FAL++EPGN  L S   +++ +R++G   +P TL +E
Sbjct: 157 KLAALPPETLICSGHDYLDGNLRFALALEPGNPALISRQGRLSEMRREGRLPMPWTLAEE 216

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
              NPF+R    +++ ++ +P  A D      IR  KD F
Sbjct: 217 LATNPFLRAPLPQMKAAVGLP-QASDTVVFAEIRARKDLF 255



 Score = 39.7 bits (91), Expect(2) = 1e-15
 Identities = 17/27 (62%), Positives = 21/27 (77%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGD+L +  CG+LFEGTP +M ASL K
Sbjct: 131 TGDSLMAAGCGRLFEGTPAEMWASLSK 157



>gb:BX248584_763839 Blochmannia floridanus complete genome; segment
           1/3.
          Length = 256

 Score = 77.4 bits (189), Expect(2) = 3e-15
 Identities = 43/99 (43%), Positives = 61/99 (61%), Gaps = 1/99 (1%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP +T IY GHEYTL N  FA+SI P +  + +Y  +IT + KK     PTTL+ E
Sbjct: 152 KIQCLPKNTLIYSGHEYTLLNLNFAISILPQDTLIINYLKKITKVLKKNKLLQPTTLQLE 211

Query: 400 KLCNPFVRTFSMEIRKSLNI-PDSADDAEALKAIRQAKD 287
              NPF+R   + I+KSLN+ P   ++ + L+A+R  KD
Sbjct: 212 LKINPFLRCNDINIQKSLNLFPKPGEEWKILQALRNKKD 250



 Score = 26.6 bits (57), Expect(2) = 3e-15
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GDT+FS  CG +  G    M  SL K
Sbjct: 126 SGDTIFSAGCGTIQTGYTQAMYKSLLK 152



>gb:BA000039_727423 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 252

 Score = 65.1 bits (157), Expect(2) = 4e-15
 Identities = 30/64 (46%), Positives = 40/64 (62%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++C HEYT  N  FAL++E  N  LQ   AQ+   R +G  TIP+T+  EK  N
Sbjct: 160 LPEETRVWCAHEYTQKNLSFALTVEADNPTLQERYAQVCRDRAQGKATIPSTIGLEKATN 219

Query: 388 PFVR 377
           PF+R
Sbjct: 220 PFLR 223



 Score = 38.5 bits (88), Expect(2) = 4e-15
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF   CG+LFEG+P QML SL +
Sbjct: 131 GDTLFGGGCGRLFEGSPAQMLDSLNQ 156



>gb:CR628336_111373 Legionella pneumophila str. Paris complete
           genome.
          Length = 254

 Score = 67.4 bits (163), Expect(2) = 3e-14
 Identities = 34/98 (34%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++C HEYTL N KFA ++EP N  + +Y  QI  L++    T+P+ ++ E   N
Sbjct: 158 LPRNTKVFCAHEYTLQNLKFAHTVEPCNSSVINYMQQI--LKQPSPCTLPSNIDLELSIN 215

Query: 388 PFVRTFSMEIRKSL--NIPDSADDAEALKAIRQAKDNF 281
           PF+RT   ++++    +  +S+D  +  K +R  K++F
Sbjct: 216 PFLRTDKEQVKQYALSHGANSSDSLDVFKVLRNQKNSF 253



 Score = 33.1 bits (74), Expect(2) = 3e-14
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLFS  CG++F+GT +++  SL
Sbjct: 129 GDTLFSAGCGRVFDGTIEELHESL 152



>pir|T26496|T26496 hypothetical protein Y17G7B.3 - Caenorhabditis
           elegans>gb:CEY17G7B_1369483 Caenorhabditis elegans YAC
           Y17G7B, complete sequence.
          Length = 260

 Score = 64.7 bits (156), Expect(2) = 6e-14
 Identities = 36/97 (37%), Positives = 57/97 (58%), Gaps = 1/97 (1%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T I+ GHEYT++N KFA  +EPGN++            ++G  T+P+T+ +EK  N
Sbjct: 167 LPVETQIFPGHEYTVANLKFACHVEPGNEKAAQKLEWAQRQIEQGGFTVPSTVAEEKATN 226

Query: 388 PFVRT-FSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+R   S EI+KS+    + D    +  +R+ K+ F
Sbjct: 227 PFMRVRESEEIQKSIG---TCDAVVGMAKLREMKNKF 260



 Score = 34.7 bits (78), Expect(2) = 6e-14
 Identities = 15/27 (55%), Positives = 18/27 (66%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF   CG+ FEGT  QM  +L +
Sbjct: 136 TGDTLFIAGCGRFFEGTAPQMDVALNE 162



>gb:AE017354_459664 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 254

 Score = 66.2 bits (160), Expect(2) = 6e-14
 Identities = 33/98 (33%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++C HEYT  N KFA ++EP N  + +Y  QI  L++    T+P+ ++ E   N
Sbjct: 158 LPRNTKVFCAHEYTFQNLKFAHTVEPCNSSVINYMQQI--LKQPSSCTLPSNIDLELSIN 215

Query: 388 PFVRTFSMEIRKSL--NIPDSADDAEALKAIRQAKDNF 281
           PF+RT   ++++    +  +S+D  +  K +R  K++F
Sbjct: 216 PFLRTDKEQVKQYALSHGANSSDSLDVFKVLRNQKNSF 253



 Score = 33.1 bits (74), Expect(2) = 6e-14
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLFS  CG++F+GT +++  SL
Sbjct: 129 GDTLFSAGCGRVFDGTIEELHESL 152



>gb:CR628337_114460 Legionella pneumophila str. Lens complete
           genome.
          Length = 254

 Score = 66.2 bits (160), Expect(2) = 6e-14
 Identities = 34/98 (34%), Positives = 59/98 (60%), Gaps = 2/98 (2%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T I+C HEYTL N KFA ++EP N  + +Y  QI  L++    T+P+ ++ E   N
Sbjct: 158 LPRNTKIFCAHEYTLQNLKFAHTVEPCNSSVINYMQQI--LKQPSPCTLPSNIDLELSIN 215

Query: 388 PFVRTFSMEIRKSL--NIPDSADDAEALKAIRQAKDNF 281
           PF+RT   ++++    +  +S+D  +  + +R  K++F
Sbjct: 216 PFLRTDKEQVKQYALSHGANSSDSLDVFEVLRNQKNSF 253



 Score = 33.1 bits (74), Expect(2) = 6e-14
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLFS  CG++F+GT +++  SL
Sbjct: 129 GDTLFSAGCGRVFDGTIEELHESL 152



>gb:BA000021_686813 Wigglesworthia glossinidia endosymbiont of
           Glossina brevipalpis DNA, complete genome.
          Length = 251

 Score = 61.6 bits (148), Expect(2) = 2e-13
 Identities = 35/102 (34%), Positives = 52/102 (50%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  LP +T I  GHEYTL N  FA+S+ P N  L  Y  ++  L     PT+P+ L  E
Sbjct: 150 KINSLPPNTLICAGHEYTLQNLNFAISVFPKNTILSMYKKKVEKLNFYKKPTLPSALYLE 209

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF*Y 275
           +  N F+  ++ E +  L      ++    K +R  K+NF Y
Sbjct: 210 RQINIFLNPYNFEFKGELKRLLLQEEWVLFKKLRDMKNNFIY 251



 Score = 36.2 bits (82), Expect(2) = 2e-13
 Identities = 15/26 (57%), Positives = 19/26 (73%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEG+   M  S++K
Sbjct: 125 GDTLFSAGCGRLFEGSAKDMYFSIKK 150



>gb:CP000009_862307 Gluconobacter oxydans 621H, complete genome.
          Length = 259

 Score = 60.8 bits (146), Expect(2) = 9e-13
 Identities = 34/96 (35%), Positives = 48/96 (50%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP+ T +  GHEYT SN  FAL ++P N  L++ A +I  L + G PT+P +L  E+  N
Sbjct: 179 LPDQTLVCAGHEYTRSNLAFALHVDPDNAALKARAGEIEQLLEAGRPTLPVSLGVERRTN 238

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           PF+                A D      +R+ KD F
Sbjct: 239 PFL---------------LAPDVATFARLRREKDTF 259



 Score = 34.7 bits (78), Expect(2) = 9e-13
 Identities = 14/26 (53%), Positives = 18/26 (69%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFSL CG+L EGT  ++  SL +
Sbjct: 150 GDVLFSLGCGRLLEGTAQELFDSLHR 175



>gb:AX394700_1466917 Sequence 1 from Patent
           WO0218559.>gb:AX394702_1466918 Sequence 3 from Patent
           WO0218559.>gb:BC004353_1969198 Homo sapiens
           hydroxyacylglutathione hydrolase-like, transcript
           variant 2, mRNA (cDNA clone MGC:2605 IMAGE:3351990),
           complete cds.
          Length = 282

 Score = 70.1 bits (170), Expect(2) = 1e-12
 Identities = 34/86 (39%), Positives = 52/86 (60%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++CGHE+TLSN +FA  +EP N  +++  +      +  +PT+P+TL +E+L N
Sbjct: 162 LPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRAKLSWAKKRDEDDVPTVPSTLGEERLYN 221

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEAL 311
           PF+R     +RK       AD  EAL
Sbjct: 222 PFLRVAEEPVRKFTGKAVPADVLEAL 247



 Score = 25.0 bits (53), Expect(2) = 1e-12
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           +GD L    CG   EG+  QM  SL
Sbjct: 132 SGDALSVAGCGSCLEGSAQQMYQSL 156



>gb:AE017162_395018 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030687 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 253

 Score = 53.1 bits (126), Expect(2) = 2e-12
 Identities = 26/68 (38%), Positives = 41/68 (60%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           RI  LP +T IYC HEYT +N ++A SI P +  ++    ++   + KG  +IP+ L +E
Sbjct: 167 RINNLPKNTKIYCAHEYTEANLRWAKSIFPEDIYIEERLKEVILRKSKGFLSIPSKLSEE 226

Query: 400 KLCNPFVR 377
           +  N F+R
Sbjct: 227 RKTNLFIR 234



 Score = 41.2 bits (95), Expect(2) = 2e-12
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF   CG+LFEGTP+QM  SL +
Sbjct: 142 GDTLFGAGCGRLFEGTPEQMFNSLSR 167



>sp|Q08889|GLO2_BUCAP Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>pir|I40592|I40592
           hypothetical protein 1 - Buchnera
           aphidicola>gb:AE014100_303157 Buchnera aphidicola str.
           Sg (Schizaphis graminum) section 25 of 57 of the
           complete genome.>gb:BUHRDSA_757281 Buchnera aphidicola
           Arginyl tRNA synthetase (argS) gene, 5' end; ORF1;
           ribonuclease H (rnh) gene, complete cds; DNA Polymerase
           III epsilon subunit (dnaQ or mutD) gene, 5' end;
           complete 16S ribosomal RNA gene, promoter
           region.>gb:AE013218_935135 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 250

 Score = 68.2 bits (165), Expect(2) = 4e-12
 Identities = 35/99 (35%), Positives = 55/99 (55%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEK 398
           I  LP  T + C HEYTLSN  FA+SI P +++++ Y  +I     +   ++P +LE EK
Sbjct: 152 IKSLPKKTILCCSHEYTLSNLNFAMSILPFDKKIKKYYKKIKKHISQNKTSLPVSLETEK 211

Query: 397 LCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
             N F+RT    I+K++ +       E    +R+ KD+F
Sbjct: 212 KINIFLRTNEKTIKKAMGLKKDTSSFEVFILLRKEKDDF 250



 Score = 25.0 bits (53), Expect(2) = 4e-12
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASL 585
           GDTLFS  CG++F+     M  S+
Sbjct: 126 GDTLFSGGCGRVFKNKFFDMYQSI 149



>gb:AE014188_967867 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014845_1229259 Plasmodium
           falciparum 3D7 chromosome 12, section 2 of 9 of the
           complete sequence.>gb:AF486285_1276072 Plasmodium
           falciparum glyoxalase II (glxII) mRNA, complete cds.
          Length = 322

 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 6/96 (6%)
 Frame = -2

Query: 550 IYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCNPFVRTF 371
           I+CGHEYTL N KFAL+++  N+ L S+   + N   K  PT+PT LE E L NPF+R  
Sbjct: 225 IFCGHEYTLDNLKFALTVDSTNKNLLSFYDHVVN-SNKNYPTVPTLLEHEYLYNPFLRCD 283

Query: 370 SMEIRKSLNIPDS------ADDAEALKAIRQAKDNF 281
             ++RKS+++           +++ +  +R  KDNF
Sbjct: 284 QNDVRKSIDLYAKKKNIKIQQESDYIVILRLMKDNF 319



>gb:BX572091_796185 Prochlorococcus marinus MED4 complete genome;
           segment 2/5.
          Length = 246

 Score = 54.7 bits (130), Expect(2) = 7e-12
 Identities = 29/73 (39%), Positives = 42/73 (57%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           RI  LP +T IYC HEYT SN  +AL +EP NQ +++   ++         TIP  LE+E
Sbjct: 161 RIKSLPKNTLIYCAHEYTKSNLLWALDLEPENQNIKNKLIEVEKKIALKELTIPCLLEEE 220

Query: 400 KLCNPFVRTFSME 362
              N F+R  +++
Sbjct: 221 MKINLFLRADNLK 233



 Score = 37.7 bits (86), Expect(2) = 7e-12
 Identities = 16/26 (61%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG++FEGT  QM  SL++
Sbjct: 136 GDTLFSAGCGRIFEGTYKQMYYSLKR 161



>sp|P57336|GLO2_BUCAI Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (GLX II).>pir|F84958|F84958
           probable hydroxyacylglutathione hydrolase (EC 3.1.2.6)
           [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653612 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 251

 Score = 63.9 bits (154), Expect(2) = 9e-12
 Identities = 34/97 (35%), Positives = 54/97 (55%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEK 398
           I  LP+ T + C HEYTLSN +F++ I P +  ++ Y  +I    K G  ++P+ +  EK
Sbjct: 152 ISSLPDSTLLCCSHEYTLSNLQFSMFILPNDNFIKLYLKKIEIKLKLGQSSLPSYIFFEK 211

Query: 397 LCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKD 287
             N F+RT    ++KS+ +  +  D E  K +R  KD
Sbjct: 212 KINLFLRTNDNYVKKSIGLKSTCTDFEVFKRLRLKKD 248



 Score = 28.1 bits (61), Expect(2) = 9e-12
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLR 582
           GDTLFS  CG++F+    +M  S++
Sbjct: 126 GDTLFSAGCGRVFKNKHLEMYRSIK 150



>gb:AE017344_1756207 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 274

 Score = 50.8 bits (120), Expect(2) = 1e-11
 Identities = 29/92 (31%), Positives = 49/92 (53%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP DT +Y GHEYT  ++KF L+IEP NQ L+    +  N       T  +T+  EK  N
Sbjct: 185 LPEDTIVYNGHEYTKGSAKFGLTIEPDNQHLKELLKKAEN---DSCTTGKSTIGDEKNWN 241

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQA 293
            F+R  + + +++    ++ +    L+ ++ A
Sbjct: 242 VFMRLDTPQAKQATGKTEAVEIMGRLREMKNA 273



 Score = 40.8 bits (94), Expect(2) = 1e-11
 Identities = 17/27 (62%), Positives = 21/27 (77%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF   CG+ FEGTP++M A+L K
Sbjct: 155 TGDTLFLAGCGRFFEGTPEEMHAALTK 181



>gb:BX572098_798536 Prochlorococcus marinus MIT9313 complete genome;
           segment 4/7.
          Length = 260

 Score = 53.9 bits (128), Expect(2) = 3e-11
 Identities = 23/71 (32%), Positives = 44/71 (61%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP  T +YC HEYT +N ++A ++ P +  +    A +++ R++G  ++P+++ +E
Sbjct: 174 RLSCLPAKTRVYCAHEYTEANLRWASALHPEDVAISERLADVSSRRQRGALSLPSSISEE 233

Query: 400 KLCNPFVRTFS 368
           +  N FVR  S
Sbjct: 234 QRTNLFVRAQS 244



 Score = 36.2 bits (82), Expect(2) = 3e-11
 Identities = 14/26 (53%), Positives = 19/26 (73%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLF   CG+LFEGT + M  +L++
Sbjct: 149 GDTLFGAGCGRLFEGTAEDMFKALQR 174



>pir|H81017|H81017 hydroxyacylglutathione hydrolase NMB1997
           [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002549_47379 Neisseria meningitidis
           serogroup B strain MC58 section 191 of 206 of the
           complete genome.>gb:AE002098_897492 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 252

 Score = 57.0 bits (136), Expect(2) = 3e-11
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 2/102 (1%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R   LP +T  Y  HEYT +N +FA  IEP N ++Q+      +      PT+P TL  E
Sbjct: 152 RFNRLPENTLFYPAHEYTAANLRFAAHIEPDNADIQTALKAAAH-----TPTLPVTLAHE 206

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEAL--KAIRQAKDNF 281
           +  NPF+R         +++P   D AEAL  K +  + D F
Sbjct: 207 RRVNPFLR---------VDLPHVRDRAEALSGKTLNSSLDTF 239



 Score = 33.1 bits (74), Expect(2) = 3e-11
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG++F GT +Q+  S ++
Sbjct: 127 GDTLFSAGCGRVFTGTIEQLYDSFQR 152



>gb:AK047517_1168126 Mus musculus 10 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:B930082I15
           product:unknown EST, full insert sequence.
          Length = 240

 Score = 66.6 bits (161), Expect(2) = 3e-11
 Identities = 28/72 (38%), Positives = 48/72 (66%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++CGHE+TLSN +FA  +EP N+ +Q+  +       + +PT+P+TL +E + N
Sbjct: 163 LPPETKVFCGHEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDDEDIPTVPSTLGEELMYN 222

Query: 388 PFVRTFSMEIRK 353
           PF+R   ++ R+
Sbjct: 223 PFLRVTQLQPRR 234



 Score = 23.5 bits (49), Expect(2) = 3e-11
 Identities = 12/27 (44%), Positives = 13/27 (48%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GD L    CG   E T  QM  SL K
Sbjct: 132 SGDALSVAGCGWHLEDTAQQMYQSLAK 158



>gb:AK005274_1152919 Mus musculus adult male cerebellum cDNA, RIKEN
           full-length enriched library, clone:1500017E18
           product:unknown EST, full insert
           sequence.>gb:BC030466_2096820 Mus musculus
           hydroxyacylglutathione hydrolase-like, mRNA (cDNA clone
           MGC:40644 IMAGE:5253213), complete
           cds.>gb:BC083322_2108590 Mus musculus
           hydroxyacylglutathione hydrolase-like, mRNA (cDNA clone
           MGC:101974 IMAGE:6820885), complete cds.
          Length = 283

 Score = 65.5 bits (158), Expect(2) = 7e-11
 Identities = 32/86 (37%), Positives = 50/86 (58%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++CGHE+TLSN +FA  +EP N+ +Q+  +       + +PT+P+TL +E + N
Sbjct: 163 LPPETKVFCGHEHTLSNLEFAQKVEPCNEHVQAKLSWAQERDDEDIPTVPSTLGEELMYN 222

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEAL 311
           PF+R     +R        A   EAL
Sbjct: 223 PFLRVTEDAVRAFTGQVAPAQVLEAL 248



 Score = 23.5 bits (49), Expect(2) = 7e-11
 Identities = 12/27 (44%), Positives = 13/27 (48%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GD L    CG   E T  QM  SL K
Sbjct: 132 SGDALSVAGCGWHLEDTAQQMYQSLAK 158



>pir|F81961|F81961 probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) NMA0444 [imported] - Neisseria meningitidis
           (strain Z2491 serogroup A)>gb:NMA2Z2491_153396 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 2/7.
          Length = 250

 Score = 55.1 bits (131), Expect(2) = 1e-10
 Identities = 39/110 (35%), Positives = 55/110 (50%), Gaps = 10/110 (9%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQS--YAAQITNLRKKGLPTIPTTLE 407
           R   LP +T  Y  HEYT +N +FA  IEP N ++Q+   AA+ T       PT+P TL 
Sbjct: 152 RFNRLPENTLFYPAHEYTAANLRFAAHIEPDNADIQTALKAAERT-------PTLPVTLA 204

Query: 406 KEKLCNPFVRTFSMEIR--------KSLNIPDSADDAEALKAIRQAKDNF 281
            E+  NPF+RT    +R        K+LN        E   A+R+ K+ +
Sbjct: 205 HERRVNPFLRTEIPAVRQRAEALVGKTLN-----SGLEVFAALRELKNAY 249



 Score = 33.1 bits (74), Expect(2) = 1e-10
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG++F GT +Q+  S ++
Sbjct: 127 GDTLFSAGCGRVFTGTIEQLYDSFQR 152



>gb:AE017154_392649 Haemophilus ducreyi strain 35000HP section 4 of
           6 of the complete genome.>gb:AE017143_1026911
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 235

 Score = 62.4 bits (150), Expect(2) = 1e-10
 Identities = 33/100 (33%), Positives = 52/100 (52%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R   LP  T ++  HEYTL+N KFA S+ P N +++   A+   LR +  PT+P+T+++E
Sbjct: 151 RFKTLPESTLVFPAHEYTLTNLKFAASVLPNNNDIREAQARAETLRAQQQPTLPSTIKQE 210

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
              NPF++               AD+      +RQ KD +
Sbjct: 211 LRINPFLQ---------------ADNLAEFITLRQQKDQY 235



 Score = 25.8 bits (55), Expect(2) = 1e-10
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFS  CG++F G       +L++
Sbjct: 126 GDALFSAGCGRVFTGDYQAQFNTLQR 151



>gb:BX569693_776445 Synechococcus sp. WH8102 complete genome;
           segment 5/7.
          Length = 249

 Score = 48.5 bits (114), Expect(2) = 3e-10
 Identities = 22/73 (30%), Positives = 42/73 (57%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP  T + C HEYT  N  +A+  +P +  ++     + +LR++G  ++P+++ +E
Sbjct: 162 RLSELPESTKVCCAHEYTEGNLLWAIQQQPQDAAIRQRYDAVVDLRRRGELSLPSSIGEE 221

Query: 400 KLCNPFVRTFSME 362
           +  N F+R  S E
Sbjct: 222 RRSNLFMRAASAE 234



 Score = 38.5 bits (88), Expect(2) = 3e-10
 Identities = 17/26 (65%), Positives = 20/26 (76%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG+LFEGTP  M  +LR+
Sbjct: 137 GDTLFSGGCGRLFEGTPADMHRALRR 162



>gb:BX842652_825068 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 7/11.
          Length = 251

 Score = 52.8 bits (125), Expect(2) = 3e-10
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 8/81 (9%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFA--------LSIEPGNQELQSYAAQITNLRKKGLPT 425
           RI  LP  T IYC HEYT SN +F           I   ++ L+ YA +++N R+  LP+
Sbjct: 159 RIKKLPPQTLIYCTHEYTKSNLEFCRILTNQDNTPITGDSEALELYANELSNRRELNLPS 218

Query: 424 IPTTLEKEKLCNPFVRTFSME 362
           +P  L  E+  NPF+    +E
Sbjct: 219 VPLKLSIEESVNPFLLARDVE 239



 Score = 34.3 bits (77), Expect(2) = 3e-10
 Identities = 14/27 (51%), Positives = 20/27 (74%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           +GD +F L CG+LFEGT +Q   SL++
Sbjct: 133 SGDVIFGLGCGRLFEGTFEQGYESLQR 159



>gb:AE004969_60876 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 250

 Score = 54.3 bits (129), Expect(2) = 4e-10
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 10/110 (9%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQS--YAAQITNLRKKGLPTIPTTLE 407
           R   LP  T  Y  HEYT +N +FA  IEP N ++Q+   AA+ T       PT+P TL 
Sbjct: 152 RFNQLPEGTLFYPAHEYTAANLRFAAHIEPDNADIQTALKAAEHT-------PTLPVTLA 204

Query: 406 KEKLCNPFVRTFSMEIR--------KSLNIPDSADDAEALKAIRQAKDNF 281
            E+  NPF+RT    +R        K+LN        E   A+R+ K+ +
Sbjct: 205 HERRVNPFLRTEIPAVRQRAEALVGKTLN-----SGLEVFAALRELKNAY 249



 Score = 32.3 bits (72), Expect(2) = 4e-10
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG++F GT +Q+  + ++
Sbjct: 127 GDTLFSAGCGRVFTGTVEQLYDNFQR 152



>sp|Q89AN4|GLO2_BUCBP Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>gb:AE014016_302640
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 1 of 2 of the complete
           genome.>gb:AE016826_981241 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 249

 Score = 58.9 bits (141), Expect(2) = 3e-09
 Identities = 33/79 (41%), Positives = 45/79 (56%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEK 398
           I  LPNDT IYC HEYT SN +F   I P N  + +Y   I   + K   T+P+TL+ EK
Sbjct: 152 ISKLPNDTLIYCSHEYTRSNLEFFKKIFPKNLNILNYYNNIK--KSKTQCTLPSTLKIEK 209

Query: 397 LCNPFVRTFSMEIRKSLNI 341
             NPF++  +  +R  + I
Sbjct: 210 KINPFLQLNNTNLRHQVKI 228



 Score = 24.6 bits (52), Expect(2) = 3e-09
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLR 582
           GD++FS  CG++  G   +M  SLR
Sbjct: 126 GDSIFSGGCGRVKNGMMIKMYNSLR 150



>gb:AE016827_342575 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 236

 Score = 52.0 bits (123), Expect(2) = 3e-09
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 3/103 (2%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQ---ELQSYAAQITNLRKKGLPTIPTTL 410
           R+  LP+ T I   HEYTLSN  FA +  P  +    +++    + +LR +  P++PTTL
Sbjct: 149 RLKQLPDKTVICPAHEYTLSNLVFAEAFAPNEKVKSAVKNQRISVESLRAQNKPSLPTTL 208

Query: 409 EKEKLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
             EK  NPF++               A++      +R+AKDNF
Sbjct: 209 ALEKNINPFLQ---------------AENLADFIYLRKAKDNF 236



 Score = 31.6 bits (70), Expect(2) = 3e-09
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GDTLFS  CG++F G   QM  S+ +
Sbjct: 124 GDTLFSAGCGRVFTGDYGQMFESITR 149



>gb:AE006464_1875633 Homo sapiens 16p13.3 sequence section 3 of 8.
          Length = 218

 Score = 58.5 bits (140), Expect(2) = 3e-09
 Identities = 27/64 (42%), Positives = 41/64 (64%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP +T ++CGHE+TLSN +FA  +EP N   +          +  +PT+P+TL +E+L N
Sbjct: 162 LPPETKVFCGHEHTLSNLEFAQKVEPCNDHKRD---------EDDVPTVPSTLGEERLYN 212

Query: 388 PFVR 377
           PF+R
Sbjct: 213 PFLR 216



 Score = 25.0 bits (53), Expect(2) = 3e-09
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           +GD L    CG   EG+  QM  SL
Sbjct: 132 SGDALSVAGCGSCLEGSAQQMYQSL 156



>gb:BA000037_720979 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 247

 Score = 54.7 bits (130), Expect(2) = 1e-07
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  + + T IY  HEYTL N KFA  I+P N+ + +Y        K    + PTTL  E
Sbjct: 151 KIKSMDDKTKIYFSHEYTLDNLKFAHYIDPKNKNIINYIEVFK--EKPDTVSAPTTLLLE 208

Query: 400 KLCNPFVR-TFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+R + +++I+  +N     ++ +A   +R+ KD F
Sbjct: 209 KEINPFLRLSENIDIKNKIN-----NEFDAFVYLRKLKDKF 244



 Score = 23.5 bits (49), Expect(2) = 1e-07
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFS  CG++     D M  SL+K
Sbjct: 127 GDVLFSAGCGRVGSNYKD-MYLSLKK 151



>gb:AE006105_215573 Pasteurella multocida subsp. multocida str. Pm70
           section 72 of 204 of the complete
           genome.>gb:AE004439_1118303 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 233

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 36/100 (36%), Positives = 49/100 (49%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           R+  LP+DT +   HEYTL+N  FA  I P N  +Q +   +   R    P++PTT+ +E
Sbjct: 149 RLKSLPDDTIVCPAHEYTLANLAFAKYILPENVAIQQHEQWVQKQRVTHQPSLPTTMGRE 208

Query: 400 KLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           K  NPF+                A D E   A R+AKD F
Sbjct: 209 KQINPFL---------------IAQDMETFVAWRKAKDVF 233



>gb:CR382134_1667038 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 255

 Score = 45.1 bits (105), Expect(2) = 3e-07
 Identities = 33/97 (34%), Positives = 51/97 (52%), Gaps = 2/97 (2%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSI--EPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKL 395
           LP +T +Y GHEYT SN KF+ +I      ++L  +  +  N    G  TI   LE    
Sbjct: 167 LPKETKVYPGHEYTKSNVKFSKTILNNDAIKKLDKFVNE--NEFTAGKFTIGDELE---- 220

Query: 394 CNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDN 284
            NPF+R    +++K   I  ++D AE +  +R+ K+N
Sbjct: 221 FNPFMRLNDPDVQK---ITGASDSAEVMGKLREMKNN 254



 Score = 31.6 bits (70), Expect(2) = 3e-07
 Identities = 12/21 (57%), Positives = 16/21 (76%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQM 597
           TGDTLF   CG+ FEG+ ++M
Sbjct: 136 TGDTLFISGCGRFFEGSGEEM 156



>gb:BC058945_2103525 Mus musculus brain protein 17, mRNA (cDNA clone
           MGC:66659 IMAGE:6812127), complete cds.
          Length = 424

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 6/103 (5%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEK 398
           ++ L +DT ++ GHEY   N  FA  +EP N   +     +   R +   T P+TL +E+
Sbjct: 317 VLDLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEER 376

Query: 397 LCNPFVRTFSMEIRKSL------NIPDSADDAEALKAIRQAKD 287
             NPF+RT  +E++++L         D    A+ L+ +R+ KD
Sbjct: 377 AYNPFLRTHCLELQEALGPGPGPTSDDGCSRAQLLEELRRLKD 419



 Score = 36.6 bits (83), Expect = 0.39
 Identities = 20/41 (48%), Positives = 25/41 (60%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEGT + ML+SL  D V+      LLWP
Sbjct: 290 SGDLLFLSGCGRTFEGTAETMLSSL--DTVLDLGDDTLLWP 328



>gb:AK173125_2070059 Mus musculus mRNA for mKIAA1184 protein.
          Length = 388

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 6/103 (5%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEK 398
           ++ L +DT ++ GHEY   N  FA  +EP N   +     +   R +   T P+TL +E+
Sbjct: 281 VLDLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEER 340

Query: 397 LCNPFVRTFSMEIRKSL------NIPDSADDAEALKAIRQAKD 287
             NPF+RT  +E++++L         D    A+ L+ +R+ KD
Sbjct: 341 AYNPFLRTHCLELQEALGPGPGPTSDDGCSRAQLLEELRRLKD 383



 Score = 36.6 bits (83), Expect = 0.39
 Identities = 20/41 (48%), Positives = 25/41 (60%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEGT + ML+SL  D V+      LLWP
Sbjct: 254 SGDLLFLSGCGRTFEGTAETMLSSL--DTVLDLGDDTLLWP 292



>gb:AB041609_2045478 Mus musculus brain cDNA, clone MNCb-5687,
           similar to Homo sapiens mRNA for KIAA1184 protein.
          Length = 360

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 6/103 (5%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEK 398
           ++ L +DT ++ GHEY   N  FA  +EP N   +     +   R +   T P+TL +E+
Sbjct: 253 VLDLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEER 312

Query: 397 LCNPFVRTFSMEIRKSL------NIPDSADDAEALKAIRQAKD 287
             NPF+RT  +E++++L         D    A+ L+ +R+ KD
Sbjct: 313 AYNPFLRTHCLELQEALGPGPGPTSDDGCSRAQLLEELRRLKD 355



 Score = 36.6 bits (83), Expect = 0.39
 Identities = 20/41 (48%), Positives = 25/41 (60%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEGT + ML+SL  D V+      LLWP
Sbjct: 226 SGDLLFLSGCGRTFEGTAETMLSSL--DTVLDLGDDTLLWP 264



>gb:AK041238_1165918 Mus musculus adult male aorta and vein cDNA,
           RIKEN full-length enriched library, clone:A530093P09
           product:brain protein 17, full insert sequence.
          Length = 345

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 6/103 (5%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEK 398
           ++ L +DT ++ GHEY   N  FA  +EP N   +     +   R +   T P+TL +E+
Sbjct: 238 VLDLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTCPSTLGEER 297

Query: 397 LCNPFVRTFSMEIRKSL------NIPDSADDAEALKAIRQAKD 287
             NPF+RT  +E++++L         D    A+ L+ +R+ KD
Sbjct: 298 AYNPFLRTHCLELQEALGPGPGPTSDDGCSRAQLLEELRRLKD 340



 Score = 36.6 bits (83), Expect = 0.39
 Identities = 20/41 (48%), Positives = 25/41 (60%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEGT + ML+SL  D V+      LLWP
Sbjct: 211 SGDLLFLSGCGRTFEGTAETMLSSL--DTVLDLGDDTLLWP 249



>sp|P71374|GLO2_HAEIN Probable hydroxyacylglutathione hydrolase (EC
           3.1.2.6) (Glyoxalase II) (Glx II).>pir|G64113|G64113
           hypothetical protein HI1274 - Haemophilus influenzae
           (strain Rd KW20)>gb:U32807_204935 Haemophilus influenzae
           Rd KW20 section 122 of 163 of the complete
           genome.>gb:L42023_1097484 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 238

 Score = 47.0 bits (110), Expect(2) = 2e-06
 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 5/105 (4%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQ-----ITNLRKKGLPTIPT 416
           R+  LP++T +   HEYTL N  FA ++      ++  A +     +   R +  P++PT
Sbjct: 149 RLNTLPDETIVCPAHEYTLGNLAFAETVLVDKSAVEKSAVEKQRIFVETQRAENKPSLPT 208

Query: 415 TLEKEKLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           TL+ E+  NPF++               A   E   A+R+AKD F
Sbjct: 209 TLKLEREINPFLQ---------------AKTLEEFTALRKAKDIF 238



 Score = 26.9 bits (58), Expect(2) = 2e-06
 Identities = 11/26 (42%), Positives = 15/26 (57%)
 Frame = -1

Query: 656 GDTLFSLSCGKLFEGTPDQMLASLRK 579
           GD LFS  CG++F G    M   L++
Sbjct: 124 GDALFSAGCGRVFTGNYALMFEGLQR 149



>gb:AF402098_507621 Azotobacter vinelandii hydroxyacylglutathione
           hydrolase gene, partial cds.
          Length = 89

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 30/89 (33%), Positives = 46/89 (51%), Gaps = 3/89 (3%)
 Frame = -2

Query: 538 HEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCNPFVRTFSMEI 359
           HEYTLSN +FA + EP N  +    A++T  R  G  ++P+ L  E+  NPF+RT    +
Sbjct: 1   HEYTLSNLRFAQAAEPDNPAIARRLAEVTAWRNAGSGSLPSELALERETNPFLRTGETSV 60

Query: 358 RKSLNI---PDSADDAEALKAIRQAKDNF 281
           ++ +         D  +    +R  KDNF
Sbjct: 61  KERVARRCGQPMLDPDQVFTELRAWKDNF 89



>gb:BC036457_1981938 Homo sapiens myofibrillogenesis regulator 1,
           mRNA (cDNA clone MGC:33461 IMAGE:4797574), complete cds.
          Length = 385

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 8/105 (7%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGN--QELQSYAAQITNLRKKGLPTIPTTLEK 404
           ++ L +DT ++ GHEY   N  FA  +EP N  +E +    Q   L +KG  T P+TL +
Sbjct: 278 VLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKG--TCPSTLGE 335

Query: 403 EKLCNPFVRTFSMEIRKSLNI---PDSADD---AEALKAIRQAKD 287
           E+  NPF+RT  + ++++L     P   DD   A+ L+ +R+ KD
Sbjct: 336 ERSYNPFLRTHCLALQEALGPGPGPTGDDDYSRAQLLEELRRLKD 380



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/41 (46%), Positives = 24/41 (58%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEG  + ML+SL  D V+      LLWP
Sbjct: 251 SGDLLFLSGCGRTFEGNAETMLSSL--DTVLGLGDDTLLWP 289



>gb:AY358753_1947632 Homo sapiens clone DNA96894 AWQG2491 (UNQ2491)
           mRNA, complete cds.>gb:BC002937_1968542 Homo sapiens
           myofibrillogenesis regulator 1, mRNA (cDNA clone
           MGC:10635 IMAGE:3956630), complete cds.
          Length = 361

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 8/105 (7%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGN--QELQSYAAQITNLRKKGLPTIPTTLEK 404
           ++ L +DT ++ GHEY   N  FA  +EP N  +E +    Q   L +KG  T P+TL +
Sbjct: 254 VLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKG--TCPSTLGE 311

Query: 403 EKLCNPFVRTFSMEIRKSLNI---PDSADD---AEALKAIRQAKD 287
           E+  NPF+RT  + ++++L     P   DD   A+ L+ +R+ KD
Sbjct: 312 ERSYNPFLRTHCLALQEALGPGPGPTGDDDYSRAQLLEELRRLKD 356



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/41 (46%), Positives = 24/41 (58%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEG  + ML+SL  D V+      LLWP
Sbjct: 227 SGDLLFLSGCGRTFEGNAETMLSSL--DTVLGLGDDTLLWP 265



>gb:AB033010_1866190 Homo sapiens mRNA for KIAA1184 protein, partial
           cds.
          Length = 380

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 8/105 (7%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGN--QELQSYAAQITNLRKKGLPTIPTTLEK 404
           ++ L +DT ++ GHEY   N  FA  +EP N  +E +    Q   L +KG  T P+TL +
Sbjct: 273 VLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKG--TCPSTLGE 330

Query: 403 EKLCNPFVRTFSMEIRKSLNI---PDSADD---AEALKAIRQAKD 287
           E+  NPF+RT  + ++++L     P   DD   A+ L+ +R+ KD
Sbjct: 331 ERSYNPFLRTHCLALQEALGPGPGPTGDDDYSRAQLLEELRRLKD 375



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/41 (46%), Positives = 24/41 (58%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEG  + ML+SL  D V+      LLWP
Sbjct: 246 SGDLLFLSGCGRTFEGNAETMLSSL--DTVLGLGDDTLLWP 284



>gb:CR857281_1181525 Pongo pygmaeus mRNA; cDNA DKFZp469H1021 (from
           clone DKFZp469H1021).
          Length = 350

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 8/105 (7%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGN--QELQSYAAQITNLRKKGLPTIPTTLEK 404
           ++ L +DT ++ GHEY   N  FA  +EP N  +E +    Q   L +KG  T P+TL +
Sbjct: 243 VLGLGDDTLLWPGHEYAEENLGFAGVVEPDNLARERKMQWMQRQRLERKG--TCPSTLGE 300

Query: 403 EKLCNPFVRTFSMEIRKSLNI---PDSADD---AEALKAIRQAKD 287
           E+  NPF+RT  + ++++L     P   DD   A+ L+ +R+ KD
Sbjct: 301 ERSYNPFLRTHCLALQEALGPGPGPTGDDDCSRAQLLEELRRLKD 345



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/41 (46%), Positives = 24/41 (58%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEG  + ML+SL  D V+      LLWP
Sbjct: 216 SGDLLFLSGCGRTFEGNAETMLSSL--DTVLGLGDDTLLWP 254



>gb:HSM802017_1186583 Homo sapiens mRNA; cDNA DKFZp434O1772 (from
           clone DKFZp434O1772).
          Length = 325

 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 37/105 (35%), Positives = 58/105 (55%), Gaps = 8/105 (7%)
 Frame = -2

Query: 577 IMLLPNDTNIYCGHEYTLSNSKFALSIEPGN--QELQSYAAQITNLRKKGLPTIPTTLEK 404
           ++ L +DT ++ GHEY   N  FA  +EP N  +E +    Q   L +KG  T P+TL +
Sbjct: 218 VLGLGDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRLERKG--TCPSTLGE 275

Query: 403 EKLCNPFVRTFSMEIRKSLNI---PDSADD---AEALKAIRQAKD 287
           E+  NPF+RT  + ++++L     P   DD   A+ L+ +R  KD
Sbjct: 276 ERSYNPFLRTHCLALQEALGPGPGPTGDDDYSRAQLLEELRLLKD 320



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/41 (46%), Positives = 24/41 (58%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVTQ*YKYLLWP 537
           +GD LF   CG+ FEG  + ML+SL  D V+      LLWP
Sbjct: 191 SGDLLFLSGCGRTFEGNAETMLSSL--DTVLGLGDDTLLWP 229



>gb:NC93G11_1688804 Neurospora crassa DNA linkage group V Cosmid
           contig 93G11.
          Length = 265

 Score = 41.6 bits (96), Expect(2) = 9e-06
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 9/105 (8%)
 Frame = -2

Query: 568 LPNDTNIYC-------GHEYTLSNSKFALSI--EPGNQELQSYAAQITNLRKKGLPTIPT 416
           LP++T ++        GHEYT SN+KF +S+      + LQ++A +    + K       
Sbjct: 169 LPDETRVFYLTYPMKPGHEYTKSNAKFCMSVLQSEAVKALQAFAEKHRETQGK------F 222

Query: 415 TLEKEKLCNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKDNF 281
           T+  EK  N F+R    EI+K+       D    +  +R+ K+NF
Sbjct: 223 TIGDEKKHNVFMRPHDPEIQKATG---ETDPVAIMTKLREMKNNF 264



 Score = 30.0 bits (66), Expect(2) = 9e-06
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF   CG+ FEG   +M  +L +
Sbjct: 138 TGDTLFHGGCGRFFEGNGAEMHKALNE 164



>gb:AC104496_1192350 Trypanosoma cruzi strain CL Brener chromosome 3
           clone cosmid Tcc1l8, *** SEQUENCING IN PROGRESS ***.
          Length = 299

 Score = 41.6 bits (96), Expect(2) = 2e-05
 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 4/81 (4%)
 Frame = -2

Query: 556 TNIYCGHEYTLSNSKFAL-SIEPGNQELQSYAAQITNLRK---KGLPTIPTTLEKEKLCN 389
           T ++ GHEYT++  +FA  +I P + +    A+Q+   ++   +  PT+P+TL +EK  N
Sbjct: 208 TFVFPGHEYTVNFLQFARDTIPPAHPDATFIASQLERYKESVAQRKPTVPSTLAEEKRQN 267

Query: 388 PFVRTFSMEIRKSLNIPDSAD 326
            F+RT      + +   D+A+
Sbjct: 268 LFLRTCDESFVREMKHGDTAE 288



 Score = 28.9 bits (63), Expect(2) = 2e-05
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDY 573
           TGDT+F    G  FEG    M  +LRK Y
Sbjct: 164 TGDTMFVGGIGAFFEGDAAHMCRALRKVY 192



>gb:TBR492819_1399336 Trypanosoma brucei brucei glxII gene for
           glyoxalase II.
          Length = 296

 Score = 40.8 bits (94), Expect(2) = 4e-05
 Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 4/82 (4%)
 Frame = -2

Query: 562 NDTNIYCGHEYTLSNSKFALSIEPGNQELQSYA-AQITNLRKK---GLPTIPTTLEKEKL 395
           N T I+ GHEYT++  +F+    P +    S+  AQ+    +     +PT+P+TL +EK 
Sbjct: 203 NHTYIFPGHEYTVNFLRFSRDALPASHPDVSFVEAQLRRYTESVAGNVPTVPSTLAEEKR 262

Query: 394 CNPFVRTFSMEIRKSLNIPDSA 329
            N F+RT      + +N  ++A
Sbjct: 263 QNLFLRTCDEAFVRVMNKGETA 284



 Score = 28.5 bits (62), Expect(2) = 4e-05
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDY 573
           TGDT+F    G  FEG    M ++LRK Y
Sbjct: 154 TGDTMFVGGIGAFFEGDAVLMCSALRKVY 182



>gb:BC033796_1981065 Homo sapiens hydroxyacylglutathione
           hydrolase-like, transcript variant 1, mRNA (cDNA clone
           MGC:44901 IMAGE:5173915), complete cds.
          Length = 290

 Score = 42.7 bits (99), Expect(2) = 1e-04
 Identities = 16/33 (48%), Positives = 25/33 (75%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQS 470
           LP +T ++CGHE+TLSN +FA  +EP N  +++
Sbjct: 162 LPPETKVFCGHEHTLSNLEFAQKVEPCNDHVRA 194



 Score = 25.0 bits (53), Expect(2) = 1e-04
 Identities = 11/25 (44%), Positives = 13/25 (52%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           +GD L    CG   EG+  QM  SL
Sbjct: 132 SGDALSVAGCGSCLEGSAQQMYQSL 156



>gb:CR382130_1662589 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 258

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 29/94 (30%), Positives = 47/94 (50%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           LP+DT +Y GHEYT SN KF  +I P N+ +        N +   + T   T+  EK  N
Sbjct: 169 LPDDTVVYPGHEYTKSNVKFVKTILPNNEAVNKLDHFCQNNK---ITTGVFTIGDEKKHN 225

Query: 388 PFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKD 287
           PF+      + +   +  S D  + ++ +R+ K+
Sbjct: 226 PFMMVNDPAVEE---VCGSTDPVKVMEVLRERKN 256



 Score = 39.3 bits (90), Expect = 0.060
 Identities = 21/44 (47%), Positives = 26/44 (59%), Gaps = 7/44 (15%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQM-------LASLRKDYVVTQ*YKY 549
           TGDTLF   CG+ FEGTP++M       LA L  D VV   ++Y
Sbjct: 138 TGDTLFIAGCGRFFEGTPEEMNVALNDILAKLPDDTVVYPGHEY 181



>pir|T40964|T40964 probable hydroxyacylglutathione hydrolase -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPCC13B11_1720891 S.pombe chromosome III
           cosmid c13B11.
          Length = 256

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 32/92 (34%), Positives = 45/92 (48%), Gaps = 2/92 (2%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITN--LRKKGLPTIPTTLEKEKL 395
           LPN+T IY GHEYT SN KFA      ++ LQS A                  T+ +EK 
Sbjct: 168 LPNNTVIYPGHEYTKSNVKFA------SKHLQSEALNHLEGLCNHNQFIAGHITMGQEKQ 221

Query: 394 CNPFVRTFSMEIRKSLNIPDSADDAEALKAIR 299
            NPF+R    E++K L + D     + L+ ++
Sbjct: 222 FNPFMRVTDPELQKHLGLNDPIKVMDELRTLK 253



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 7/44 (15%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQM-------LASLRKDYVVTQ*YKY 549
           TGDTLF+  CG+ FEGT  +M       L+SL  + V+   ++Y
Sbjct: 137 TGDTLFNAGCGRFFEGTAAEMHIALNAVLSSLPNNTVIYPGHEY 180



>gb:AJ749949_531862 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 252

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 33/101 (32%), Positives = 46/101 (45%), Gaps = 1/101 (0%)
 Frame = -2

Query: 580 RIMLLPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKE 401
           +I  L  D   Y  H+Y L N  FALSI   +     Y  Q+  L  +  P +   L +E
Sbjct: 156 KITKLDGDIKPYPAHDYWLGNLDFALSILADDSYFNYYRNQVAELAAEDKPIV--NLAEE 213

Query: 400 KLCNPFVRTFS-MEIRKSLNIPDSADDAEALKAIRQAKDNF 281
              N F+R  S   + K+L  PD +   E    +RQ K+NF
Sbjct: 214 AKLNIFIRAMSDKALLKAL--PDYSLGREMFVKLRQLKNNF 252



>gb:AE011383_272353 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 192 of 397 of the complete
           sequence.>gb:AE010300_1005752 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete sequence.
          Length = 202

 Score = 40.8 bits (94), Expect = 0.021
 Identities = 25/78 (32%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSIEPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKLCN 389
           L  +  +Y GH+Y  +N KF LS+ P NQ+      + + L  K +  + T L KE+  N
Sbjct: 100 LEEEILLYPGHDYLETNLKFTLSLNPSNQDAIDALEECSRL-PKNIEFLTTNLGKERRIN 158

Query: 388 PFVRTF--SMEIRKSLNI 341
            F++    S E+ K+++I
Sbjct: 159 TFLQCDHPSSELLKNVSI 176



>pir|T39108|T39108 probable hydroxyacylglutathione hydrolase -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC824_1718390 S.pombe chromosome I cosmid
           c824.
          Length = 256

 Score = 38.9 bits (89), Expect = 0.079
 Identities = 30/96 (31%), Positives = 47/96 (48%), Gaps = 2/96 (2%)
 Frame = -2

Query: 568 LPNDTNIYCGHEYTLSNSKFALSI--EPGNQELQSYAAQITNLRKKGLPTIPTTLEKEKL 395
           LP+DT  Y GHEYT SN+KF+ +I   P   +L  +       +     T   T+  EK 
Sbjct: 168 LPDDTVTYPGHEYTKSNAKFSSTIFSTPELTKLVDFC------KNHESTTGHFTIGDEKK 221

Query: 394 CNPFVRTFSMEIRKSLNIPDSADDAEALKAIRQAKD 287
            NPF+      ++K++    S+D    +K +R  K+
Sbjct: 222 FNPFMCLGLESVQKAVG---SSDPITVMKKLRDMKN 254



 Score = 33.5 bits (75), Expect = 3.3
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 7/44 (15%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQM-------LASLRKDYVVTQ*YKY 549
           TGDTLF+  CG+ FEG   QM       LA+L  D V    ++Y
Sbjct: 137 TGDTLFTSGCGRFFEGDAKQMDYALNHVLAALPDDTVTYPGHEY 180



>gb:CR380955_1651557 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 274

 Score = 38.5 bits (88), Expect = 0.10
 Identities = 16/27 (59%), Positives = 21/27 (77%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTLF+  CG+ FEGT ++M A+L K
Sbjct: 141 TGDTLFTAGCGRFFEGTGEEMDAALNK 167



>sp|P70030|PO3B_XENLA Transcription factor POU3B
           (XLPOU3B).>gb:BC072060_2556324 Xenopus laevis cDNA clone
           MGC:78934 IMAGE:4203106, complete
           cds.>gb:XLPOU3B_2583070 X.laevis POU3b gene.
          Length = 385

 Score = 37.7 bits (86), Expect = 0.18
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 291 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPAAQEITSLADSLQLEKEVVRVW 343



>gb:AF091043_2472705 Coturnix coturnix japonica POU-box protein
           brain-2 mRNA, complete cds.
          Length = 431

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 337 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 389



>gb:AB001869_2460207 Anolis carolinensis Brain-2 gene, complete cds.
          Length = 447

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 351 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 403



>gb:AB001868_2460206 Anolis carolinensis Brain-1 gene, complete cds.
          Length = 454

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 355 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 407



>gb:HS273N12_1997839 Human DNA sequence from clone RP1-273N12 on
           chromosome 6q16.1-16.3 Contains the FBXL4 gene for F-box
           and leucine-rich repeat protein 4 and the POU3F2 gene
           for POU domain class 3 transcription factor 2 and a CpG
           island, complete sequence.
          Length = 443

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 349 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 401



>gb:BC051699_1984626 Homo sapiens POU domain, class 3, transcription
           factor 2, mRNA (cDNA clone MGC:26417 IMAGE:4817001),
           complete cds.
          Length = 443

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 349 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 401



>gb:AY650385_1958332 Macaca fascicularis pou domain class 3
           transcription factor 2 mRNA, partial cds.
          Length = 125

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 70  AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 122



>pir|S29334|S29334 transcription factor Brn-2 [validated] -
           human>gb:HSNOCTPOU_2019182 H.sapiens mRNA for N-Oct 3,
           N-Oct5a, and N-Oct 5b proteins.
          Length = 443

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 349 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 401



>pir|A49447|A49447 transcription factor Brn-2 - rat
          Length = 445

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 351 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 403



>sp|P79746|ZP47_BRARE POU domain protein ZP-47.>gb:BC067373_2554706
           Danio rerio POU domain gene 47, mRNA (cDNA clone
           MGC:77528 IMAGE:6802070), complete
           cds.>gb:DRZP47POU_2571416 D.rerio mRNA for zp-47 POU
           gene.
          Length = 378

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 287 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPAASEITSLADSLQLEKEVVRVW 339



>sp|P31360|PO32_MOUSE POU domain, class 3, transcription factor 2
           (Nervous-system specific octamer-binding transcription
           factor N-Oct-3) (Brain-specific homeobox/POU domain
           protein 2) (Brain-2) (Brn-2 protein).>pir|S31224|S31224
           transcription factor Brn-2 - mouse>gb:MUSPOUDOMB_2129695
           Mouse brain-2 POU-domain protein, complete cds.
          Length = 445

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 351 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 403



>sp|P20265|PO32_HUMAN POU domain, class 3, transcription factor 2
           (Nervous-system specific octamer-binding transcription
           factor N-Oct-3) (Brain-specific homeobox/POU domain
           protein 2) (Brain-2) (Brn-2 protein).>gb:HUMNOCT_2035168
           Homo sapiens POU-domain transcription factor (N-Oct-3),
           complete cds.
          Length = 443

 Score = 37.4 bits (85), Expect = 0.23
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 349 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 401



>gb:AE016816_1746774 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 293

 Score = 37.0 bits (84), Expect = 0.30
 Identities = 15/25 (60%), Positives = 20/25 (80%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASL 585
           TGDTLF+  CG+ FEGT ++M A+L
Sbjct: 162 TGDTLFTAGCGRFFEGTAEEMDAAL 186



>gb:CNS07EG9_1372814 chromosome II of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 263

 Score = 37.0 bits (84), Expect = 0.30
 Identities = 15/27 (55%), Positives = 19/27 (70%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRK 579
           TGDTL  L CGK F GTP QM+ ++ +
Sbjct: 156 TGDTLLFLGCGKFFGGTPGQMIKNIEE 182



>sp|P56222|PO32_RAT POU domain, class 3, transcription factor 2
           (Nervous-system specific octamer-binding transcription
           factor N-Oct-3) (Brain-specific homeobox/POU domain
           protein 2) (Brain-2) (Brn-2 protein).
          Length = 445

 Score = 37.0 bits (84), Expect = 0.30
 Identities = 25/54 (46%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLADSLQ    + RVW
Sbjct: 351 ASQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADSLQLEKEVVRVW 403



>gb:BC041298_2547925 Xenopus laevis similar to POU domain, class 3,
           transcription factor 2, mRNA (cDNA clone IMAGE:4683624),
           partial cds.
          Length = 406

 Score = 36.6 bits (83), Expect = 0.39
 Identities = 25/54 (46%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 312 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAPEITSLADSLQLEKEVVRVW 364



>gb:AY078995_1296501 Branchiostoma floridae transcription factor
           AmphiBrn1/2/4 mRNA, complete cds.
          Length = 410

 Score = 36.6 bits (83), Expect = 0.39
 Identities = 24/54 (44%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK   + I  LADSLQ    + RVW
Sbjct: 292 AAQGRKRKKRTSIEVTVKGALES-HFLKQPKPSAQEIAQLADSLQLEKEVVRVW 344



>sp|P31365|PO3A_XENLA Transcription factor POU3A
           (XLPOU3).>pir|S22652|S22652 transcription factor Brn-2 -
           African clawed frog>gb:XLPOU3_2583069 X.laevis XlPOU3
           mRNA for a POU-domain protein.
          Length = 382

 Score = 36.6 bits (83), Expect = 0.39
 Identities = 25/54 (46%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 288 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAPEITSLADSLQLEKEVVRVW 340



>gb:DRU77736_2571383 Danio rerio class III POU domain protein
           (taichi) gene, complete cds.>gb:DRZP12POU_2571413
           D.rerio mRNA for zp-12 POU gene, splice variant
           (postsomitogenesis, 20-28 hpf).
          Length = 428

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 328 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 380



>gb:BC070001_2555480 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:85606 IMAGE:6963958), complete cds.
          Length = 437

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 328 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 380



>gb:BC065961_2554215 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:76858 IMAGE:6969114), complete cds.
          Length = 446

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 329 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 381



>gb:BC058318_2552289 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:65765 IMAGE:6801552), complete cds.
          Length = 438

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 329 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 381



>gb:BC056549_2551822 Danio rerio POU domain gene 23, mRNA (cDNA
           clone MGC:65734 IMAGE:6794036), complete cds.
          Length = 444

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 326 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 378



>gb:BC056320_2551760 Danio rerio POU domain gene 23, mRNA (cDNA
           clone MGC:65766 IMAGE:6800248), complete
           cds.>gb:DRZP23POU_2571415 D.rerio mRNA for zp-23 POU
           gene, splice variant (neurula, 9-16 hpf and
           postsomitogenesis, 20-28 hpf).
          Length = 425

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 325 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 377



>gb:BC044354_2548664 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:55267 IMAGE:3818319), complete cds.
          Length = 434

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 328 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 380



>gb:AF039952_2470029 Danio rerio type III POU domain protein (zp-12)
           mRNA, complete cds.
          Length = 445

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 328 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 380



>gb:AF469664_2066685 Mesocricetus auratus POU homeodomain protein
           (Brn-4) mRNA, complete cds.
          Length = 361

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK   + I SLADSLQ    + RVW
Sbjct: 273 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAAQEISSLADSLQLEKEVVRVW 325



>gb:HS326L13_1998059 Human DNA sequence from clone RP3-326L13 on
           chromosome Xq21.1 Contains the POU3F4 gene for POU
           domain, class 3, transcription factor 4 and two CpG
           islands, complete sequence.
          Length = 361

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK   + I SLADSLQ    + RVW
Sbjct: 273 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAAQEISSLADSLQLEKEVVRVW 325



>gb:AF273264_1257682 Steatoda triangulosa VvlB protein (cf1a) mRNA,
           partial cds.
          Length = 133

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 74  AAQGRKRKKRTSIEVSVKGALES-HFHKQPKPAAQEIASLADSLQLEKEVVRVW 126



>pir|A44144|A44144 transcription factor Brn-4 - rat (fragment)
          Length = 371

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK   + I SLADSLQ    + RVW
Sbjct: 283 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAAQEISSLADSLQLEKEVVRVW 335



>pir|A55557|A55557 transcription factor Brn-4 - human
          Length = 361

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK   + I SLADSLQ    + RVW
Sbjct: 273 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAAQEISSLADSLQLEKEVVRVW 325



>sp|P79745|ZP23_BRARE POU domain protein ZP-23.>gb:DRZP23POU_2571414
           D.rerio mRNA for zp-23 POU gene, splice variant
           (neurula, 9-16 hpf and postsomitogenesis, 20-28 hpf).
          Length = 443

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 325 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 377



>sp|P56224|ZP12_BRARE POU domain protein ZP-12 (Class III POU domain
           protein TAICHI).>gb:DRZP12POU_2571412 D.rerio mRNA for
           zp-12 POU gene, splice variant (postsomitogenesis, 20-28
           hpf).
          Length = 437

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 328 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 380



>sp|P31366|POU1_BRARE POU domain protein 1
           (ZFPOU1).>pir|JH0710|JH0710 transcription factor Brn-1 -
           zebra fish>gb:ZEFZFPOU1_2583889 Zebrafish mRNA for POU
           domain protein, complete cds.
          Length = 425

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 325 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 377



>sp|P25216|PO34_MOUSE POU domain, class 3, transcription factor 4
           (Brain-specific homeobox/POU domain protein 4) (Brain-4)
           (Brn-4) (RHS2 class III POU protein).>pir|S31225|S31225
           transcription factor Brn-4 - mouse>gb:MUSPOUDOMC_2129696
           Mouse brain-4 POU-domain protein, complete
           cds.>gb:RATRHS2POU_2133717 Sprague-Dawley RHS2 class III
           POU protein (RHS2) complete cds.>gb:RNBRAIN4_2134539
           R.norvegicus mRNA for brain-4.
          Length = 361

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK   + I SLADSLQ    + RVW
Sbjct: 273 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAAQEISSLADSLQLEKEVVRVW 325



>sp|P49335|PO34_HUMAN POU domain, class 3, transcription factor 4
           (Brain-specific homeobox/POU domain protein 4) (Brain-4)
           (Brn-4).>gb:HSBRN4_2011118 H.sapiens Brain 4 mRNA.
          Length = 361

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK   + I SLADSLQ    + RVW
Sbjct: 273 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAAQEISSLADSLQLEKEVVRVW 325



>sp|Q63262|PO33_RAT POU domain, class 3, transcription factor 3
           (Brain-specific homeobox/POU domain protein 1) (Brain-1)
           (Brn-1 protein).>gb:RNBRAIN1_2134538 Rattus norvegicus
           mRNA for Brain-1 (Brn-1) protein.
          Length = 497

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ    + RVW
Sbjct: 398 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITNLADSLQLEKEVVRVW 450



>sp|Q29087|PO33_PIG POU domain, class 3, transcription factor 3
           (Brain-specific homeobox/POU domain protein 1) (Brain-1)
           (Brn-1 protein) (Fragment).>gb:PIGPOUD_1443251 Sus
           scrofa POU mRNA, partial cds.
          Length = 131

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ    + RVW
Sbjct: 73  AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITNLADSLQLEKEVVRVW 125



>sp|P31361|PO33_MOUSE POU domain, class 3, transcription factor 3
           (Brain-specific homeobox/POU domain protein 1) (Brain-1)
           (Brn-1 protein).>pir|S31223|S31223 transcription factor
           Brn-1 - mouse>gb:MUSPOUDOMA_2129694 Mouse brain-1
           POU-domain protein, complete cds.
          Length = 495

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ    + RVW
Sbjct: 396 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITNLADSLQLEKEVVRVW 448



>sp|P20264|PO33_HUMAN POU domain, class 3, transcription factor 3
           (Brain-specific homeobox/POU domain protein 1) (Brain-1)
           (Brn-1 protein).>gb:AB001835_1863571 Homo sapiens DNA
           for Brain-1, complete cds.
          Length = 500

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ    + RVW
Sbjct: 401 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITNLADSLQLEKEVVRVW 453



>sp|Q90436|PO33_BRARE Brain-specific homeobox/POU domain protein 1.1
           (Brn-1.1) (Fragment).>gb:DRU43898_2571299 Danio rerio
           alternatively spliced brn-1.1 protein variant (brn-1.1)
           mRNA, partial cds.
          Length = 441

 Score = 36.2 bits (82), Expect = 0.51
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I SLAD+LQ    + RVW
Sbjct: 324 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITSLADNLQLEKEVVRVW 376



>gb:BC043847_2548301 Xenopus laevis similar to POU domain gene, mRNA
           (cDNA clone IMAGE:4888100), partial cds.
          Length = 377

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 25/54 (46%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 283 AAQGRKRKKRTSIEVGVKGALEN-HFLKCPKPSAHEITSLADSLQLEKEVVRVW 335



>gb:AF276075_2483851 Ambystoma mexicanum POU domain transcription
           factor brn-1 mRNA, complete cds.
          Length = 403

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK   + I +LADSLQ    + RVW
Sbjct: 304 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAQEITALADSLQLEKEVVRVW 356



>gb:AF064608_2471402 Gallus gallus POU class III transcription
           factor (Oct-6) gene, complete cds.
          Length = 372

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 25/54 (46%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 278 AAQGRKRKKRTSIEVGVKGALEN-HFLKCPKPSAHEITSLADSLQLEKEVVRVW 330



>gb:AY557739_1613966 Saccharomyces cerevisiae clone FLH002078.01X
           YDR272W gene, complete cds.
          Length = 274

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVT 564
           TGDTLF+  CG+ FEGT ++M  +L    + T
Sbjct: 142 TGDTLFTAGCGRFFEGTGEEMDIALNNSILET 173



>gb:DMCF1A_1378541 Drosophila melanogaster Cf1a gene for DNA-binding
           protein (C- term.), containing POU domain.
          Length = 343

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 216 AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITSLADSLQLEKEVVRVW 268



>gb:BT003517_1356919 Drosophila melanogaster RE27192 full insert
           cDNA.
          Length = 427

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 299 AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITSLADSLQLEKEVVRVW 351



>gb:AY513764_1332265 Helicoverpa armigera POU-domain transcription
           factor mRNA, complete cds.
          Length = 351

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 234 AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITSLADSLQLEKEVVRVW 286



>gb:AY334012_1320414 Bombyx mori POU-M2 (POU-M2) mRNA, complete cds.
          Length = 352

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 237 AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITSLADSLQLEKEVVRVW 289



>pir|S05042|S05042 transcription factor Brn-1, brain - human
           (fragments)
          Length = 125

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 30/54 (55%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ    + RVW
Sbjct: 70  AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSSQEITNLADSLQLEKEVVRVW 122



>pir|S19095|S19095 transcription factor Cf1a - fruit fly (Drosophila
           melanogaster)>gb:DMCF1AMRN_1378542 D.melanogaster CF1-a
           mRNA for a POU-domain protein.
          Length = 549

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 338 AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITSLADSLQLEKEVVRVW 390



>pir|S23248|S23248 transcription factor POU1 - African clawed frog
           (fragment)
          Length = 369

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 25/54 (46%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 275 AAQGRKRKKRTSIEVGVKGALEN-HFLKCPKPSAHEITSLADSLQLEKEVVRVW 327



>sp|Q17237|SGF3_BOMMO Silk gland factor 3 (SGF-3) (POU domain
           protein M1).>pir|A48763|A48763 transcription factor
           SGF-3 - silkworm>gb:BMOPOUM1_1355625 Bombyx mori POU
           domain protein (POU-M1) mRNA, complete cds.
          Length = 351

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 236 AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITSLADSLQLEKEVVRVW 288



>sp|P31363|POU1_XENLA Transcription factor POU1 (XLPOU1) (Homeotic
           protein NRL-22/NRL-34).>gb:XLPOU1_2583067 X.laevis mRNA
           for POU domain (POU 1 gene).
          Length = 356

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 25/54 (46%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 262 AAQGRKRKKRTSIEVGVKGALEN-HFLKCPKPSAHEITSLADSLQLEKEVVRVW 314



>sp|Q05584|GLO2_YEAST Hydroxyacylglutathione hydrolase, cytoplasmic
           isozyme (EC 3.1.2.6) (Glyoxalase II) (Glx
           II).>pir|S70130|S70130 hypothetical protein YDR272w -
           yeast (Saccharomyces cerevisiae)>gb:SCGLO2_1708390
           S.cerevisiae GLO2 gene.>gb:YSCD9954_1728776
           Saccharomyces cerevisiae chromosome IV cosmid 9954.
          Length = 274

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 15/32 (46%), Positives = 21/32 (65%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQMLASLRKDYVVT 564
           TGDTLF+  CG+ FEGT ++M  +L    + T
Sbjct: 142 TGDTLFTAGCGRFFEGTGEEMDIALNNSILET 173



>sp|P16241|CF1A_DROME POU-domain protein CF1A (Chorion factor 1A)
           (CF1-A) (Ventral veins lacking protein) (Drifter
           protein).>gb:AE014296_1135051 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003561_1215657
           Drosophila melanogaster chromosome 3L, section 24 of 83
           of the complete sequence.>gb:DROPOUC_1382562
           D.melanogaster POU domain protein (Cfla) mRNA, complete
           cds.
          Length = 427

 Score = 35.8 bits (81), Expect = 0.67
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 299 AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITSLADSLQLEKEVVRVW 351



>gb:BC076747_2559492 Xenopus laevis POU 2 transcription factor, mRNA
           (cDNA clone MGC:82270 IMAGE:4032407), complete
           cds.>gb:XLU17654_2583255 Xenopus laevis transcription
           factor POU2 (XlPOU 2) mRNA, complete cds.
          Length = 361

 Score = 35.4 bits (80), Expect = 0.87
 Identities = 24/54 (44%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK     I SLADSLQ    + RVW
Sbjct: 273 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAALEITSLADSLQLEKEVVRVW 325



>gb:BC067685_2554856 Danio rerio cDNA clone IMAGE:6972273, partial
           cds.
          Length = 334

 Score = 35.4 bits (80), Expect = 0.87
 Identities = 25/54 (46%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL     LK PK     I SLADSLQ    + RVW
Sbjct: 243 AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPGASEINSLADSLQLEKEVVRVW 295



>gb:AB001870_2460208 Anolis carolinensis Brain-4 gene, complete cds.
          Length = 356

 Score = 35.4 bits (80), Expect = 0.87
 Identities = 23/54 (42%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK   + I +LADSLQ    + RVW
Sbjct: 262 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAAQEIAALADSLQLEKEVVRVW 314



>gb:AF273265_1257683 Steatoda triangulosa VvlC protein (cf1a) mRNA,
           partial cds.
          Length = 133

 Score = 35.4 bits (80), Expect = 0.87
 Identities = 24/54 (44%), Positives = 29/54 (53%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I SLADSLQ    + RVW
Sbjct: 74  AAQGRKRKKRTSIEVSVKGALEN-HFHKQPKPSAQEIASLADSLQLEKEVVRVW 126



>pir|S23249|S23249 transcription factor POU2 - African clawed frog
           (fragment)
          Length = 235

 Score = 35.4 bits (80), Expect = 0.87
 Identities = 24/54 (44%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK     I SLADSLQ    + RVW
Sbjct: 147 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAALEITSLADSLQLEKEVVRVW 199



>sp|P31364|POU2_XENLA Transcription factor POU2
           (XLPOU2).>gb:XLPOU2_2583068 X.laevis mRNA for POU domain
           (POU 2 gene).
          Length = 218

 Score = 35.4 bits (80), Expect = 0.87
 Identities = 24/54 (44%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK     I SLADSLQ    + RVW
Sbjct: 130 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAALEITSLADSLQLEKEVVRVW 182



>gb:BC075142_2558255 Xenopus laevis MGC81954 protein, mRNA (cDNA
           clone MGC:81954 IMAGE:7010002), complete cds.
          Length = 356

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 24/54 (44%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+  L     LK PK     I SLADSLQ    + RVW
Sbjct: 268 AAQGRKRKKRTSIEVSVKGVLET-HFLKCPKPAALEISSLADSLQLEKEVVRVW 320



>gb:RATTST1POU_2134177 Rat POU domain protein (Tst-1) mRNA, 3' end.
          Length = 417

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 300 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 352



>gb:MMOCT6R_2116814 M.musculus Oct-6 mRNA for octamer binding
           protein.
          Length = 448

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 331 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 383



>gb:HSOCT6TR_2019258 Homo sapiens Oct-6 transcription factor.
          Length = 398

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 281 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 333



>gb:AL139158_1920366 Human DNA sequence from clone RP5-884C9 on
           chromosome 1p34.1-35.3, complete sequence.
          Length = 451

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 334 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 386



>pir|A40168|A40168 transcription factor Oct-6 -
           rat>gb:RATSCIP_2133829 Rat transcriptional repressor of
           myelin-specific genes (SCIP) mRNA, complete cds.
          Length = 451

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 334 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 386



>sp|P20267|PO31_RAT POU domain, class 3, transcription factor 1
           (Octamer-binding transcription factor 6) (Oct-6)
           (POU-domain transcription factor SCIP) (Tst-1).
          Length = 451

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 334 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 386



>sp|P21952|PO31_MOUSE POU domain, class 3, transcription factor 1
           (Octamer-binding transcription factor 6) (Oct-6)
           (POU-domain transcription factor
           SCIP).>pir|S30205|S30205 transcription factor Oct-6 -
           mouse>gb:MDSCIP_2113631 Mouse SCIP mRNA for a POU-domain
           transcription factor.>gb:MMOCT6GR_2116813 M. musculus
           oct6 gene for the octamer binding factor
           oct6.>gb:MUSPOUDOMD_2129697 Mouse scip POU-domain
           protein, complete cds.
          Length = 449

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 332 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 384



>sp|Q03052|PO31_HUMAN POU domain, class 3, transcription factor 1
           (Octamer-binding transcription factor 6) (Oct-6)
           (POU-domain transcription factor
           SCIP).>pir|A56018|A56018 transcription factor Oct-6 -
           human>gb:HUMOCT6A_2035246 Homo sapiens (oct-6) mRNA,
           complete cds.
          Length = 448

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 24/54 (44%), Positives = 27/54 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    + RVW
Sbjct: 331 AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVW 383



>gb:AF273266_1257684 Porcellio scaber Vvl protein (cf1a) mRNA,
           partial cds.
          Length = 133

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 23/54 (42%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I  LADSLQ    + RVW
Sbjct: 74  AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITQLADSLQLEKEVVRVW 126



>gb:AF273260_1257678 Procambarus clarkii Vvl protein (cf1a) mRNA,
           partial cds.>gb:AF273263_1257681 Steatoda triangulosa
           VvlA protein (cf1a) mRNA, partial cds.
          Length = 133

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 23/54 (42%), Positives = 28/54 (51%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V+V+ AL      K PK   + I  LADSLQ    + RVW
Sbjct: 74  AAQGRKRKKRTSIEVSVKGALEQ-HFHKQPKPSAQEITQLADSLQLEKEVVRVW 126



>gb:CR382126_1659065 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 283

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 13/21 (61%), Positives = 17/21 (80%)
 Frame = -1

Query: 659 TGDTLFSLSCGKLFEGTPDQM 597
           TGDTLF+  CG+ FEGT ++M
Sbjct: 149 TGDTLFTGGCGRFFEGTAEEM 169



>gb:AF231942_1253214 Haliotis asinina class III POU protein mRNA,
           partial cds.
          Length = 224

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 23/54 (42%), Positives = 26/54 (48%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LAD LQ    + RVW
Sbjct: 72  AAQGRKRKKRTSIEVTVKGALEN-HFLKQPKPSAAEISQLADQLQLEKEVVRVW 124



>gb:S81257_2041984 OCT6=transcriptional regulator [human,
           tripronuclear ova and embryos, mRNA Partial, 204 nt].
          Length = 68

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 24/55 (43%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQ-SFSIIRRVW 340
           A QG +  KR  I V V+ AL     LK PK     I  LADSLQ    ++R VW
Sbjct: 9   AAQGRKRKKRTSIEVGVKGALES-HFLKCPKPSAHEITGLADSLQLEKEVVRVVW 62



>gb:AY071583_1295667 Drosophila melanogaster RE63964 full length
           cDNA.
          Length = 495

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 4/77 (5%)
 Frame = -2

Query: 559 DTNIYCGHEYTLSNSKFALSIEPGNQELQ----SYAAQITNLRKKGLPTIPTTLEKEKLC 392
           DT ++ GH+ T S   FALS+   N ++Q      A+++    K+ +P +   +++    
Sbjct: 302 DTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKESMPYLEAVIKETLRI 361

Query: 391 NPFVRTFSMEIRKSLNI 341
            P V  FS ++ + L +
Sbjct: 362 YPSVPFFSRKVLEDLEV 378



>sp|Q9VXY0|C4S3_DROME Probable cytochrome P450 4s3 (EC 1.14.-.-)
           (CYPIVS3).>gb:AE014298_1125702 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003498_1212711
           Drosophila melanogaster chromosome X, section 50 of 74
           of the complete sequence.
          Length = 495

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 4/77 (5%)
 Frame = -2

Query: 559 DTNIYCGHEYTLSNSKFALSIEPGNQELQ----SYAAQITNLRKKGLPTIPTTLEKEKLC 392
           DT ++ GH+ T S   FALS+   N ++Q      A+++    K+ +P +   +++    
Sbjct: 302 DTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASELEGREKESMPYLEAVIKETLRI 361

Query: 391 NPFVRTFSMEIRKSLNI 341
            P V  FS ++ + L +
Sbjct: 362 YPSVPFFSRKVLEDLEV 378



>gb:CSA420131_1375693 Cupiennius salei partial mRNA for nubbin (pdm
           gene).
          Length = 290

 Score = 32.3 bits (72), Expect = 7.4
 Identities = 21/51 (41%), Positives = 25/51 (49%)
 Frame = +2

Query: 188 GTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           G R  KR  I   V LAL     L+NPK   + I  LA+SL     + RVW
Sbjct: 161 GRRRKKRTSIETTVRLALEK-AFLQNPKPTSEEIAMLAESLAMEKEVVRVW 210



>gb:RATRHS1POU_2133716 Sprague-Dawley class III POU protein
           POU-domain (RHS1) mRNA, partial cds.
          Length = 125

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 23/53 (43%), Positives = 29/53 (54%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRV 337
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ    + RV
Sbjct: 74  AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPSAQEITNLADSLQLEKEVVRV 125



>gb:AE016818_1748421 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 1110

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 20/84 (23%), Positives = 42/84 (50%), Gaps = 1/84 (1%)
 Frame = -2

Query: 541 GHEYTLSNSKFALSIEPGNQELQSYAAQITNLRK-KGLPTIPTTLEKEKLCNPFVRTFSM 365
           GH+ T S++  +  I P +++L   A+ +TN+ K K +  +P      +  +  + T   
Sbjct: 198 GHKSTTSSNAHSTVITPRSRQLPDVASSVTNVPKGKAMRQMPVRRLLHRKSSSSIATVHS 257

Query: 364 EIRKSLNIPDSADDAEALKAIRQA 293
            ++  LNI D  +++   +  RQ+
Sbjct: 258 NLKYPLNINDYDEESVEEEGGRQS 281



>gb:AF297550_1259962 Sacculina carcini class III POU protein
           (PouIII) gene, partial cds.
          Length = 112

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 22/53 (41%), Positives = 27/53 (50%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRV 337
           A QG++  KR  I V+V+  L     LK PK     I  LADSLQ    + RV
Sbjct: 61  AAQGSKRKKRTSIEVSVKSMLEQ-HFLKQPKPAANEISGLADSLQLEKEVVRV 112



>gb:AF273259_1257677 Porcellio scaber Pdm protein mRNA, partial cds.
          Length = 138

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 21/51 (41%), Positives = 25/51 (49%)
 Frame = +2

Query: 188 GTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQSFSIIRRVW 340
           G R  KR  I  +V +AL     L NPK   + I  LADSL     + RVW
Sbjct: 81  GRRRKKRTSIETSVRVALER-AFLTNPKPTSEEISMLADSLTMEKEVVRVW 130



>pir|S12181|S12181 transcription factor nrl-20 - African clawed frog
           (fragment)
          Length = 105

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQ 313
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ
Sbjct: 62  AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPAAQEITTLADSLQ 105



>sp|P20914|HM20_XENLA Homeotic protein NRL-20
           (Fragment).>gb:XLNRL20_2582993 Xenopus laevis mRNA for
           nrl-20 POU-homeobox protein.
          Length = 105

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 21/45 (46%), Positives = 26/45 (57%)
 Frame = +2

Query: 179 ALQGTRNAKRAHISVAVELALRL*QLLKNPKHILKVILSLADSLQ 313
           A QG +  KR  I V+V+ AL     LK PK   + I +LADSLQ
Sbjct: 62  AAQGRKRKKRTSIEVSVKGALES-HFLKCPKPAAQEITTLADSLQ 105


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 671,441,945
Number of Sequences: 1806583
Number of extensions: 13166472
Number of successful extensions: 40350
Number of sequences better than 10.0: 219
Number of HSP's better than 10.0 without gapping: 39566
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40321
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 36147673485
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)