BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12948
         (1002 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P16577|UBC4_WHEAT|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa (EC ...   280   3e-74   Triticum aestivum [Canadian hard winter wheat]
gb:AF180143_1774802 Glycine max ubiquitin carrier protein 4 (UBC...   273   4e-72   
sp|P42748|UBC4_ARATH|UBC4_ARATH Ubiquitin-conjugating enzyme E2-21 kDa 1 (E...   270   4e-71   Arabidopsis thaliana [mouse-ear cress]
gb:ATHUBIQUD_1553458 Arabidopsis thaliana ubiquitin conjugating ...   268   1e-70   
sp|P42749|UBC5_ARATH|UBC5_ARATH Ubiquitin-conjugating enzyme E2-21 kDa 2 (E...   267   2e-70   Arabidopsis thaliana [mouse-ear cress]
pir|S43784|S43784 ubiquitin-protein ligase (EC 6.3.2.19) - Arabi...   265   1e-69   Arabidopsis thaliana [mouse-ear cress]
pir|S43786|S43786 ubiquitin-protein ligase (EC 6.3.2.19) - Arabi...   264   2e-69   Arabidopsis thaliana [mouse-ear cress]
sp|P42750|UBC6_ARATH|UBC6_ARATH Ubiquitin-conjugating enzyme E2-21 kDa 3 (E...   263   4e-69   Arabidopsis thaliana [mouse-ear cress]
pir|S43785|S43785 ubiquitin-protein ligase (EC 6.3.2.19) - Arabi...   260   3e-68   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022827 Oryza sativa (japonica cultivar-group) chrom...   259   4e-68   
gb:ATUBC6_1557439 A.thaliana gene for ubiquitin carrier protein.      245   9e-64   
pir|A96663|A96663 hypothetical protein T12P18.18 [imported] - Ar...   241   1e-62   Arabidopsis thaliana [mouse-ear cress]
gb:ANUBCA_1819601 A.niger mRNA for ubiquitin conjugating enzyme ...   229   8e-59   
pir|T50342|T50342 ubiquitin conjugating enzyme [imported] - fiss...   226   4e-58   Schizosaccharomyces pombe
gb:ABUBCA_1529974 A.bisporus mRNA for ubiquitin-conjugating prot...   224   3e-57   
gb:CR382131_1663958 Yarrowia lipolytica chromosome E of strain C...   218   2e-55   
gb:CR382134_1667230 Debaryomyces hansenii chromosome B of strain...   214   2e-54   
gb:CR380959_1653797 Candida glabrata strain CBS138 chromosome M ...   210   4e-53   
gb:CR382121_1654748 Kluyveromyces lactis strain NRRL Y-1140 chro...   207   2e-52   
gb:AE017350_1758986 Cryptococcus neoformans var. neoformans JEC2...   207   3e-52   
gb:AC011622_1537261 Arabidopsis thaliana chromosome 1 BAC F24D7 ...   207   3e-52   
gb:AE014185_937906 Plasmodium falciparum 3D7 chromosome 10 compl...   205   1e-51   
sp|P28263|UBC8_YEAST|UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa (EC ...   205   1e-51   Saccharomyces cerevisiae [brewer's yeast]
gb:BC044038_2548444 Xenopus laevis ubiquitin-conjugating enzyme ...   201   2e-50   
gb:BT007925_2150857 Synthetic construct Homo sapiens ubiquitin-c...   201   2e-50   
sp|P62256|UBCH_HUMAN|UBCH_HUMAN Ubiquitin-conjugating enzyme E2 H (EC 6.3.2...   201   2e-50   Homo sapiens [man]
gb:AL590150_2503675 Zebrafish DNA sequence from clone RP71-3C13 ...   200   3e-50   
gb:AE016818_1748104 Ashbya gossypii (= Eremothecium gossypii) AT...   200   4e-50   
gb:AY223399_1176859 Schistosoma japonicum clone ZZZ325 mRNA sequ...   199   9e-50   
gb:SCE9871_1708250 Saccharomyces cerevisiae chromosome V cosmids...   194   2e-48   
gb:AE014298_1124740 Drosophila melanogaster chromosome X, comple...   191   1e-47   
gb:AC024876_1205044 Caenorhabditis elegans cosmid Y94H6A, comple...   182   1e-44   
gb:ATHUBIQUE_1553459 Arabidopsis thaliana ubiquitin conjugating ...   176   6e-43   
gb:ATHUBIQUF_1553460 Arabidopsis thaliana ubiquitin conjugating ...   176   8e-43   
gb:CNS07EGF_1373862 chromosome VIII of strain GB-M1 of Encephali...   154   3e-36   
gb:AE014297_1139148 Drosophila melanogaster chromosome 3R, compl...   136   7e-31   
gb:AY302138_1943017 Homo sapiens ubiquitin-conjugating enzyme (U...   131   2e-29   
sp|P52490|UBCC_YEAST|UBCC_YEAST Ubiquitin-conjugating enzyme E2 13 (EC 6.3....   113   7e-24   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380953_1650966 Candida glabrata strain CBS138 chromosome G ...   112   9e-24   
gb:CR382123_1656250 Kluyveromyces lactis strain NRRL Y-1140 chro...   109   1e-22   
gb:AY632078_1342695 Clonorchis sinensis ubiquitin-conjugating en...   107   3e-22   
gb:AY223038_1176503 Schistosoma japonicum clone ZZD1166 mRNA seq...   107   3e-22   
gb:AE016820_1750075 Ashbya gossypii (= Eremothecium gossypii) AT...   107   5e-22   
gb:AX406018_1467946 Sequence 433 from Patent WO0222660.               105   2e-21   
gb:BT007772_2150704 Synthetic construct Homo sapiens ubiquitin-c...   104   2e-21   
sp|P51668|UB5A_HUMAN|UB5A_HUMAN Ubiquitin-conjugating enzyme E2-17 kDa 1 (E...   104   2e-21   Homo sapiens [man]
gb:BT008091_2151023 Synthetic construct Homo sapiens ubiquitin-c...   104   3e-21   
gb:AB026055_1516892 Nicotiana tabacum Ntubc1 mRNA for ubiquitin-...   104   3e-21   
sp|P23567|UBC2_HUMAN|UBC2_HUMAN Ubiquitin-conjugating enzyme E2 B (EC 6.3.2...   104   3e-21   Homo sapiens [man]
gb:AP003842_1834083 Oryza sativa (japonica cultivar-group) genom...   103   4e-21   
gb:AJ843121_1814506 Plantago major mRNA for Ubiquitin-conjugatin...   103   4e-21   
gb:CR382129_1661340 Yarrowia lipolytica chromosome C of strain C...   103   5e-21   
sp|P25866|UBC2_WHEAT|UBC2_WHEAT Ubiquitin-conjugating enzyme E2-17 kDa (EC ...   103   5e-21   Triticum aestivum [Canadian hard winter wheat]
gb:BC076728_2559474 Xenopus laevis ubiquitin-conjugating enzyme ...   102   9e-21   
gb:BC059465_2552442 Danio rerio zgc:73096, mRNA (cDNA clone MGC:...   102   9e-21   
gb:AB079798_1523925 Oryza sativa (japonica cultivar-group) OsRad...   102   9e-21   
gb:AB026056_1516893 Nicotiana tabacum Ntubc2 mRNA for ubiquitin-...   102   9e-21   
gb:AF262934_1781643 Avicennia marina ubiquitin conjugating prote...   102   1e-20   
gb:LMFLCHR4B_1388543 Leishmania major Friedlin chromosome 4, rig...   102   1e-20   
gb:AK011363_1156355 Mus musculus 10 days embryo whole body cDNA,...   102   1e-20   
gb:BC071066_2555930 Xenopus laevis MGC78891 protein, mRNA (cDNA ...   102   2e-20   
gb:BC044416_2548725 Danio rerio zgc:55512, mRNA (cDNA clone MGC:...   102   2e-20   
gb:AE016814_1745987 Ashbya gossypii (= Eremothecium gossypii) AT...   102   2e-20   
gb:CR382137_1670071 Debaryomyces hansenii chromosome E of strain...   102   2e-20   
gb:CR382123_1655713 Kluyveromyces lactis strain NRRL Y-1140 chro...   102   2e-20   
sp|P06104|UBC2_YEAST|UBC2_YEAST Ubiquitin-conjugating enzyme E2-20 kDa (EC ...   102   2e-20   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380955_1651531 Candida glabrata strain CBS138 chromosome I ...   101   2e-20   
gb:AY048267_1561728 Arabidopsis thaliana AT5g62540/K19B1_15 mRNA...   101   2e-20   
gb:AY826157_1180117 Aedes albopictus clone AL_336 ubiquitin conj...   101   2e-20   
sp|P49459|UBCA_HUMAN|UBCA_HUMAN Ubiquitin-conjugating enzyme E2 A (EC 6.3.2...   101   2e-20   Homo sapiens [man]
sp|P35128|UBC3_DROME|UBC3_DROME Ubiquitin-conjugating enzyme E2-17 kDa (EC ...   101   2e-20   Drosophila melanogaster
sp|P35130|UBC2_MEDSA|UBC2_MEDSA Ubiquitin-conjugating enzyme E2-17 kDa (EC ...   101   2e-20   Medicago sativa [alfalfa]
sp|P42745|UBC2_ARATH|UBC2_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 2 (E...   101   2e-20   Arabidopsis thaliana [mouse-ear cress]
sp|P52478|UBC1_CAEEL|UBC1_CAEEL Ubiquitin-conjugating enzyme E2-21.5 kDa (E...   101   2e-20   Caenorhabditis elegans [roundworm]
gb:AF508551_2498590 Fundulus heteroclitus ubiquitin conjugating ...   101   3e-20   
pir|A48145|A48145 ubiquitin-conjugating enzyme ubc-2 - Caenorhab...   101   3e-20   Caenorhabditis elegans [roundworm]
sp|P42746|UBC3_ARATH|UBC3_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 3 (E...   101   3e-20   Arabidopsis thaliana [mouse-ear cress]
sp|P35129|UBC2_CAEEL|UBC2_CAEEL Ubiquitin-conjugating enzyme E2-17 kDa (EC ...   101   3e-20   Caenorhabditis elegans [roundworm]
gb:CR382132_1665038 Yarrowia lipolytica chromosome F of strain C...   100   3e-20   
gb:AY143805_1583262 Arabidopsis thaliana At5g62540/K19B1_15 mRNA...   100   3e-20   
pir|A39392|A39392 RAD6 DNA-repair homolog Dhr6 - fruit fly (Dros...   100   3e-20   Drosophila melanogaster
sp|P25153|UBC6_DROME|UBC6_DROME Ubiquitin-conjugating enzyme E2-17 kDa (EC ...   100   3e-20   Drosophila melanogaster
gb:AF091621_1767451 Catharanthus roseus ubiquitin-conjugating en...   100   5e-20   
gb:AE017341_1754626 Cryptococcus neoformans var. neoformans JEC2...   100   5e-20   
gb:SPBC2D10_1719790 S.pombe chromosome II cosmid c2D10.               100   5e-20   
sp|O13685|UBCC_SCHPO|UBCC_SCHPO Ubiquitin-conjugating enzyme E2 13 (EC 6.3....   100   5e-20   Schizosaccharomyces pombe
gb:BC055599_2551463 Danio rerio zgc:66323, mRNA (cDNA clone MGC:...   100   6e-20   
gb:AY049261_1561903 Arabidopsis thaliana At1g78870/F9K20_8 mRNA,...   100   6e-20   
sp|P35133|UBCA_ARATH|UBCA_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 10/1...   100   6e-20   Arabidopsis thaliana [mouse-ear cress]
sp|P25865|UBC1_ARATH|UBC1_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 1 (E...   100   6e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP003223_1825567 Oryza sativa (japonica cultivar-group) genom...    99   1e-19   
gb:AY086447_1571495 Arabidopsis thaliana clone 25162 mRNA, compl...    99   1e-19   
gb:CNS07EGG_1374116 chromosome X of strain GB-M1 of Encephalitoz...    99   1e-19   
pir|C86304|C86304 probable ubiquitin-conjugating enzyme E2 [impo...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:BC047863_2549945 Danio rerio zgc:56340, mRNA (cDNA clone MGC:...    99   1e-19   
gb:BC048523_2099700 Mus musculus Similar to ubiquitin-conjugatin...    99   1e-19   
gb:AK095822_1914444 Homo sapiens cDNA FLJ38503 fis, clone HCHON2...    99   1e-19   
gb:AF325019_1786473 Arabidopsis thaliana AT4g27960 (AT4g27960/T1...    99   1e-19   
gb:AE017343_1755756 Cryptococcus neoformans var. neoformans JEC2...    99   1e-19   
gb:CR382135_1668351 Debaryomyces hansenii chromosome C of strain...    99   1e-19   
gb:AF284603_1258841 Trypanosoma cruzi putative ubiquitin-conjuga...    99   1e-19   
pir|A41222|A41222 ubiquitin-protein ligase (EC 6.3.2.19) E2A - h...    99   1e-19   Homo sapiens [man]
sp|P35134|UBCB_ARATH|UBCB_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 11 (...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
sp|P35132|UBC9_ARATH|UBC9_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 9 (E...    99   1e-19   Arabidopsis thaliana [mouse-ear cress]
sp|P15732|UBC5_YEAST|UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa (EC ...    99   1e-19   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017345_1756993 Cryptococcus neoformans var. neoformans JEC2...    99   2e-19   
gb:CR382130_1662934 Yarrowia lipolytica chromosome D of strain C...    99   2e-19   
gb:AX876763_1476681 Sequence 11668 from Patent EP1074617.>gb:AF1...    99   2e-19   
gb:AY489135_1178425 Capsicum annuum ubiquitin-conjugating enzyme...    99   2e-19   
pir|I59365|I59365 ubiquitin conjugating enzyme - human>gb:HUMUBC...    99   2e-19   Homo sapiens [man]
gb:BC048896_2550071 Danio rerio zgc:55886, mRNA (cDNA clone MGC:...    98   2e-19   
gb:AY133670_1581493 Arabidopsis thaliana At1g64230/F22C12_17 mRN...    98   2e-19   
gb:AB074411_1523247 Oryza sativa (japonica cultivar-group) mRNA ...    98   2e-19   
sp|P35131|UBC8_ARATH|UBC8_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 8 (E...    98   2e-19   Arabidopsis thaliana [mouse-ear cress]
sp|P25867|UBC1_DROME|UBC1_DROME Ubiquitin-conjugating enzyme E2-17 kDa (EC ...    98   2e-19   Drosophila melanogaster
sp|P51669|UB5B_HUMAN|UB5B_HUMAN Ubiquitin-conjugating enzyme E2-17 kDa 2 (E...    98   2e-19   Homo sapiens [man]
gb:BC059548_2552525 Danio rerio zgc:73200, mRNA (cDNA clone MGC:...    98   3e-19   
gb:AF176040_1774550 Mesembryanthemum crystallinum ubiquitin-conj...    98   3e-19   
gb:CR382135_1668293 Debaryomyces hansenii chromosome C of strain...    98   3e-19   
gb:AY769917_1627684 Arachis hypogaea ubiquitin-conjugating enzym...    98   3e-19   
gb:AY389584_1178222 Hyacinthus orientalis ubiquitin-conjugating ...    98   3e-19   
pir|H90116|H90116 ubiquitin conjugating enzyme [imported] - Guil...    98   3e-19   Guillardia theta
pir|B96818|B96818 hypothetical protein F9K20.8 [imported] - Arab...    97   4e-19   Arabidopsis thaliana [mouse-ear cress]
gb:CR456916_1993123 Homo sapiens full open reading frame cDNA cl...    97   5e-19   
gb:AE017346_1757428 Cryptococcus neoformans var. neoformans JEC2...    97   5e-19   
gb:OSJN00032_1693583 Oryza sativa genomic DNA, chromosome 4, BAC...    97   5e-19   
gb:AY085670_1570737 Arabidopsis thaliana clone 16865 mRNA, compl...    97   5e-19   
gb:AC116977_1207017 Dictyostelium discoideum chromosome 2 map 55...    97   5e-19   
pir|T48741|T48741 probable ubiquitin-protein ligase [imported] -...    97   5e-19   Neurospora crassa
sp|P70711|UB5D_RAT|UB5D_RAT Ubiquitin-conjugating enzyme E2-17 kDa 4 (EC ...    97   5e-19   Rattus norvegicus [brown rat]
gb:BC076409_2559246 Danio rerio zgc:100921, mRNA (cDNA clone MGC...    97   7e-19   
gb:BC066917_1987154 Homo sapiens ubiquitin-conjugating enzyme E2...    97   7e-19   
gb:AP004078_1837347 Oryza sativa (japonica cultivar-group) genom...    97   7e-19   
gb:AF034946_1762835 Zea mays ubiquitin conjugating enzyme (UBC) ...    97   7e-19   
gb:AY135219_1581754 Pavlova lutheri ubiquitin-conjugating enzyme...    97   7e-19   
gb:AE014296_1136020 Drosophila melanogaster chromosome 3L, compl...    97   7e-19   
sp|P46595|UBC4_SCHPO|UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2...    97   7e-19   Schizosaccharomyces pombe
sp|P35135|UBC4_LYCES|UBC4_LYCES Ubiquitin-conjugating enzyme E2-17 kDa (EC ...    97   7e-19   Solanum lycopersicum
sp|P61077|UB5C_HUMAN|UB5C_HUMAN Ubiquitin-conjugating enzyme E2-17 kDa 3 (E...    97   7e-19   Homo sapiens [man]
gb:AP006156_1861013 Oryza sativa (japonica cultivar-group) genom...    96   9e-19   
gb:AP003446_1829528 Oryza sativa (japonica cultivar-group) genom...    96   9e-19   
gb:PEAUBC4_1699751 Pisum sativum ubiquitin conjugating enzyme (U...    96   9e-19   
gb:CR382139_1672271 Debaryomyces hansenii chromosome G of strain...    96   9e-19   
gb:AY082009_1569038 Gossypium thurberi ubiquitin-conjugating enz...    96   9e-19   
gb:AY082008_1569037 Gossypium arboreum ubiquitin-conjugating enz...    96   9e-19   
gb:PFA929354_1393172 Plasmodium falciparum strain 3D7, chromosom...    96   9e-19   
pir|F84543|F84543 probable ubiquitin-conjugating enzyme E2 [impo...    96   9e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AF461687_1801830 Pinus pinaster putative ubiquitin mRNA, part...    96   1e-18   
gb:LEUBC_1684800 L.esculentum mRNA for ubiquitin conjugating enz...    96   1e-18   
gb:AY736121_1626035 Triticum aestivum ubiquitin-conjugating enzy...    96   1e-18   
gb:AE014134_1129189 Drosophila melanogaster chromosome 2L, compl...    96   1e-18   
gb:AJ843120_1814505 Plantago major mRNA for Ubiquitin-conjugatin...    96   1e-18   
gb:AF517850_1807652 Griffithsia japonica isolate Gj75 ubiquitin-...    96   1e-18   
gb:AF424651_1798986 Phytophthora infestans clone MY-07-B-10 ubiq...    96   1e-18   
gb:AY082005_1569034 Gossypium hirsutum ubiquitin-conjugating enz...    96   1e-18   
gb:AY080741_1568455 Arabidopsis thaliana putative E2, ubiquitin-...    96   1e-18   
gb:AY542992_1334448 Bigelowiella natans ubiquitin conjugating en...    96   1e-18   
pir|T32959|T32959 hypothetical protein C35B1.1 - Caenorhabditis ...    96   1e-18   Caenorhabditis elegans [roundworm]
gb:AE016818_1748319 Ashbya gossypii (= Eremothecium gossypii) AT...    95   2e-18   
gb:CR382125_1657779 Kluyveromyces lactis strain NRRL Y-1140 chro...    95   2e-18   
gb:AY220735_1590527 Hordeum vulgare ubiquitin-conjugating enzyme...    95   2e-18   
gb:AB074412_1523248 Oryza sativa (japonica cultivar-group) mRNA ...    95   2e-18   
gb:ECA270223_1384169 Entodinium caudatum partial mRNA for putati...    95   2e-18   
gb:AK003163_1151691 Mus musculus 18-day embryo whole body cDNA, ...    95   2e-18   
sp|P43102|UBC4_CANAL|UBC4_CANAL Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2...    95   2e-18   Candida albicans
sp|O74201|UBC2_CANAL|UBC2_CANAL Ubiquitin-conjugating enzyme E2-20 kDa (EC ...    95   2e-18   Candida albicans
gb:AY653733_2371310 Mimivirus, complete genome.                        95   2e-18   
gb:AB032739_2044825 Rattus norvegicus rbendless mRNA for bendles...    95   2e-18   
gb:CR380951_1650139 Candida glabrata strain CBS138 chromosome E ...    95   2e-18   
pir|D96666|D96666 protein F22C12.2 [imported] - Arabidopsis thal...    95   2e-18   Arabidopsis thaliana [mouse-ear cress]
sp|P15731|UBC4_YEAST|UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2...    95   2e-18   Saccharomyces cerevisiae [brewer's yeast]
gb:BC053141_2550533 Danio rerio ubiquitin-conjugating enzyme E2N...    94   3e-18   
gb:BT007560_2150492 Synthetic construct Homo sapiens ubiquitin-c...    94   3e-18   
gb:AY082004_1569033 Gossypium hirsutum ubiquitin-conjugating enz...    94   3e-18   
gb:DDU67838_1377398 Dictyostelium discoideum putative ubiquitin ...    94   3e-18   
sp|P61088|UBCN_HUMAN|UBCN_HUMAN Ubiquitin-conjugating enzyme E2 N (EC 6.3.2...    94   3e-18   Homo sapiens [man]
gb:BC053797_2550747 Xenopus laevis ubiquitin-conjugating enzyme ...    94   4e-18   
gb:BC044461_2548767 Danio rerio ubiquitin-conjugating enzyme E2N...    94   4e-18   
gb:AF532622_1809424 Glycine max ubiquitin-conjugation enzyme gen...    94   4e-18   
gb:CR380951_1649962 Candida glabrata strain CBS138 chromosome E ...    94   4e-18   
gb:ATHUBCD_1553454 Arabidopsis thaliana ubiquitin conjugating en...    94   4e-18   
gb:AB011476_1511404 Arabidopsis thaliana genomic DNA, chromosome...    94   4e-18   
gb:AK005788_1153228 Mus musculus adult male testis cDNA, RIKEN f...    94   4e-18   
pir|S32673|S32673 ubiquitin-protein ligase (EC 6.3.2.19) UBC11 -...    94   4e-18   Arabidopsis thaliana [mouse-ear cress]
pir|S61417|S61417 ubiquitin-protein ligase (EC 6.3.2.19) - rice        94   4e-18   Oryza sativa [red rice]
sp|P52493|UBC2_NEUCR|UBC2_NEUCR Ubiquitin-conjugating enzyme E2-17 kDa (EC ...    94   4e-18   
gb:BC079353_2107473 Rattus norvegicus cDNA clone MGC:94810 IMAGE...    94   6e-18   
gb:AF001948_1760557 Pinus resinosa putative ubiquitin conjugatin...    94   6e-18   
gb:AY084297_1569389 Arabidopsis thaliana clone 102813 mRNA, comp...    94   6e-18   
gb:AC012562_1537727 Arabidopsis thaliana chromosome 3 BAC F17O14...    94   6e-18   
gb:AE014188_967848 Plasmodium falciparum 3D7 chromosome 12, comp...    94   6e-18   
gb:AF317220_1896474 Homo sapiens ubiquitin-conjugating enzyme (P...    93   7e-18   
gb:CR382123_1656294 Kluyveromyces lactis strain NRRL Y-1140 chro...    93   7e-18   
gb:AY486137_1178414 Capsicum annuum ubiquitin-conjugating protei...    93   7e-18   
pir|T51931|T51931 hypothetical protein NhRAD6 [imported] - Haema...    93   7e-18   [Nectria] haematococca
pir|T11716|T11716 ubiquitin conjugating enzyme - fission yeast  ...    93   7e-18   Schizosaccharomyces pombe
sp|Q95044|UBCB_SPISO|UBCB_SPISO Ubiquitin-conjugating enzyme E2-C (EC 6.3.2...    93   7e-18   Spisula solidissima [Atlantic surf-clam]
gb:CR382132_1666055 Yarrowia lipolytica chromosome F of strain C...    93   9e-18   
gb:DROSADH04_1382759 Drosophila melanogaster, chromosome 2L, reg...    93   9e-18   
gb:BC064184_2553737 Xenopus tropicalis hypothetical protein MGC7...    92   1e-17   
gb:CR382137_1669597 Debaryomyces hansenii chromosome E of strain...    92   1e-17   
gb:AB017063_1513329 Arabidopsis thaliana genomic DNA, chromosome...    92   1e-17   
pir|T40123|T40123 ubiquitin-conjugating enzyme - fission yeast  ...    92   1e-17   Schizosaccharomyces pombe
pir|T45220|T45220 ubiquitin-protein ligase (EC 6.3.2.19) rhp6 [i...    92   1e-17   Schizosaccharomyces pombe
gb:AY083611_1569253 Oryza sativa elicitor and UV light related t...    92   2e-17   
gb:AY032592_1559373 Aspergillus nidulans UVSJ (uvsJ) gene, compl...    92   2e-17   
gb:AY542993_1334449 Bigelowiella natans ubiquitin conjugating en...    92   2e-17   
sp|P23566|UBC2_SCHPO|UBC2_SCHPO Ubiquitin-conjugating enzyme E2-17 kDa (EC ...    92   2e-17   Schizosaccharomyces pombe
sp|Q9UVR2|UBC1_MAGGR|UBC1_MAGGR Ubiquitin-conjugating enzyme E2-16 kDa (EC ...    92   2e-17   Magnaporthe grisea
sp|O74196|UBC1_COLGL|UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa (EC ...    92   2e-17   Colletotrichum gloeosporioides
gb:PFMAL8P1_1192213 Plasmodium falciparum 3D7 chromosome 8, *** ...    92   2e-17   
gb:AP004069_1837211 Oryza sativa (japonica cultivar-group) genom...    91   3e-17   
gb:AC024817_1204818 Caenorhabditis elegans cosmid Y54G2A, comple...    91   3e-17   
gb:AK009276_1155043 Mus musculus adult male tongue cDNA, RIKEN f...    91   3e-17   
gb:OSU15971_1698407 Oryza sativa ubiquitin conjugating enzyme (U...    91   5e-17   
sp|P21734|UBC1_YEAST|UBC1_YEAST Ubiquitin-conjugating enzyme E2-24 kDa (EC ...    91   5e-17   Saccharomyces cerevisiae [brewer's yeast]
gb:AE014296_1134587 Drosophila melanogaster chromosome 3L, compl...    90   6e-17   
gb:CR382132_1665178 Yarrowia lipolytica chromosome F of strain C...    89   1e-16   
gb:CNS07EGG_1374079 chromosome X of strain GB-M1 of Encephalitoz...    89   1e-16   
gb:CR382398_1374891 Plasmodium falciparum chromosome 6, complete...    89   1e-16   
gb:AY223405_1176864 Schistosoma japonicum clone ZZZ337 mRNA sequ...    89   1e-16   
gb:AE017344_1756168 Cryptococcus neoformans var. neoformans JEC2...    89   2e-16   
pir|E86484|E86484 hypothetical protein F7F23.6 - Arabidopsis tha...    89   2e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AF125045_1885037 Homo sapiens ubiquitin-conjugating enzyme 1 ...    88   2e-16   
gb:AF132073_1414624 Sus scrofa RAD6 homolog (PHR6A) gene, partia...    88   2e-16   
gb:BC088818_2565910 Xenopus laevis hypothetical LOC496302, mRNA ...    88   3e-16   
gb:BC082942_2563011 Xenopus laevis hypothetical LOC494805, mRNA ...    88   3e-16   
gb:BC082838_2562914 Xenopus laevis hypothetical LOC494742, mRNA ...    88   3e-16   
gb:AE016817_1747554 Ashbya gossypii (= Eremothecium gossypii) AT...    88   3e-16   
sp|Q91W82|UB6B_MOUSE|UB6B_MOUSE Ubiquitin-conjugating enzyme E2 E2 (EC 6.3....    88   3e-16   Mus musculus [mouse]
sp|Q96LR5|UB6B_HUMAN|UB6B_HUMAN Ubiquitin-conjugating enzyme E2 E2 (EC 6.3....    88   3e-16   Homo sapiens [man]
gb:BC042331_2548142 Danio rerio zgc:76906, mRNA (cDNA clone MGC:...    87   4e-16   
gb:AE016817_1747350 Ashbya gossypii (= Eremothecium gossypii) AT...    87   4e-16   
gb:BX649605_1643264 Aspergillus fumigatus BAC pilot project supe...    87   4e-16   
pir|T37559|T37559 ubiquitin-conjugating enzyme e2-16 kd - fissio...    87   4e-16   Schizosaccharomyces pombe
gb:BC076483_2559319 Danio rerio zgc:92467, mRNA (cDNA clone MGC:...    87   5e-16   
gb:AF424641_1798976 Phytophthora infestans clone MY-03-C-08 ubiq...    87   5e-16   
gb:AB022024_2461008 Carassius auratus mRNA for cyclin-selective ...    87   7e-16   
gb:AF419316_1419733 Bos taurus RAD6-like protein HR6A (BHR6A) mR...    87   7e-16   
gb:AF132074_1414625 Equus caballus RAD6 homolog (EHR6A) gene, pa...    87   7e-16   
gb:AY281323_2524706 Xenopus laevis ubiquitin-conjugating enzyme ...    86   9e-16   
gb:BT019344_2151302 Synthetic construct Homo sapiens ubiquitin-c...    86   9e-16   
gb:MMUBCM2_2124225 M.musculus mRNA for ubiquitin-conjugating enz...    86   9e-16   
gb:HSDJ680N4_2012370 Human DNA sequence from clone RP4-680N4 on ...    86   9e-16   
gb:AE017350_1759038 Cryptococcus neoformans var. neoformans JEC2...    86   9e-16   
pir|T00789|T00789 ubiquitin-protein ligase homolog F24L7.7 - Ara...    86   9e-16   Arabidopsis thaliana [mouse-ear cress]
sp|Q969T4|UB6C_HUMAN|UB6C_HUMAN Ubiquitin-conjugating enzyme E2 E3 (EC 6.3....    86   9e-16   Homo sapiens [man]
gb:BC077923_2560569 Xenopus laevis hypothetical LOC494592, mRNA ...    86   1e-15   
gb:BC061394_2553168 Xenopus tropicalis hypothetical protein MGC7...    86   1e-15   
gb:CR382130_1662631 Yarrowia lipolytica chromosome D of strain C...    86   1e-15   
gb:AF132075_1414626 Bos taurus RAD6 homolog (BHR6A) gene, partia...    86   1e-15   
gb:LMFL7845_1388389 Leishmania major Friedlin chromosome 35 cosm...    86   1e-15   
gb:CNS06C8G_1372689 chromosome I of strain GB-M1 of Encephalitoz...    86   1e-15   
gb:AB105548_2465123 Xenopus laevis Xubc15 mRNA for ubiquitin con...    86   2e-15   
sp|O00103|UBCD_SCHPO|UBCD_SCHPO Ubiquitin-conjugating enzyme E2-20 kDa (EC ...    86   2e-15   Schizosaccharomyces pombe
gb:BT007515_2150447 Synthetic construct Homo sapiens ubiquitin-c...    85   2e-15   
gb:BC079134_2107266 Rattus norvegicus cDNA clone IMAGE:7127579, ...    85   2e-15   
sp|O00762|UBCC_HUMAN|UBCC_HUMAN Ubiquitin-conjugating enzyme E2 C (EC 6.3.2...    85   2e-15   Homo sapiens [man]
sp|P52491|UBCB_YEAST|UBCB_YEAST Ubiquitin-conjugating enzyme E2-21.2 kDa (E...    85   2e-15   Saccharomyces cerevisiae [brewer's yeast]
sp|P56616|UBCB_XENLA|UBCB_XENLA Ubiquitin-conjugating enzyme X (EC 6.3.2.19...    85   2e-15   Xenopus laevis [clawed frog]
sp|P52482|UBC6_MOUSE|UBC6_MOUSE Ubiquitin-conjugating enzyme E2 E1 (EC 6.3....    85   2e-15   Mus musculus [mouse]
sp|P51965|UBC6_HUMAN|UBC6_HUMAN Ubiquitin-conjugating enzyme E2 E1 (EC 6.3....    85   2e-15   Homo sapiens [man]
gb:BC074688_2558182 Xenopus tropicalis huntingtin interacting pr...    85   3e-15   
gb:AP003262_1826619 Oryza sativa (japonica cultivar-group) genom...    85   3e-15   
gb:CR382131_1663648 Yarrowia lipolytica chromosome E of strain C...    85   3e-15   
gb:BC041728_2548013 Xenopus laevis huntingtin interacting protei...    84   3e-15   
gb:AJ720771_2502958 Gallus gallus mRNA for hypothetical protein,...    84   3e-15   
gb:AB011081_2043643 Mus musculus mRNA for huntingtin interacting...    84   3e-15   
gb:AY052292_1562665 Arabidopsis thaliana unknown protein mRNA, c...    84   3e-15   
gb:AB020746_1514617 Arabidopsis thaliana genomic DNA, chromosome...    84   3e-15   
gb:PFMAL3P6_1394566 Plasmodium falciparum MAL3P6, complete seque...    84   3e-15   
pir|T18512|T18512 hypothetical protein C0855w - malaria parasite...    84   3e-15   Plasmodium falciparum 3D7
pir|A40797|A40797 ubiquitin-conjugating enzyme - bovine>gb:S5101...    84   3e-15   Bos taurus [bovine]
sp|P52492|UBCA_YEAST|UBCA_YEAST Ubiquitin-conjugating enzyme E2-18 kDa (EC ...    84   3e-15   Saccharomyces cerevisiae [brewer's yeast]
sp|P61085|UBC1_BOVIN|UBC1_BOVIN Ubiquitin-conjugating enzyme E2-25 kDa (EC ...    84   3e-15   Bos taurus [bovine]
gb:BC086816_2564974 Danio rerio zgc:103472, mRNA (cDNA clone MGC...    84   4e-15   
gb:MAU66493_1685657 Metarhizium anisopliae ubiquitin conjugating...    84   4e-15   
gb:AB079872_1198031 Bombyx mori BmubcD4 gene for ubiquitin conju...    84   4e-15   
gb:AP003804_1833611 Oryza sativa (japonica cultivar-group) genom...    84   6e-15   
gb:AY086775_1571818 Arabidopsis thaliana clone 27602 mRNA, compl...    84   6e-15   
gb:D50499_1376201 Paramecium tetraurelia mRNA for ubiquitin-conj...    84   6e-15   
sp|Q9P6I1|UBCG_SCHPO|UBCG_SCHPO Ubiquitin-conjugating enzyme E2 16 (EC 6.3....    84   6e-15   
gb:BC077801_2560454 Xenopus laevis Ube2e2 protein, mRNA (cDNA cl...    83   7e-15   
pir|S57619|S57619 ubiquitin conjugating enzyme - tomato>gb:LEUBC...    83   7e-15   
gb:CR548612_1375365 Paramecium tetraurelia macronuclear largest ...    83   1e-14   
gb:AE014296_1135589 Drosophila melanogaster chromosome 3L, compl...    82   1e-14   
gb:CNS07EGH_1374375 chromosome XI of strain GB-M1 of Encephalito...    82   2e-14   
pir|T33629|T33629 hypothetical protein F40G9.3 - Caenorhabditis ...    82   2e-14   
gb:BC085107_2109059 Mus musculus cDNA clone MGC:103063 IMAGE:304...    81   3e-14   
gb:NCB7H23_1690161 Neurospora crassa DNA linkage group V BAC con...    81   3e-14   
gb:AF161499_1150392 Homo sapiens HSPC150 mRNA, complete cds.>gb:...    81   3e-14   
pir|G90107|G90107 ubiquitin-conjugating enzyme E2-21 KD [importe...    81   3e-14   
sp|Q9D1C1|UBCC_MOUSE|UBCC_MOUSE Ubiquitin-conjugating enzyme E2 C (EC 6.3.2...    81   3e-14   
gb:HSDJ447F3_2012116 Human DNA sequence from clone RP3-447F3 on ...    81   4e-14   
gb:AP005684_1855962 Oryza sativa (japonica cultivar-group) genom...    81   4e-14   
pir|T08465|T08465 ubiquitin-protein ligase (EC 6.3.2.19) - fruit...    81   4e-14   
sp|P52486|UBC4_DROME|UBC4_DROME Ubiquitin-conjugating enzyme E2-22 kDa (EC ...    81   4e-14   
sp|P52485|UBC2_DROME|UBC2_DROME Ubiquitin-conjugating enzyme E2-24 kDa (EC ...    81   4e-14   
gb:AK012565_1157030 Mus musculus 11 days embryo whole body cDNA,...    80   5e-14   
gb:AF136176_1885746 Homo sapiens ubiquitin-conjugating enzyme Ub...    80   6e-14   
gb:AP003022_1824310 Oryza sativa (japonica cultivar-group) genom...    80   6e-14   
gb:AC116986_1207486 Dictyostelium discoideum chromosome 2 map 22...    80   6e-14   
gb:AY231667_1176960 Drosophila yakuba clone yak-em_CG7375 mRNA s...    80   6e-14   
gb:BCSC1_1632811 Brassica oleracea ubiquitine conjugating enzyme...    80   8e-14   
pir|T14451|T14451 ubiquitin conjugating enzyme, E2 - wild cabbag...    80   8e-14   
gb:NCB11H24_1689045 Neurospora crassa DNA linkage group V BAC cl...    79   1e-13   
gb:BX538352_1359063 Cryptosporidium parvum chromosome 6, complet...    79   1e-13   
gb:BC077940_2560586 Xenopus laevis hypothetical protein LOC44623...    79   1e-13   
gb:AF300336_1895675 Homo sapiens ubiquitin-conjugating enzyme (U...    79   1e-13   
gb:CR860875_1184921 Pongo pygmaeus mRNA; cDNA DKFZp469G1720 (fro...    79   1e-13   
sp|P51966|UBC7_HUMAN|UBC7_HUMAN Ubiquitin-conjugating enzyme E2-18 kDa UbcH...    79   1e-13   
gb:AY127573_1580488 Arabidopsis thaliana ubiquitin-conjugating e...    79   2e-13   
gb:AP004465_1841460 Oryza sativa (japonica cultivar-group) genom...    78   2e-13   
gb:AY034618_1559667 Arabidopsis thaliana ubiquitin-conjugating e...    78   2e-13   
gb:AX887984_1483437 Sequence 3847 from Patent EP1033401.               78   2e-13   
gb:AE014296_1135280 Drosophila melanogaster chromosome 3L, compl...    78   2e-13   
gb:AE017344_1756233 Cryptococcus neoformans var. neoformans JEC2...    78   3e-13   
gb:AY004247_1557746 Lycopersicon esculentum RUB1 conjugating enz...    78   3e-13   
gb:AE014298_1125369 Drosophila melanogaster chromosome X, comple...    78   3e-13   
sp|O60015|UBCX_PICAN|UBCX_PICAN Ubiquitin-conjugating enzyme E2-21 kDa (EC ...    78   3e-13   
gb:AY157723_1585443 Olea europaea RUB1 conjugating enzyme (ORCE)...    77   4e-13   
gb:AY148222_1425768 Sus scrofa E2 ubiquitin-conjugating enzyme U...    77   4e-13   
gb:AE016819_1749149 Ashbya gossypii (= Eremothecium gossypii) AT...    77   5e-13   
gb:CR380950_1649923 Candida glabrata strain CBS138 chromosome D ...    77   5e-13   
gb:AY548921_1334849 Antonospora locustae ubiquitin-conjugating e...    77   5e-13   
gb:AY826156_1180116 Aedes albopictus clone AL_265 ubiquitin_conj...    77   5e-13   
gb:BC087785_2565435 Xenopus tropicalis hypothetical LOC496657, m...    77   7e-13   
gb:BC071403_2556144 Danio rerio zgc:86727, mRNA (cDNA clone MGC:...    77   7e-13   
gb:BC070971_2555847 Xenopus laevis hypothetical protein MGC78786...    77   7e-13   
gb:AE016818_1748204 Ashbya gossypii (= Eremothecium gossypii) AT...    77   7e-13   
pir|T13578|T13578 ubiquitin-conjugating enzyme (EC 6.3.2.-) - fr...    77   7e-13   
gb:BC077833_2560485 Xenopus laevis MGC80512 protein, mRNA (cDNA ...    76   9e-13   
gb:BC061289_2553066 Xenopus tropicalis hypothetical protein MGC7...    76   9e-13   
gb:CR382133_1666791 Debaryomyces hansenii chromosome A of strain...    76   9e-13   
gb:U00035_1401406 Caenorhabditis elegans cosmid R01H2, complete ...    76   9e-13   
gb:TVU38786_1401279 Trichomonas vaginalis calmodulin (CAM) and E...    76   9e-13   
gb:PFMAL13_1191611 Plasmodium falciparum 3D7 chromosome 13, *** ...    76   9e-13   
pir|T16646|T16646 hypothetical protein R01H2.6 - Caenorhabditis ...    76   9e-13   
gb:BC056724_2551916 Danio rerio ubiquitin-conjugating enzyme E2L...    76   1e-12   
gb:BC044029_2548435 Xenopus laevis HSPC150 protein similar to ub...    76   1e-12   
gb:AE014134_1126998 Drosophila melanogaster chromosome 2L, compl...    76   1e-12   
gb:HSDJ526F5_2012179 Human DNA sequence from clone RP3-526F5 on ...    75   2e-12   
gb:AY591341_1616671 Zea mays putative RUB1 conjugating enzyme mR...    75   2e-12   
gb:AC012561_1537703 Arabidopsis thaliana chromosome I BAC F11F12...    75   2e-12   
gb:CR382123_1656234 Kluyveromyces lactis strain NRRL Y-1140 chro...    75   2e-12   
gb:AY127574_1580489 Arabidopsis thaliana ubiquitin-conjugating e...    75   2e-12   
gb:AC025726_1205194 Caenorhabditis elegans cosmid Y71G12B, compl...    75   2e-12   
gb:AY389716_1178329 Hyacinthus orientalis ubiquitin-conjugating ...    75   2e-12   
pir|D90126|D90126 ubiquitin-conjugating enzyme E2-17 KD subunit ...    75   2e-12   
sp|P34477|UBC7_CAEEL|UBC7_CAEEL Probable ubiquitin-conjugating enzyme E2-19...    75   2e-12   
gb:AB105547_2465122 Xenopus laevis Xubc14 mRNA for ubiquitin con...    75   3e-12   
gb:AY088923_1573931 Arabidopsis thaliana clone 9968 mRNA, comple...    75   3e-12   
gb:AX885962_1481415 Sequence 1825 from Patent EP1033401.               75   3e-12   
gb:AB099076_1410399 Bos taurus mRNA for similar to phosphoargini...    75   3e-12   
gb:BC086355_2109546 Rattus norvegicus similar to RIKEN cDNA 2510...    74   3e-12   
gb:BC085248_2109130 Mus musculus cDNA clone MGC:102634 IMAGE:304...    74   3e-12   
gb:AY064695_2074790 Mus musculus ubiquitin-conjugating enzyme (M...    74   3e-12   
gb:AK010957_1156093 Mus musculus 13 days embryo liver cDNA, RIKE...    74   3e-12   
gb:AK007960_1154300 Mus musculus 10 day old male pancreas cDNA, ...    74   3e-12   
gb:AK007937_1154293 Mus musculus 10 day old male pancreas cDNA, ...    74   3e-12   
gb:AE016959_1021359 Oryza sativa (japonica cultivar-group) chrom...    74   3e-12   
pir|T29929|T29929 hypothetical protein F29B9.6 - Caenorhabditis ...    74   3e-12   
gb:BC087251_2565107 Xenopus laevis hypothetical LOC496125, mRNA ...    74   5e-12   
gb:BC041263_2547897 Xenopus laevis hypothetical protein MGC52831...    74   5e-12   
gb:AJ719958_2502145 Gallus gallus mRNA for hypothetical protein,...    74   5e-12   
gb:BT008242_2151174 Synthetic construct Homo sapiens ubiquitin-c...    74   5e-12   
gb:AP001081_1820783 Oryza sativa (japonica cultivar-group) genom...    74   5e-12   
gb:AY048210_1561672 Arabidopsis thaliana AT4g36800/C7A10_560 mRN...    74   5e-12   
gb:AB005245_1509588 Arabidopsis thaliana genomic DNA, chromosome...    74   5e-12   
gb:CNS07EGB_1373133 chromosome IV of strain GB-M1 of Encephalito...    74   5e-12   
pir|D96541|D96541 hypothetical protein F17J6.3 [imported] - Arab...    74   5e-12   
sp|P61081|UBCM_HUMAN|UBCM_HUMAN Ubiquitin-conjugating enzyme E2 M (EC 6.3.2...    74   5e-12   
gb:AF455746_1902606 Homo sapiens ubiquitin-conjugating enzyme (H...    74   6e-12   
gb:CR382125_1657435 Kluyveromyces lactis strain NRRL Y-1140 chro...    74   6e-12   
gb:CR380950_1649686 Candida glabrata strain CBS138 chromosome D ...    74   6e-12   
gb:PFA929356_1393372 Plasmodium falciparum strain 3D7, chromosom...    74   6e-12   
gb:AY231898_1177191 Drosophila yakuba clone yak-em_eff mRNA sequ...    74   6e-12   
sp|P25869|UBC_ASFM2|UBC_ASFM2 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6...    74   6e-12   
gb:AF310723_1896239 Homo sapiens NEDD8-conjugating enzyme NCE2 (...    73   8e-12   
gb:AP005769_1857546 Oryza sativa (japonica cultivar-group) genom...    73   8e-12   
gb:AE017150_1029862 Trypanosoma brucei chromosome 2, complete se...    73   8e-12   
gb:PFL298327_2577891 Platichthys flesus partial mRNA for putativ...    73   1e-11   
gb:HUME2EPI_2030774 Human ubiquitin carrier protein (E2-EPF) mRN...    73   1e-11   
gb:AK003078_1151633 Mus musculus adult male spleen cDNA, RIKEN f...    73   1e-11   
gb:AE014296_1136404 Drosophila melanogaster chromosome 3L, compl...    73   1e-11   
pir|B42856|B42856 ubiquitin carrier protein E2 - human                 73   1e-11   
sp|Q921J4|UBCE_MOUSE|UBCE_MOUSE Ubiquitin-conjugating enzyme E2S (EC 6.3.2....    73   1e-11   
sp|Q16763|UBCE_HUMAN|UBCE_HUMAN Ubiquitin-conjugating enzyme E2S (EC 6.3.2....    73   1e-11   
sp|P50623|UBC9_YEAST|UBC9_YEAST Ubiquitin-conjugating enzyme E2-18 kDa (EC ...    73   1e-11   
gb:BC075995_2558878 Danio rerio zgc:92307, mRNA (cDNA clone MGC:...    72   1e-11   
gb:CR382124_1656735 Kluyveromyces lactis strain NRRL Y-1140 chro...    72   1e-11   
gb:CR382128_1661280 Yarrowia lipolytica chromosome B of strain C...    72   2e-11   
gb:OCU58652_1442681 Oryctolagus cuniculus ubiquitin-conjugating ...    72   2e-11   
sp|P27949|UBC_ASFB7|UBC_ASFB7 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6...    72   2e-11   
gb:BC074529_2558024 Xenopus tropicalis MGC69351 protein, mRNA (c...    72   2e-11   
gb:BT011473_1357955 Drosophila melanogaster RE15288 full insert ...    72   2e-11   
gb:AE014296_1136402 Drosophila melanogaster chromosome 3L, compl...    72   2e-11   
sp|P52487|UBC7_DROME|UBC7_DROME Ubiquitin-conjugating enzyme E2-18 kDa (EC ...    72   2e-11   
gb:BC076537_2559363 Danio rerio zgc:91847, mRNA (cDNA clone MGC:...    71   3e-11   
gb:BC056005_2551588 Xenopus laevis ubiquitin coniugating enzyme ...    71   3e-11   
gb:AK000426_1907903 Homo sapiens cDNA FLJ20419 fis, clone KAT02435.    71   3e-11   
gb:AX406024_1467952 Sequence 439 from Patent WO0222660.                71   3e-11   
gb:AE014298_1126178 Drosophila melanogaster chromosome X, comple...    71   3e-11   
sp|Q29503|UBC3_RABIT|UBC3_RABIT Ubiquitin-conjugating enzyme E2-32 kDa comp...    71   3e-11   
gb:BC045129_2549061 Xenopus laevis hypothetical protein MGC53533...    71   4e-11   
gb:AF469491_1802538 Triticum aestivum RUB1-conjugating enzyme mR...    71   4e-11   
gb:CR380951_1650133 Candida glabrata strain CBS138 chromosome E ...    71   4e-11   
gb:AF026506_1234318 Drosophila silvestris ubiquitin-conjugating ...    71   4e-11   
gb:U41026_1403715 Caenorhabditis elegans cosmid C28G1, complete ...    70   5e-11   
gb:DMU51051_1380823 Drosophila melanogaster ubiquitin conjugatin...    70   5e-11   
gb:AB105545_2465120 Xenopus laevis Xubc3 mRNA for ubiquitin conj...    70   7e-11   
gb:MMU240086_2119398 Mus musculus mRNA for ubiquitin coniugating...    70   7e-11   
gb:AE016820_1749752 Ashbya gossypii (= Eremothecium gossypii) AT...    70   7e-11   
gb:AX040994_1457760 Sequence 41 from Patent WO0065040.                 70   7e-11   
gb:AK075703_1170947 Mus musculus adult male lung cDNA, RIKEN ful...    70   7e-11   
gb:AJ721068_2503255 Gallus gallus mRNA for hypothetical protein,...    70   9e-11   
gb:AY653733_2371645 Mimivirus, complete genome.                        70   9e-11   
gb:AL645764_2071883 Mouse DNA sequence from clone RP23-290B5 on ...    70   9e-11   
gb:CR382136_1669252 Debaryomyces hansenii chromosome D of strain...    70   9e-11   
gb:BC066948_1987178 Homo sapiens UBE2S protein, mRNA (cDNA clone...    69   1e-10   
gb:AF061736_1879909 Homo sapiens ubiquitin-conjugating enzyme RI...    69   1e-10   
gb:AB113652_1527265 Coprinopsis cinerea ubc9 mRNA for ubiquitin-...    69   1e-10   
pir|C84566|C84566 probable ubiquitin-conjugating enzyme E2 [impo...    69   1e-10   
sp|O14933|UBC8_HUMAN|UBC8_HUMAN Ubiquitin-conjugating enzyme E2-18 kDa UbcH...    69   1e-10   
sp|P40984|UBC3_SCHPO|UBC3_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa (EC ...    69   1e-10   
gb:BC044173_2548562 Danio rerio zgc:55452, mRNA (cDNA clone MGC:...    69   1e-10   
gb:BT008255_2151187 Synthetic construct Homo sapiens ubiquitin-c...    69   1e-10   
gb:BT008039_2150971 Synthetic construct Homo sapiens cell divisi...    69   1e-10   
gb:HUMCDC34H_2029964 Human ubiquitin conjugating enzyme mRNA, pa...    69   1e-10   
gb:AL161916_1922265 Human DNA sequence from clone RP4-636O23 on ...    69   1e-10   
gb:AL161916_1922264 Human DNA sequence from clone RP4-636O23 on ...    69   1e-10   
gb:NCB11N2_1689084 Neurospora crassa DNA linkage group V BAC con...    69   1e-10   
pir|A49630|A49630 ubiquitin conjugating enzyme - human (fragment)      69   1e-10   
sp|P62253|UBCG_HUMAN|UBCG_HUMAN Ubiquitin-conjugating enzyme E2 G1 (EC 6.3....    69   1e-10   
sp|Q8CFI2|UBC3_MOUSE|UBC3_MOUSE Ubiquitin-conjugating enzyme E2-32 kDa comp...    69   1e-10   
sp|P49427|UBC3_HUMAN|UBC3_HUMAN Ubiquitin-conjugating enzyme E2-32 kDa comp...    69   1e-10   
gb:BC047985_2549975 Xenopus laevis ubiquitin-conjugating enzyme ...    69   2e-10   
gb:BC045512_2549347 Danio rerio ubiquitin-conjugating enzyme E2G...    69   2e-10   
gb:AF246690_1255183 Dictyostelium discoideum putative E2 enzyme ...    69   2e-10   
gb:BC066702_2554541 Danio rerio zgc:77005, mRNA (cDNA clone MGC:...    68   2e-10   
gb:CNS07EGG_1374140 chromosome X of strain GB-M1 of Encephalitoz...    68   2e-10   
gb:AE016959_1023624 Oryza sativa (japonica cultivar-group) chrom...    68   2e-10   
gb:AY190745_2518063 Pagrus major ubiquitin-conjugating enzyme E2...    68   3e-10   
gb:AY135220_1581755 Pavlova lutheri ubiquitin-conjugating enzyme...    68   3e-10   
gb:BT001441_1356214 Drosophila melanogaster GH25305 full insert ...    68   3e-10   
gb:AB076054_1197628 Brachionus plicatilis ubc mRNA for ubiquitin...    68   3e-10   
gb:AE014297_1139442 Drosophila melanogaster chromosome 3R, compl...    68   3e-10   
pir|E85434|E85434 ubiquitin-protein ligase-like protein [importe...    68   3e-10   
sp|P52484|UBC8_CAEEL|UBC8_CAEEL Probable ubiquitin-conjugating enzyme E2-29...    68   3e-10   
sp|P14682|UBC3_YEAST|UBC3_YEAST Ubiquitin-conjugating enzyme E2-34 kDa (EC ...    68   3e-10   
pir|T15691|T15691 hypothetical protein C28G1.1 - Caenorhabditis ...    67   4e-10   
gb:AB072767_1871285 Macaca fascicularis testis cDNA clone:QtsA-2...    67   6e-10   
gb:AP004040_1836750 Oryza sativa (japonica cultivar-group) genom...    67   6e-10   
gb:AE017344_1756359 Cryptococcus neoformans var. neoformans JEC2...    67   6e-10   
pir|T24069|T24069 hypothetical protein R09B3.4 - Caenorhabditis ...    67   6e-10   
gb:AY071574_1295658 Drosophila melanogaster RE63412 full length ...    67   7e-10   
gb:AC117072_1207694 Dictyostelium discoideum chromosome 2 map 38...    67   7e-10   
gb:BT007635_2150567 Synthetic construct Homo sapiens ubiquitin-c...    66   9e-10   
gb:PFA929357_1393430 Plasmodium falciparum strain 3D7, chromosom...    66   9e-10   
sp|P29340|UBCX_YEAST|UBCX_YEAST Ubiquitin-conjugating enzyme E2-21 kDa (EC ...    66   9e-10   
sp|P50550|UBCI_HUMAN|UBCI_HUMAN Ubiquitin-like protein SUMO-1 conjugating e...    66   9e-10   
gb:AF159230_2057231 Mus musculus E2 ubiquitin conjugating enzyme...    66   1e-09   
gb:AC098695_1736862 Oryza sativa (japonica cultivar-group) chrom...    66   1e-09   
gb:PEU457186_1699894 Populus euramericana mRNA for putative ubiq...    66   1e-09   
gb:AK010942_1156084 Mus musculus 13 days embryo liver cDNA, RIKE...    66   1e-09   
sp|Q9QZU9|UBC8_MOUSE|UBC8_MOUSE Ubiquitin-conjugating enzyme E2-18 kDa UbcH...    66   1e-09   
gb:NBE580839_1688170 Nicotiana benthamiana mRNA for SUMO E2 conj...    65   2e-09   
gb:AF332623_2487971 Danio rerio ubiquitin-conjugating enzyme 9-2...    65   2e-09   
gb:AF128240_2475322 Danio rerio ubiquitin-conjugating enzyme 9 (...    65   2e-09   
gb:AF165420_1773733 Mesembryanthemum crystallinum ubiquitin-conj...    65   2e-09   
gb:AF008910_1761053 Prunus armeniaca ubiquitin-conjugating enzym...    65   2e-09   
pir|H86478|H86478 protein F15O4.3 [imported] - Arabidopsis thali...    65   2e-09   
pir|T50603|T50603 ubiquitin-conjugating enzyme [imported] - Prun...    65   2e-09   
sp|P49428|UBCX_PICPA|UBCX_PICPA Ubiquitin-conjugating enzyme E2-24 kDa (EC ...    65   2e-09   
gb:AE017349_1758720 Cryptococcus neoformans var. neoformans JEC2...    65   3e-09   
pir|T46009|T46009 E2 ubiquitin-conjugating-like enzyme Ahus5 - A...    65   3e-09   
gb:BC008238_2090675 Mus musculus ubiquitin-conjugating enzyme E2...    64   4e-09   
gb:CR380955_1651965 Candida glabrata strain CBS138 chromosome I ...    64   4e-09   
gb:AF126815_1243259 Strongyloides stercoralis ubiquitin conjugat...    64   4e-09   
pir|JC5970|JC5970 nuclear ubiquitin-conjugating enzyme - fruit f...    64   4e-09   
gb:CR382135_1667856 Debaryomyces hansenii chromosome C of strain...    64   5e-09   
gb:CR382129_1661561 Yarrowia lipolytica chromosome C of strain C...    64   5e-09   
gb:AY542996_1334452 Bigelowiella natans ubiquitin conjugating en...    64   5e-09   
gb:BC045309_2549154 Danio rerio zgc:55321, mRNA (cDNA clone MGC:...    64   6e-09   
sp|Q9Y818|UBCF_SCHPO|UBCF_SCHPO Ubiquitin-conjugating enzyme E2 15 (EC 6.3....    64   6e-09   
gb:AL844518_2504580 Zebrafish DNA sequence from clone DKEY-83D9 ...    63   8e-09   
sp|O09181|UBCI_MESAU|UBCI_MESAU Ubiquitin-like protein SUMO-1 conjugating e...    63   8e-09   
gb:AE016815_1746293 Ashbya gossypii (= Eremothecium gossypii) AT...    63   1e-08   
gb:CEY87G2A_1371192 Caenorhabditis elegans YAC Y87G2A, complete ...    63   1e-08   
gb:HSU31882_2023426 Human ubiquitin-conjugating enzyme 9 mRNA, c...    62   2e-08   
gb:AF076597_1239065 Dictyostelium discoideum ubiquitin-conjugati...    62   2e-08   
gb:AE017150_1029736 Trypanosoma brucei chromosome 2, complete se...    62   2e-08   
gb:AE017346_1757562 Cryptococcus neoformans var. neoformans JEC2...    62   2e-08   
gb:CR382133_1666391 Debaryomyces hansenii chromosome A of strain...    62   2e-08   
gb:AY223260_1176722 Schistosoma japonicum clone ZZD446 mRNA sequ...    62   2e-08   
gb:AE014188_968240 Plasmodium falciparum 3D7 chromosome 12, comp...    62   2e-08   
sp|P42747|UBCE_ARATH|UBCE_ARATH Ubiquitin-conjugating enzyme E2 14 (EC 6.3....    62   2e-08   
gb:RICKN6922_1703635 Oryza sativa KN69 mRNA for ubiquitin-conjug...    61   3e-08   
gb:OSJN00086_1694641 Oryza sativa genomic DNA, chromosome 4, BAC...    61   3e-08   
gb:CR382125_1657561 Kluyveromyces lactis strain NRRL Y-1140 chro...    61   3e-08   


>sp|P16577|UBC4_WHEAT Ubiquitin-conjugating enzyme E2-23 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>pir|A34506|A34506 23K ubiquitin carrier
           protein E2 - wheat>gb:WHTUBE2_1727723 Wheat ubiquitin
           carrier protein (E2) mRNA, complete cds.
          Length = 184

 Score =  280 bits (716), Expect = 3e-74
 Identities = 129/184 (70%), Positives = 153/184 (83%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY V+ IND +++F V FHGPK+S+Y+GGVWKVRVEL +AYP
Sbjct: 1   MSSPSKRREMDLMKLMMSDYKVDMINDGMHEFFVHFHGPKDSIYQGGVWKVRVELTEAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPSIGF NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+N+FEVFLPQLLLYPNPSDPL
Sbjct: 61  YKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           NG+AASLMM+DK  Y+ KVKEYCERYAK E+IS ++             G    ++ + G
Sbjct: 121 NGEAASLMMRDKNAYENKVKEYCERYAKPEDISPEEEEEESDEELSDAEGYDSGDEAIMG 180

Query: 267 HADP 256
           HADP
Sbjct: 181 HADP 184



>gb:AF180143_1774802 Glycine max ubiquitin carrier protein 4 (UBC4)
           mRNA, complete cds.
          Length = 183

 Score =  273 bits (698), Expect = 4e-72
 Identities = 131/184 (71%), Positives = 151/184 (82%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY VE IND + +F V FHGP ES Y GGVWKVRVELPDAYP
Sbjct: 1   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFYVHFHGPNESPYHGGVWKVRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFEVFLPQLLLYPNPSDPL
Sbjct: 61  YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           NG+AA+LMM+D+  Y+Q+VKEYCE+YAK E+I                   S S+++VAG
Sbjct: 121 NGEAAALMMRDRATYEQRVKEYCEKYAKPEDIGAATEENSSDEELTEDEYDS-SDEQVAG 179

Query: 267 HADP 256
            ADP
Sbjct: 180 KADP 183



>sp|P42748|UBC4_ARATH Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC
           6.3.2.19) (Ubiquitin- protein ligase 4) (Ubiquitin
           carrier protein 4).>gb:AB006707_1510032 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MYC6.>gb:AY065360_1566472 Arabidopsis thaliana
           putative E2, ubiquitin-conjugating enzyme UBC4
           (At5g41340) mRNA, complete cds.>gb:AY096587_1576127
           Arabidopsis thaliana putative ubiquitin-conjugating
           enzyme E2-21 kD 1 (At5g41340) mRNA, complete cds.
          Length = 187

 Score =  270 bits (689), Expect = 4e-71
 Identities = 128/187 (68%), Positives = 151/187 (80%), Gaps = 3/187 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct: 1   MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct: 61  YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDE--- 277
           NG+AA+LMM+D+  Y+Q+VKEYCE+YAK    S  K            S   D +D+   
Sbjct: 121 NGEAAALMMRDRPAYEQRVKEYCEKYAKPGEGSEDKSSDEELSEEEYGSDNEDDDDDDVA 180

Query: 276 VAGHADP 256
           +AG  DP
Sbjct: 181 IAGKPDP 187



>gb:ATHUBIQUD_1553458 Arabidopsis thaliana ubiquitin conjugating
           enzyme (UBC4) gene, complete cds and flanking regions.
          Length = 187

 Score =  268 bits (686), Expect = 1e-70
 Identities = 128/187 (68%), Positives = 150/187 (80%), Gaps = 3/187 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct: 1   MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct: 61  YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDE--- 277
           NG+AA+LMM+D   Y+Q+VKEYCE+YAK    S  K            S   D +D+   
Sbjct: 121 NGEAAALMMRDHPAYEQRVKEYCEKYAKPGEGSEDKSSDEELSEEEYGSDNEDDDDDDVA 180

Query: 276 VAGHADP 256
           +AG  DP
Sbjct: 181 IAGKPDP 187



>sp|P42749|UBC5_ARATH Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC
           6.3.2.19) (Ubiquitin- protein ligase 5) (Ubiquitin
           carrier protein 5).>gb:AY074347_1567502 Arabidopsis
           thaliana putative E2, ubiquitin-conjugating enzyme UBC5
           (At1g63800) mRNA, complete cds.>gb:AY114061_1578472
           Arabidopsis thaliana putative E2, ubiquitin-conjugating
           enzyme UBC5 (At1g63800) mRNA, complete cds.
          Length = 185

 Score =  267 bits (683), Expect = 2e-70
 Identities = 127/186 (68%), Positives = 151/186 (81%), Gaps = 2/186 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF GPK+S+YEGGVWK+RVELPDAYP
Sbjct: 1   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct: 61  YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEV-- 274
           NG+AA+LMM+D+  Y+Q+VKEYCE+YA K    T++            +   D ED+V  
Sbjct: 121 NGEAAALMMRDRPTYEQRVKEYCEKYA-KPRADTEEMSSDDEMSEDEYASDGDDEDDVAI 179

Query: 273 AGHADP 256
           AG  DP
Sbjct: 180 AGKLDP 185



>pir|S43784|S43784 ubiquitin-protein ligase (EC 6.3.2.19) -
           Arabidopsis thaliana
          Length = 189

 Score =  265 bits (677), Expect = 1e-69
 Identities = 127/189 (67%), Positives = 150/189 (79%), Gaps = 5/189 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF+GPK+SLY+GGVWK+RVELPDAYP
Sbjct: 1   MSSPSKRREMDMMKLMMSDYKVETINDGMQEFYVEFNGPKDSLYQGGVWKIRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+ KI+HPNVDELSGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct: 61  YKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKK---ENISTQKXXXXXXXXXXXXSGQSDSEDE 277
           NG+AA+LMM+D   Y+Q+VKEYCE+YAK    E    +               + D +D+
Sbjct: 121 NGEAAALMMRDHPAYEQRVKEYCEKYAKPGPGEGSEDKSSDEELSEEEYGSDNEDDDDDD 180

Query: 276 V--AGHADP 256
           V  AG  DP
Sbjct: 181 VAIAGKPDP 189



>pir|S43786|S43786 ubiquitin-protein ligase (EC 6.3.2.19) -
           Arabidopsis thaliana
          Length = 187

 Score =  264 bits (675), Expect = 2e-69
 Identities = 126/187 (67%), Positives = 151/187 (80%), Gaps = 3/187 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+M +MKLMMSDY VE IND + +F VEF GPK+S+YEGGVWK+RVELPDAYP
Sbjct: 1   MSSPSKRREMLMMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPL
Sbjct: 61  YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAK-KENISTQKXXXXXXXXXXXXSGQSDSEDEV- 274
           NG+AA+LMM+D+  Y+Q+VKEYCE+YAK +    T++            +   D ED+V 
Sbjct: 121 NGEAAALMMRDRPTYEQRVKEYCEKYAKPRPRADTEEMSSDEEMSEDEYASDGDDEDDVR 180

Query: 273 -AGHADP 256
            AG  DP
Sbjct: 181 IAGKLDP 187



>sp|P42750|UBC6_ARATH Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC
           6.3.2.19) (Ubiquitin- protein ligase 6) (Ubiquitin
           carrier protein 6).>pir|S52661|S52661 ubiquitin-protein
           ligase (EC 6.3.2.19) - Arabidopsis
           thaliana>gb:AC005397_1532672 Arabidopsis thaliana
           chromosome 2 clone T3F17 map CIC02E07, complete
           sequence.>gb:BT005208_1638148 Arabidopsis thaliana
           At2g46030 mRNA, complete cds.
          Length = 183

 Score =  263 bits (672), Expect = 4e-69
 Identities = 120/184 (65%), Positives = 147/184 (79%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           M+SPSKRR+MD+MKLMMSDY V+ +ND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct: 1   MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct: 61  YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           NG+AASL+M+D+  Y+ KVKEYCE+YAK E I +                  D +DE+ G
Sbjct: 121 NGEAASLLMRDRAAYELKVKEYCEKYAKPEEILSD-DDDDDSMSEDGSDSDDDDDDEIVG 179

Query: 267 HADP 256
            ADP
Sbjct: 180 KADP 183



>pir|S43785|S43785 ubiquitin-protein ligase (EC 6.3.2.19) -
           Arabidopsis thaliana
          Length = 185

 Score =  260 bits (665), Expect = 3e-68
 Identities = 120/185 (64%), Positives = 145/185 (78%), Gaps = 1/185 (0%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY V+ +ND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct: 1   MSSPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDP 
Sbjct: 61  YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPF 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKE-NISTQKXXXXXXXXXXXXSGQSDSEDEVA 271
           NG+AASL+M+D+  Y+ KVKEYCE+YAK E                       D +DE+ 
Sbjct: 121 NGEAASLLMRDRAAYELKVKEYCEKYAKPEPEEILSDDDDDDSMSEDGSDSDDDDDDEIV 180

Query: 270 GHADP 256
           G ADP
Sbjct: 181 GKADP 185



>gb:AE016959_1022827 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017099_1752646
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 53 of 77 of the complete sequence.
          Length = 195

 Score =  259 bits (663), Expect = 4e-68
 Identities = 127/196 (64%), Positives = 149/196 (76%), Gaps = 12/196 (6%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY VE +ND + +F VEF GP ES+Y+GGVWKVRVELPDAYP
Sbjct: 1   MSSPSKRREMDLMKLMMSDYKVEMVNDGMQEFFVEFRGPTESIYQGGVWKVRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF------------DLLNVFEVFLP 484
           YKSPSIGF+NKI+HPNVDE+SGSVCLDVINQ+WSPMF            DL+NVFEVFLP
Sbjct: 61  YKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFGEITLVLVIISTDLVNVFEVFLP 120

Query: 483 QLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXX 304
           QLLLYPNPSDPLNG+AA+LMM+D+  Y+QKVKEYCE+YAK E+                 
Sbjct: 121 QLLLYPNPSDPLNGEAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVTPEDKSSDEELSED 180

Query: 303 SGQSDSEDEVAGHADP 256
              S  +D + G+ DP
Sbjct: 181 EDDS-GDDAILGNPDP 195



>gb:ATUBC6_1557439 A.thaliana gene for ubiquitin carrier protein.
          Length = 179

 Score =  245 bits (626), Expect = 9e-64
 Identities = 114/184 (61%), Positives = 142/184 (77%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           M+SPSKRR+MD+MKLMMSDY V+ +ND++  F V FHGP + LY+GGVWK++VELP+AYP
Sbjct: 1   MASPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDGLYQGGVWKIKVELPEAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+W    +L+NVFE FLPQLLLYPNPSDP 
Sbjct: 61  YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTW----NLINVFESFLPQLLLYPNPSDPF 116

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           NG+AASL+M+D+  Y+ KVKEYCE+YAK E I +                  D +DE+ G
Sbjct: 117 NGEAASLLMRDRAAYELKVKEYCEKYAKPEEILSD-DDDDDSMSEDGSDSDDDDDDEIVG 175

Query: 267 HADP 256
            ADP
Sbjct: 176 KADP 179



>pir|A96663|A96663 hypothetical protein T12P18.18 [imported] -
           Arabidopsis thaliana>gb:AE005173_894042 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010852_1537139 Arabidopsis thaliana
           chromosome 1 BAC T12P18 genomic sequence, complete
           sequence.
          Length = 170

 Score =  241 bits (616), Expect = 1e-62
 Identities = 114/171 (66%), Positives = 136/171 (79%), Gaps = 2/171 (1%)
 Frame = -1

Query: 762 MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP 583
           MMSDY VE IND + +F VEF GPK+S+YEGGVWK+RVELPDAYPYKSPS+GF+ KI+HP
Sbjct: 1   MMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHP 60

Query: 582 NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY 403
           NVDE+SGSVCLDVINQ+WSPMFDL+NVFE FLPQLLLYPNPSDPLNG+AA+LMM+D+  Y
Sbjct: 61  NVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPNPSDPLNGEAAALMMRDRPTY 120

Query: 402 DQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEV--AGHADP 256
           +Q+VKEYCE+YA K    T++            +   D ED+V  AG  DP
Sbjct: 121 EQRVKEYCEKYA-KPRADTEEMSSDDEMSEDEYASDGDDEDDVAIAGKLDP 170



>gb:ANUBCA_1819601 A.niger mRNA for ubiquitin conjugating enzyme
           type E2.
          Length = 185

 Score =  229 bits (583), Expect = 8e-59
 Identities = 104/183 (56%), Positives = 133/183 (72%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSP +R + DVMK++MSDY V  +ND + +F V F GP+E+ + GG WK+ VELPD YP
Sbjct: 1   MSSPKRRIETDVMKMLMSDYEVTLVNDNMQEFYVRFKGPEETPFAGGHWKIHVELPDQYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPSIGF+N+IFHPN+DELSGSVCLDVINQ+WSPM+D++N+FEVFLPQLL YPNPSDPL
Sbjct: 61  YKSPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMYDMINIFEVFLPQLLRYPNPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           NG+AA+++M++ K Y+ KVKEY  +YA KE +                       +E AG
Sbjct: 121 NGEAAAMLMREPKSYEAKVKEYVAKYASKEAVDEAGEDTESEDELSSAGSYESGGEEPAG 180

Query: 267 HAD 259
             D
Sbjct: 181 TMD 183



>pir|T50342|T50342 ubiquitin conjugating enzyme [imported] - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPBC211_1719504
           S.pombe chromosome II cosmid c211.
          Length = 184

 Score =  226 bits (577), Expect = 4e-58
 Identities = 106/183 (57%), Positives = 134/183 (73%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSP +R + DVMKL+MSDY V  +ND + +F V FHGP E+ Y GG+WKV VELP  YP
Sbjct: 1   MSSPRRRIETDVMKLLMSDYEVTLVNDNMQEFYVRFHGPSETPYSGGIWKVHVELPSEYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           +KSPSIGF+N+IFHPN+DELSGSVCLDVINQ+WSPMFD++N+FEVFLPQLL YPN SDPL
Sbjct: 61  WKSPSIGFVNRIFHPNIDELSGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNASDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           NG+AA+L++++   Y  KV++Y  RYA KE+                    ++S DE+AG
Sbjct: 121 NGEAAALLLREPNTYYAKVRDYIARYANKEDADITLNDSSDDDTMSSI--DTESGDEIAG 178

Query: 267 HAD 259
             D
Sbjct: 179 PMD 181



>gb:ABUBCA_1529974 A.bisporus mRNA for ubiquitin-conjugating
           protein.
          Length = 181

 Score =  224 bits (570), Expect = 3e-57
 Identities = 101/150 (67%), Positives = 128/150 (85%), Gaps = 1/150 (0%)
 Frame = -1

Query: 804 SSPSKRR-DMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           ++ SKRR + DVMK++MSDY V  +ND + +F V F+GP E+ + GGVWK+ VELPD YP
Sbjct: 4   ANQSKRRIETDVMKMLMSDYEVNLVNDNMQEFYVRFYGPAETPFAGGVWKIHVELPDQYP 63

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           +KSPSIGF+NKIFHPN+DELSGSVCLDVINQ+WS MFD++N+FEVFLPQLL YPNP+DPL
Sbjct: 64  FKSPSIGFMNKIFHPNIDELSGSVCLDVINQTWSAMFDMINIFEVFLPQLLRYPNPNDPL 123

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKE 358
           NG+AA+LMM+  K+YD KVKEY +R+A +E
Sbjct: 124 NGEAAALMMRHPKEYDAKVKEYVQRFATRE 153



>gb:CR382131_1663958 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 170

 Score =  218 bits (554), Expect = 2e-55
 Identities = 96/168 (57%), Positives = 130/168 (77%)
 Frame = -1

Query: 762 MMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHP 583
           +MSDY V  +ND + +F V F GP+E+ ++GG+WK+ VELP+ YPYKSPSIGF+NKIFHP
Sbjct: 3   LMSDYEVTLVNDSMQEFYVRFEGPEETPFQGGIWKIHVELPNEYPYKSPSIGFVNKIFHP 62

Query: 582 NVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQY 403
           N+DELSGSVCLDVINQ+WSPMFD++N+FEVFLPQLL YPNPSDPLNG+A+ ++M++ KQY
Sbjct: 63  NIDELSGSVCLDVINQTWSPMFDMVNIFEVFLPQLLRYPNPSDPLNGEASGMLMREPKQY 122

Query: 402 DQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAGHAD 259
           ++KVK+Y  +YA  +++S +K               SD ++E AG  +
Sbjct: 123 EEKVKDYVTKYASNDSVSAEK-DISDDDDLSSIGSFSDDDEEPAGELE 169



>gb:CR382134_1667230 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 193

 Score =  214 bits (546), Expect = 2e-54
 Identities = 102/155 (65%), Positives = 123/155 (79%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSP +R + DVM LMMSD+ V  I+D I  F+V FHGP ++ Y GG WK+RVELPD YP
Sbjct: 1   MSSPKRRIEKDVMDLMMSDHDVALIDDSIQLFHVIFHGPSDTPYAGGTWKIRVELPDQYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
            KSPSIGF+NKI+HPN+DE SGSVCLDVINQ+WSPMF LLN+FE FLP LL Y NPSDPL
Sbjct: 61  IKSPSIGFINKIYHPNIDETSGSVCLDVINQTWSPMFGLLNIFENFLPHLLRYANPSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQ 343
           N +A++LM KD+K+Y+  VKEY  RYAK  N+S +
Sbjct: 121 NTEASTLMTKDEKKYNDTVKEYVTRYAK--NVSNE 153



>gb:CR380959_1653797 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 214

 Score =  210 bits (534), Expect = 4e-53
 Identities = 97/156 (62%), Positives = 126/156 (80%), Gaps = 1/156 (0%)
 Frame = -1

Query: 807 MSSPSKRR-DMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAY 631
           MS  SKRR + DVMKL+MSD+ VE + D + +F+V+F+GPK++ YEGGVW++ VELPD Y
Sbjct: 1   MSGNSKRRIETDVMKLLMSDHEVELVEDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNY 60

Query: 630 PYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDP 451
           PYKSPSIGF+NKIFHPN+D  SGS+CLDVIN +WSP++DLLN+ E  LP LL  PN SDP
Sbjct: 61  PYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLLNIVEWMLPGLLKEPNGSDP 120

Query: 450 LNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQ 343
           LN +AA+L +KDKK Y++KV+EY ++YA KE   +Q
Sbjct: 121 LNNEAANLQLKDKKVYEEKVREYIDKYATKERYESQ 156



>gb:CR382121_1654748 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 202

 Score =  207 bits (528), Expect = 2e-52
 Identities = 100/186 (53%), Positives = 129/186 (69%), Gaps = 3/186 (1%)
 Frame = -1

Query: 807 MSSPSKRR-DMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAY 631
           MSS SKRR + DVMKL+MSD+ VE + D++ +F+++FHGPK++ YE GVW++ VELPD Y
Sbjct: 1   MSSNSKRRIETDVMKLLMSDHDVELVEDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNY 60

Query: 630 PYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDP 451
           PYKSPSIGF+NKIFHPN+D  SGS+CLDVIN +WSP++DLLN+ E  +P LL  PN SDP
Sbjct: 61  PYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDP 120

Query: 450 LNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQ--KXXXXXXXXXXXXSGQSDSEDE 277
           LN +AA+L +KDK  Y+QK+ EY  +YA KE    Q  K                D  D+
Sbjct: 121 LNNEAATLQLKDKDMYEQKIHEYINKYATKEKYIQQFGKWNSSDDTDDEDEDADMDESDD 180

Query: 276 VAGHAD 259
              H D
Sbjct: 181 EQAHDD 186



>gb:AE017350_1758986 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 234

 Score =  207 bits (527), Expect = 3e-52
 Identities = 91/139 (65%), Positives = 119/139 (85%)
 Frame = -1

Query: 771 MKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKI 592
           MKL+MSDY V  +N+++++F V+F GP E+ +  GVWK+ VELP+ +PYKSPSIGF+NKI
Sbjct: 1   MKLLMSDYDVTLVNNKMSEFFVKFKGPTETPFANGVWKIHVELPEQFPYKSPSIGFMNKI 60

Query: 591 FHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDK 412
           FHPN+DE SGSVCLDVINQ+WSPMF+L+N+FE+FLPQLL YPNP+DPLNG+AASL+M+D 
Sbjct: 61  FHPNIDETSGSVCLDVINQTWSPMFELINIFEIFLPQLLRYPNPADPLNGEAASLLMRDP 120

Query: 411 KQYDQKVKEYCERYAKKEN 355
           K Y +KV+ Y ER+A  E+
Sbjct: 121 KAYAKKVESYVERFASAED 139



>gb:AC011622_1537261 Arabidopsis thaliana chromosome 1 BAC F24D7
           genomic sequence, complete sequence.
          Length = 143

 Score =  207 bits (526), Expect = 3e-52
 Identities = 96/144 (66%), Positives = 115/144 (79%), Gaps = 2/144 (1%)
 Frame = -1

Query: 681 LYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNV 502
           +YEGGVWK+RVELPDAYPYKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMFDL+NV
Sbjct: 1   IYEGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 60

Query: 501 FEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXX 322
           FE FLPQLLLYPNPSDPLNG+AA+LMM+D+  Y+Q+VKEYCE+YA K    T++      
Sbjct: 61  FETFLPQLLLYPNPSDPLNGEAAALMMRDRPTYEQRVKEYCEKYA-KPRADTEEMSSDDE 119

Query: 321 XXXXXXSGQSDSEDEV--AGHADP 256
                 +   D ED+V  AG  DP
Sbjct: 120 MSEDEYASDGDDEDDVAIAGKLDP 143



>gb:AE014185_937906 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014834_1228640 Plasmodium falciparum 3D7
           chromosome 10 section 6 of 7 of the complete sequence.
          Length = 191

 Score =  205 bits (522), Expect = 1e-51
 Identities = 95/150 (63%), Positives = 115/150 (76%)
 Frame = -1

Query: 789 RRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSI 610
           R+  D  KL+M+ Y +E  N     F+V FHGP  + YEGG+WKV V LPD YP+ SPSI
Sbjct: 9   RKQCDFTKLIMAGYDLELNNGSTQDFDVMFHGPNGTAYEGGIWKVHVTLPDDYPFASPSI 68

Query: 609 GFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAAS 430
           GF+NK+ HPNVDE SGSVCLDVINQ+W+P++ L+NVFEVFLPQLL YPNPSDPLN DAAS
Sbjct: 69  GFMNKLLHPNVDEASGSVCLDVINQTWTPLYSLVNVFEVFLPQLLTYPNPSDPLNSDAAS 128

Query: 429 LMMKDKKQYDQKVKEYCERYAKKENISTQK 340
           L+MKDK  Y++KVKEY + YA K+    QK
Sbjct: 129 LLMKDKNIYEEKVKEYVKLYASKDLWEQQK 158



>sp|P28263|UBC8_YEAST Ubiquitin-conjugating enzyme E2-24 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>pir|B53516|B53516 ubiquitin-protein ligase (EC
           6.3.2.19) UBC8 - yeast  (Saccharomyces cerevisiae)
          Length = 218

 Score =  205 bits (521), Expect = 1e-51
 Identities = 96/180 (53%), Positives = 130/180 (72%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSS  +R + DVMKL+MSD+ V+ IND + +F+V+F GPK++ YE GVW++ VELPD YP
Sbjct: 1   MSSSKRRIETDVMKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPSIGF+NKIFHPN+D  SGS+CLDVIN +WSP++DL+N+ E  +P LL  PN SDPL
Sbjct: 61  YKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           N +AA+L ++DKK Y++K+KEY ++YA KE                   G +DS+D  +G
Sbjct: 121 NNEAATLQLRDKKLYEEKIKEYIDKYATKEKYQQM------------FGGDNDSDDSDSG 168



>gb:BC044038_2548444 Xenopus laevis ubiquitin-conjugating enzyme
           E2H, mRNA (cDNA clone MGC:53494 IMAGE:5572446), complete
           cds.>gb:BC075340_2558444 Xenopus tropicalis MGC89025
           protein, mRNA (cDNA clone MGC:89025 IMAGE:7004818),
           complete cds.
          Length = 183

 Score =  201 bits (511), Expect = 2e-50
 Identities = 97/178 (54%), Positives = 130/178 (73%), Gaps = 3/178 (1%)
 Frame = -1

Query: 807 MSSPS---KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           MSSPS   +R D DV+KL+ S + V  +   +N+F V+F+GP+ + YEGGVWKVRV+LPD
Sbjct: 1   MSSPSPGKRRMDTDVVKLIESKHEVTILGG-LNEFIVKFYGPQGTPYEGGVWKVRVDLPD 59

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+KSPSIGF+NKIFHPN+DE SG+VCLDVINQ+W+ ++DL N+FE FLPQLL YPNP 
Sbjct: 60  KYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPI 119

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSE 283
           DPLNGDAA++ +   ++Y QK+KEY ++YA +E +  Q+            S  S+ E
Sbjct: 120 DPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEERTGDSSSESSMSDFSEDE 177



>gb:BT007925_2150857 Synthetic construct Homo sapiens
           ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
           mRNA, partial cds.
          Length = 184

 Score =  201 bits (511), Expect = 2e-50
 Identities = 97/178 (54%), Positives = 130/178 (73%), Gaps = 3/178 (1%)
 Frame = -1

Query: 807 MSSPS---KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           MSSPS   +R D DV+KL+ S + V  +   +N+F V+F+GP+ + YEGGVWKVRV+LPD
Sbjct: 1   MSSPSPGKRRMDTDVVKLIESKHEVTILGG-LNEFVVKFYGPQGTPYEGGVWKVRVDLPD 59

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+KSPSIGF+NKIFHPN+DE SG+VCLDVINQ+W+ ++DL N+FE FLPQLL YPNP 
Sbjct: 60  KYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPI 119

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSE 283
           DPLNGDAA++ +   ++Y QK+KEY ++YA +E +  Q+            S  S+ E
Sbjct: 120 DPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDE 177



>sp|P62256|UBCH_HUMAN Ubiquitin-conjugating enzyme E2 H (EC
           6.3.2.19) (Ubiquitin-protein ligase H) (Ubiquitin
           carrier protein H) (UbcH2)
           (E2-20K).>sp|P62257|UBCH_MOUSE Ubiquitin-conjugating
           enzyme E2 H (EC 6.3.2.19) (Ubiquitin-protein ligase H)
           (Ubiquitin carrier protein H) (UBCH2)
           (E2-20K).>pir|A53516|A53516 ubiquitin-protein ligase (EC
           6.3.2.19) E2H - human>pir|JC4308|JC4308
           ubiquitin-protein ligase (EC 6.3.2.19) -
           mouse>gb:BC006277_1970157 Homo sapiens
           ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast),
           mRNA (cDNA clone MGC:10638 IMAGE:3957107), complete
           cds.>gb:BT006756_1990194 Homo sapiens
           ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast)
           mRNA, complete cds.>gb:HSUCEH1_2027882 H.sapiens (23k/1)
           mRNA for ubiquitin-conjugating enzyme
           UbcH2.>gb:HSUCEH2_2027883 H.sapiens (23k/2) mRNA for
           ubiquitin-conjugating enzyme UbcH2.>gb:BC008517_2090709
           Mus musculus ubiquitin-conjugating enzyme E2H, mRNA
           (cDNA clone MGC:6029 IMAGE:3600233), complete
           cds.>gb:MMU19854_2118819 Mus musculus ubiquitinating
           enzyme E2-20K mRNA, complete cds.>gb:AJ719747_2501934
           Gallus gallus mRNA for hypothetical protein, clone 5p24.
          Length = 183

 Score =  201 bits (511), Expect = 2e-50
 Identities = 97/178 (54%), Positives = 130/178 (73%), Gaps = 3/178 (1%)
 Frame = -1

Query: 807 MSSPS---KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           MSSPS   +R D DV+KL+ S + V  +   +N+F V+F+GP+ + YEGGVWKVRV+LPD
Sbjct: 1   MSSPSPGKRRMDTDVVKLIESKHEVTILGG-LNEFVVKFYGPQGTPYEGGVWKVRVDLPD 59

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+KSPSIGF+NKIFHPN+DE SG+VCLDVINQ+W+ ++DL N+FE FLPQLL YPNP 
Sbjct: 60  KYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPI 119

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSE 283
           DPLNGDAA++ +   ++Y QK+KEY ++YA +E +  Q+            S  S+ E
Sbjct: 120 DPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDE 177



>gb:AL590150_2503675 Zebrafish DNA sequence from clone RP71-3C13 in
           linkage group 4 Contains the 3' end of the ube2h gene
           for ubiquitin-conjugating enzyme E2H (UBC8 homolog,
           yeast), a novel gene, the nrf1 gene for nuclear
           respiratory factor 1 and two CpG islands, complete
           sequence.>gb:BC049139_2550140 Danio rerio
           ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast),
           mRNA (cDNA clone MGC:55756 IMAGE:3816572), complete
           cds.>gb:BX571796_2567688 Zebrafish DNA sequence from
           clone DKEY-180P18 in linkage group 4 Contains the gene
           for a novel protein containing a tetraspanin family
           domain, the gene for a novel protein containing kelch
           motif domains (zgc:55663), the gene for a novel protein
           similar to vertebrate proteasome (prosome, macropain)
           26S subunit, ATPase, 2 (PSMC2) (zgc:63995), the pres
           gene for prestin, the gene for a novel protein similar
           to vertebrate PR domain containing 4 (PRDM4), the gene
           for a novel protein similar to vertebrate aldo-keto
           reductase family 1, the 5' end of the ube2h gene for
           ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast),
           the 3' end of the gene for a novel protein similar to
           vertebrate aldo-keto reductase family 1, member B1
           (aldose reducatse) (AKR1B1), the smoh gene for
           smoothened homolog (Drosophila) and two novel genes,
           complete sequence.
          Length = 183

 Score =  200 bits (509), Expect = 3e-50
 Identities = 94/159 (59%), Positives = 126/159 (79%), Gaps = 3/159 (1%)
 Frame = -1

Query: 807 MSSPS---KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           MSSPS   +R D DV+KL+ S + V  ++  +N+F V+F+GP+ + YEGGVWKVRV+LPD
Sbjct: 1   MSSPSPGKRRMDTDVVKLIESKHEVTILSG-LNEFVVKFYGPQGTPYEGGVWKVRVDLPD 59

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+KSPSIGF+NKIFHPN+DE SG+VCLDVINQ+W+ ++DL N+FE FLPQLL YPNP 
Sbjct: 60  KYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPI 119

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK 340
           DPLNGDAA++ +   + Y QK+KEY ++YA +E +  Q+
Sbjct: 120 DPLNGDAAAMYLHRPEDYKQKIKEYIQKYATEEALKEQE 158



>gb:AE016818_1748104 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 211

 Score =  200 bits (508), Expect = 4e-50
 Identities = 89/155 (57%), Positives = 122/155 (78%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSS  +R + DVMKL+MSD+ VE ++D + +F+V+FHGPK + YE GVW++ VELPD YP
Sbjct: 1   MSSSKRRIETDVMKLLMSDHDVELVDDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPSIGF+NKIFHPN+D  SGS+CLDVIN +WSP++DLLN+ E  +P LL  PN SDPL
Sbjct: 61  YKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQ 343
           N +AA+L +K+ + Y++K++EY ++YA +E    Q
Sbjct: 121 NNEAATLQLKNPQMYEEKIQEYIDKYATEERYVQQ 155



>gb:AY223399_1176859 Schistosoma japonicum clone ZZZ325 mRNA
           sequence.
          Length = 159

 Score =  199 bits (505), Expect = 9e-50
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 3/159 (1%)
 Frame = -1

Query: 807 MSSPS---KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           MSSPS   KR D DV+KL+ S Y V  +   +N+  V+F GP E+ YEGG+WKVRV+LP+
Sbjct: 1   MSSPSPGKKRMDTDVVKLIESKYEVTILGG-LNELMVKFFGPPETPYEGGIWKVRVDLPE 59

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+KSPSIGF+NKIFHPN+DE SG+VCLDVINQ WS ++DL N+FE FLPQLL YPNP+
Sbjct: 60  RYPFKSPSIGFINKIFHPNIDEASGTVCLDVINQQWSALYDLTNIFESFLPQLLAYPNPT 119

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK 340
           DPLN DAASL M    +Y  KVKEY +R+A +E +  ++
Sbjct: 120 DPLNSDAASLFMFKPSEYVIKVKEYVQRFASEEALKAEE 158



>gb:SCE9871_1708250 Saccharomyces cerevisiae chromosome V cosmids
           9871, 8199, 9867, 9495 and lambda clones 6693 and 5898.
          Length = 206

 Score =  194 bits (494), Expect = 2e-48
 Identities = 90/168 (53%), Positives = 122/168 (72%)
 Frame = -1

Query: 771 MKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKI 592
           MKL+MSD+ V+ IND + +F+V+F GPK++ YE GVW++ VELPD YPYKSPSIGF+NKI
Sbjct: 1   MKLLMSDHQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKI 60

Query: 591 FHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDK 412
           FHPN+D  SGS+CLDVIN +WSP++DL+N+ E  +P LL  PN SDPLN +AA+L ++DK
Sbjct: 61  FHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDK 120

Query: 411 KQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
           K Y++K+KEY ++YA KE                   G +DS+D  +G
Sbjct: 121 KLYEEKIKEYIDKYATKEKYQQM------------FGGDNDSDDSDSG 156



>gb:AE014298_1124740 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1124741 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014298_1124742
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003442_1209922 Drosophila melanogaster
           chromosome X, section 26 of 74 of the complete
           sequence.>gb:AE003442_1209923 Drosophila melanogaster
           chromosome X, section 26 of 74 of the complete
           sequence.>gb:AE003442_1209924 Drosophila melanogaster
           chromosome X, section 26 of 74 of the complete
           sequence.>gb:AY061237_1293040 Drosophila melanogaster
           LD17992 full length cDNA.>gb:AY118510_1300232 Drosophila
           melanogaster LD13772 full insert cDNA.
          Length = 183

 Score =  191 bits (486), Expect = 1e-47
 Identities = 94/178 (52%), Positives = 127/178 (71%), Gaps = 3/178 (1%)
 Frame = -1

Query: 807 MSSPS---KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           MSSPS   +R D DV+KL+ S + V  +   +N+F+V+F GP E+ YEGGVWKVRV LPD
Sbjct: 1   MSSPSAGKRRMDNDVIKLIESKHEVTILGG-LNEFHVKFFGPTETPYEGGVWKVRVYLPD 59

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+KSPSIGF+NKI+HPN+DE SG+VCLDVINQ+W+ ++DL N+FE FLPQLL YPNP 
Sbjct: 60  NYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPV 119

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSE 283
           DPLN DAA+L + + ++Y +KV +Y +RYA ++ +   +            S  S+ E
Sbjct: 120 DPLNRDAAALYLHEPEEYHRKVADYVQRYATEDALRAAQQERESSDSESSMSDYSEDE 177



>gb:AC024876_1205044 Caenorhabditis elegans cosmid Y94H6A, complete
           sequence.
          Length = 221

 Score =  182 bits (461), Expect = 1e-44
 Identities = 80/144 (55%), Positives = 113/144 (78%)
 Frame = -1

Query: 792 KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPS 613
           +R D DV+KL+  ++ V+ +N   ++F V FHGPK++ YE GVW++RV++PD YP+KSPS
Sbjct: 10  RRIDCDVVKLISHNHEVQIVNG-CSEFIVRFHGPKDTAYENGVWRIRVDMPDKYPFKSPS 68

Query: 612 IGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAA 433
           IGFLNKIFHPN+DE SG+VCLDVINQ+W+ ++DL N+F+ FLPQLL YPN +DPLNG+AA
Sbjct: 69  IGFLNKIFHPNIDEASGTVCLDVINQAWTALYDLTNIFDTFLPQLLTYPNAADPLNGEAA 128

Query: 432 SLMMKDKKQYDQKVKEYCERYAKK 361
            L +   ++Y +  +EY  R+A +
Sbjct: 129 RLYIHKPEEYRRTCREYVMRFASE 152



>gb:ATHUBIQUE_1553459 Arabidopsis thaliana ubiquitin conjugating
           enzyme (UBC6) gene, complete cds.
          Length = 140

 Score =  176 bits (446), Expect = 6e-43
 Identities = 89/184 (48%), Positives = 109/184 (59%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY V+ +ND++  F V FHGP +SLY+GGVWK++VELP+AYP
Sbjct: 1   MSSPSKRREMDMMKLMMSDYKVDTVNDDLQMFYVTFHGPTDSLYQGGVWKIKVELPEAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+NKI+HPNVDE SG+VCLDVINQ+WSPMF                       
Sbjct: 61  YKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMF----------------------- 97

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEVAG 268
                               EYCE+YAK E I +                  D +DE+ G
Sbjct: 98  --------------------EYCEKYAKPEEILSD-DDDDDSMSEDGSDSDDDDDDEIVG 136

Query: 267 HADP 256
            ADP
Sbjct: 137 KADP 140



>gb:ATHUBIQUF_1553460 Arabidopsis thaliana ubiquitin conjugating
           enzyme (UBC5) gene, complete cds.
          Length = 142

 Score =  176 bits (445), Expect = 8e-43
 Identities = 94/186 (50%), Positives = 111/186 (59%), Gaps = 2/186 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           MSSPSKRR+MD+MKLMMSDY VE IND + +F VEF GPK+S+YEGGVWK+RVELPDAYP
Sbjct: 1   MSSPSKRREMDLMKLMMSDYKVEMINDGMQEFFVEFSGPKDSIYEGGVWKIRVELPDAYP 60

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
           YKSPS+GF+ KI+HPNVDE+SGSVCLDVINQ+WSPMF                       
Sbjct: 61  YKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMF----------------------- 97

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQKXXXXXXXXXXXXSGQSDSEDEV-- 274
                               EYCE+YA K    T++            +   D ED+V  
Sbjct: 98  --------------------EYCEKYA-KPRADTEEMSSDDEMSEDEYASDGDDEDDVRI 136

Query: 273 AGHADP 256
           AG  DP
Sbjct: 137 AGKLDP 142



>gb:CNS07EGF_1373862 chromosome VIII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 171

 Score =  154 bits (389), Expect = 3e-36
 Identities = 70/148 (47%), Positives = 104/148 (70%), Gaps = 3/148 (2%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           ++ KL  ++Y V  I  +  +  V  +GP++S Y G  + V + LPD YP+KSPSIGF  
Sbjct: 11  EIQKLYNANYEVRMIEGKQTQMEVLINGPEDSPYSGAKYIVNILLPDNYPFKSPSIGFTT 70

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           +IFHPNVDE SGS+CLDV+NQ WSP++DLLN+ ++ LPQLL YPN +DPLN +A S+ + 
Sbjct: 71  RIFHPNVDEASGSICLDVLNQIWSPIYDLLNIVDILLPQLLSYPNAADPLNCEAGSMYLN 130

Query: 417 DKKQYDQKVKEYCERY---AKKENISTQ 343
           ++++Y++ V+ Y ++Y   A KE I  +
Sbjct: 131 NREKYNEVVRSYVKKYAIPATKEKIDVE 158



>gb:AE014297_1139148 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003694_1221141 Drosophila melanogaster
           chromosome 3R, section 32 of 118 of the complete
           sequence.>gb:AY089474_1297130 Drosophila melanogaster
           AT28509 full insert cDNA.
          Length = 206

 Score =  136 bits (342), Expect = 7e-31
 Identities = 63/151 (41%), Positives = 96/151 (63%)
 Frame = -1

Query: 792 KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPS 613
           +R D DV +L+ S Y    ++D++   NV   GP  S YEGG+W V V +P  YP  +P 
Sbjct: 16  RRLDRDVNRLLASGYRTT-VDDDMTNLNVCLEGPLGSAYEGGIWTVNVTMPQDYPLTAPR 74

Query: 612 IGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAA 433
           + F+ KI HPN++ ++G VC++V+ Q+WS  +DL+N+FE FLPQLL YPNP D LN  AA
Sbjct: 75  VRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAA 134

Query: 432 SLMMKDKKQYDQKVKEYCERYAKKENISTQK 340
           ++M   ++ + + V    + YA   N+ T++
Sbjct: 135 AIMKHSEQLFREHVILCMKTYAMPANLPTRQ 165



>gb:AY302138_1943017 Homo sapiens ubiquitin-conjugating enzyme
           (UBE2H) mRNA, complete cds; alternatively spliced.
          Length = 152

 Score =  131 bits (329), Expect = 2e-29
 Identities = 72/159 (45%), Positives = 97/159 (61%), Gaps = 3/159 (1%)
 Frame = -1

Query: 807 MSSPS---KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           MSSPS   +R D DV+KL+ S + V  +   +N+F V+F+GP+ + YEGGVWKVRV+LPD
Sbjct: 1   MSSPSPGKRRMDTDVVKLIESKHEVTILGG-LNEFVVKFYGPQGTPYEGGVWKVRVDLPD 59

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+KSPSI                               DL N+FE FLPQLL YPNP 
Sbjct: 60  KYPFKSPSI-------------------------------DLTNIFESFLPQLLAYPNPI 88

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENISTQK 340
           DPLNGDAA++ +   ++Y QK+KEY ++YA +E +  Q+
Sbjct: 89  DPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQE 127



>sp|P52490|UBCC_YEAST Ubiquitin-conjugating enzyme E2 13 (EC
           6.3.2.19) (Ubiquitin-protein ligase 13) (Ubiquitin
           carrier protein 13).>pir|S58092|S58092 hypothetical
           protein YDR092w - yeast (Saccharomyces
           cerevisiae)>gb:SC6652X_1705369 S.cerevisiae chromosome
           IV cosmid 6652.>gb:SCUBC13_1710624 S.cerevisiae UBC13
           gene.
          Length = 153

 Score =  113 bits (282), Expect = 7e-24
 Identities = 59/153 (38%), Positives = 92/153 (60%), Gaps = 3/153 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLM---MSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           M+S  KR   +  KL+   +   T EP +D +  F V   GP++S YE G++++ + LPD
Sbjct: 1   MASLPKRIIKETEKLVSDPVPGITAEPHDDNLRYFQVTIEGPEQSPYEDGIFELELYLPD 60

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP ++P + FL KI+HPN+D L G +CLDV+  +WSP   +  V  + +  LL  PNP+
Sbjct: 61  DYPMEAPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVL-LSIQALLASPNPN 118

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKE 358
           DPL  D A   +K+++    K +E+ + YAKK+
Sbjct: 119 DPLANDVAEDWIKNEQGAKAKAREWTKLYAKKK 151



>gb:CR380953_1650966 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 149

 Score =  112 bits (281), Expect = 9e-24
 Identities = 54/128 (42%), Positives = 79/128 (61%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           T EP  D +  F+V   GP +S YE G++K+ + LP+ YP ++P + FL KI+HPN+D L
Sbjct: 24  TAEPHEDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRL 83

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLDV+  +WSP   +  V  + +  LL  PNP+DPL  D A   +KD+ +  Q  K
Sbjct: 84  -GRICLDVLKTNWSPALQIRTVL-LSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAK 141

Query: 387 EYCERYAK 364
           E+  +YAK
Sbjct: 142 EWTAQYAK 149



>gb:CR382123_1656250 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 159

 Score =  109 bits (272), Expect = 1e-22
 Identities = 54/128 (42%), Positives = 77/128 (60%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           T EP  D +  F V   GP++S YE GV+++ + LPD YP ++P + FL KI+HPN+D L
Sbjct: 24  TAEPHEDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLTKIYHPNIDRL 83

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLDV+  +WSP   +  V  + +  LL  PNP+DPL  D A   +K +     K K
Sbjct: 84  -GRICLDVLKNNWSPALQIRTVL-LSVQALLASPNPNDPLANDVAEEWIKHEDTAIAKAK 141

Query: 387 EYCERYAK 364
           E+ + YAK
Sbjct: 142 EWTKLYAK 149



>gb:AY632078_1342695 Clonorchis sinensis ubiquitin-conjugating
           enzyme mRNA, complete cds.
          Length = 156

 Score =  107 bits (268), Expect = 3e-22
 Identities = 52/154 (33%), Positives = 96/154 (62%), Gaps = 4/154 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR +  +K + +D        P++D +  +N    GP+++ +E G +K+R++  
Sbjct: 1   MSTPAQRRLLRDLKRLQTDPPPGICGSPVDDNVMVWNAVIFGPEDTAFEDGTFKLRLDFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + FL+K+FHPNV    GS+CLD+++ +WSP +D+L +    +  LL  PNP
Sbjct: 61  EEYPNKPPRVVFLSKMFHPNV-YTDGSICLDILSSAWSPTYDVLAIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKE 358
           + P N  AA L ++++++Y+++V+   E    +E
Sbjct: 119 NSPANSLAAQLYVENRREYEKRVRACVEESMYEE 152



>gb:AY223038_1176503 Schistosoma japonicum clone ZZD1166 mRNA
           sequence.
          Length = 154

 Score =  107 bits (268), Expect = 3e-22
 Identities = 53/156 (33%), Positives = 95/156 (60%), Gaps = 4/156 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR +  +K + SD        P+ D +  +N    GP ++ +E G +K+R+E  
Sbjct: 1   MSTPAQRRLLRDLKRLQSDPPPGICGSPVEDNVMVWNAVIFGPDDTAFEDGTFKLRLEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F +K+FHPNV    GS+CLD+++ +WSP +D+L +    +  LL  PNP
Sbjct: 61  EDYPNKPPRVVFTSKMFHPNV-YADGSICLDILSSAWSPTYDVLAIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENI 352
           + P N  AA L ++++++Y+++V+   E    +E++
Sbjct: 119 NSPANSVAAQLYVENRREYEKRVRACVEESWYEEDV 154



>gb:AE016820_1750075 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 154

 Score =  107 bits (266), Expect = 5e-22
 Identities = 56/149 (37%), Positives = 85/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 798 PSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAY 631
           P  +R +   + ++SD     + EP  D +  F+V   GP++S YE GV+++ + LPD Y
Sbjct: 3   PLPKRIIKETERLVSDPVPGISAEPHEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEY 62

Query: 630 PYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDP 451
           P + P + FL KI+HPN+D L G +CLDV+  +WSP   +  V  + +  LL  PNP+DP
Sbjct: 63  PMEPPKVRFLTKIYHPNIDRL-GRICLDVLKTNWSPALQIRTVL-LSIQALLATPNPNDP 120

Query: 450 LNGDAASLMMKDKKQYDQKVKEYCERYAK 364
           L  D A   + D+     K +E+   YAK
Sbjct: 121 LANDVAKDWIADEAAATAKAREWTALYAK 149



>gb:AX406018_1467946 Sequence 433 from Patent WO0222660.
          Length = 181

 Score =  105 bits (261), Expect = 2e-21
 Identities = 47/128 (36%), Positives = 77/128 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + V  P  YP+K P I F  KI+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A +   DK++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWT 142

Query: 378 ERYAKKEN 355
           ++YA  ++
Sbjct: 143 QKYAMSKS 150



>gb:BT007772_2150704 Synthetic construct Homo sapiens
           ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog,
           yeast) mRNA, partial cds.
          Length = 148

 Score =  104 bits (260), Expect = 2e-21
 Identities = 47/124 (37%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + V  P  YP+K P I F  KI+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A +   DK++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>sp|P51668|UB5A_HUMAN Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein) (E2(17)KB 1).>sp|P61080|UB5A_MOUSE
           Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)
           (Ubiquitin- protein ligase) (Ubiquitin carrier protein)
           (E2(17)KB 1).>pir|I39202|I39202 ubiquitin conjugating
           enzyme - human>gb:AF257220_1893203 Homo sapiens
           ubiquitin-conjugating enzyme (UBCH5) mRNA, complete
           cds.>gb:BC005980_1969982 Homo sapiens
           ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog,
           yeast), mRNA (cDNA clone MGC:14673 IMAGE:4106710),
           complete cds.>gb:BC015997_1975433 Homo sapiens
           ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog,
           yeast), mRNA (cDNA clone MGC:27216 IMAGE:4305900),
           complete cds.>gb:BT007041_1990479 Homo sapiens
           ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog,
           yeast) mRNA, complete cds.>gb:HSA272367_2001946 Homo
           sapiens mRNA for ubiquitin-conjugating enzyme (UBCH5
           gene).>gb:HSA293565_2002809 Homo sapiens UBCH5 gene for
           ubiquitin-conjugating enzyme, exons
           1-7.>gb:HSUBCH5_2027860 H.sapiens UBCH5 mRNA for
           ubiquitin conjugating enzyme.>gb:BC019464_2092939 Mus
           musculus ubiquitin-conjugating enzyme E2D 1, UBC4/5
           homolog (yeast), mRNA (cDNA clone MGC:28550
           IMAGE:4205941), complete cds.
          Length = 147

 Score =  104 bits (260), Expect = 2e-21
 Identities = 47/124 (37%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + V  P  YP+K P I F  KI+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A +   DK++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:BT008091_2151023 Synthetic construct Homo sapiens
           ubiquitin-conjugating enzyme E2B (RAD6 homolog) mRNA,
           partial cds.
          Length = 153

 Score =  104 bits (259), Expect = 3e-21
 Identities = 53/149 (35%), Positives = 88/149 (59%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D  V     P  + I ++N    GP+ + +E G +K+ +E  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ FL+K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>gb:AB026055_1516892 Nicotiana tabacum Ntubc1 mRNA for
           ubiquitin-conjugating enzyme (E2), complete
           cds.>gb:AJ879070_1815131 Capsicum chinense mRNA for
           ubiquitin-conjugating enzyme.
          Length = 152

 Score =  104 bits (259), Expect = 3e-21
 Identities = 48/149 (32%), Positives = 92/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPYDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFISRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA +  ++K++Y++KV+E  E+
Sbjct: 119 NSPANSEAARMFSENKREYNRKVREIVEQ 147



>sp|P23567|UBC2_HUMAN Ubiquitin-conjugating enzyme E2 B (EC
           6.3.2.19) (Ubiquitin-protein ligase B) (Ubiquitin
           carrier protein B) (HR6B) (hHR6B) (E2-17
           kDa).>pir|B41222|B41222 ubiquitin-protein ligase (EC
           6.3.2.19) E2B - human>pir|A42416|A42416 ubiquitin
           carrier protein E2 - rabbit>pir|I51913|I51913 14 kDa
           ubiquitin conjugating enzyme - rat>gb:AK010432_1155759
           Mus musculus ES cells cDNA, RIKEN full-length enriched
           library, clone:2410006O05 product:ubiquitin-conjugating
           enzyme E2B, RAD6 homology (S. cerevisiae), full insert
           sequence.>gb:RABUCE_1444173 Oryctolagus cuniculus
           ubiquitin conjugating enzyme mRNA, complete
           cds.>gb:BC005979_1969981 Homo sapiens
           ubiquitin-conjugating enzyme E2B (RAD6 homolog), mRNA
           (cDNA clone MGC:14670 IMAGE:4105643), complete
           cds.>gb:BC008404_1971357 Homo sapiens
           ubiquitin-conjugating enzyme E2B (RAD6 homolog), mRNA
           (cDNA clone MGC:14524 IMAGE:4278820), complete
           cds.>gb:BC008470_1971402 Homo sapiens
           ubiquitin-conjugating enzyme E2B (RAD6 homolog), mRNA
           (cDNA clone MGC:14743 IMAGE:4281004), complete
           cds.>gb:BT007071_1990509 Homo sapiens
           ubiquitin-conjugating enzyme E2B (RAD6 homolog) mRNA,
           complete cds.>gb:CR407634_1992488 Homo sapiens full open
           reading frame cDNA clone RZPDo834E032D for gene UBE2B,
           ubiquitin-conjugating enzyme E2B (RAD6 homolog) complete
           cds, without stopcodon.>gb:HSE2P1_2012802 H.sapiens mRNA
           for E2 protein.>gb:HUMHHR6B_2031927 Human HHR6B (yeast
           RAD 6 homologue) mRNA, complete cds.>gb:AF144083_2056283
           Rattus norvegicus ubiquitin-conjugating enzyme mRNA,
           complete cds.>gb:AH005393S6_2068209 Rattus norvegicus 14
           kDa ubiquitin conjugating enzyme gene, exon 6, partial
           cds.>gb:BC070946_2106393 Rattus norvegicus ubiquitin
           conjugating enzyme, mRNA (cDNA clone MGC:91645
           IMAGE:7103580), complete cds.>gb:MMHR6BGEN_2115393
           M.musculus mRNA for ubiquitin-conjugating
           enzyme.>gb:MMU57690_2122593 Mus musculus
           ubiquitin-conjugating enzyme E214K mRNA, complete
           cds.>gb:RATUCE_2134187 Rattus norvegicus ubiquitin
           conjugating enzyme mRNA, complete cds.
          Length = 152

 Score =  104 bits (259), Expect = 3e-21
 Identities = 53/149 (35%), Positives = 88/149 (59%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D  V     P  + I ++N    GP+ + +E G +K+ +E  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ FL+K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>gb:AP003842_1834083 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1641_C04.>gb:AP004267_1839468 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0039H02.
          Length = 152

 Score =  103 bits (258), Expect = 4e-21
 Identities = 49/149 (32%), Positives = 92/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA L  ++K++Y++KV+E  E+
Sbjct: 119 NSPANSEAARLFSENKREYNRKVREIVEQ 147



>gb:AJ843121_1814506 Plantago major mRNA for Ubiquitin-conjugating
           enzyme (ubc2 gene).
          Length = 152

 Score =  103 bits (258), Expect = 4e-21
 Identities = 49/149 (32%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPYDNNIMIWNAVIFGPDDTPWDGGTFKLTLQFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFISRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA L  ++K+ Y++KV+E  E+
Sbjct: 119 NSPANSEAARLFSENKRDYNRKVREIVEQ 147



>gb:CR382129_1661340 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 150

 Score =  103 bits (257), Expect = 5e-21
 Identities = 54/149 (36%), Positives = 84/149 (56%)
 Frame = -1

Query: 810 RMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAY 631
           R+S  ++R    ++K  +   +  P +D +  F+V   GP  S YEGG +K+ + LP+ Y
Sbjct: 7   RISKETER----LVKEPVPGISAAPHDDNLRYFDVTIDGPTSSPYEGGTFKLELFLPEDY 62

Query: 630 PYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDP 451
           P   P + FL KI+HPN+D L G +CLDV+  +WSP   +  +  + +  LL  PNP DP
Sbjct: 63  PMVPPKVRFLTKIYHPNIDRL-GRICLDVLKSNWSPALQIRTIL-LSIQALLGAPNPDDP 120

Query: 450 LNGDAASLMMKDKKQYDQKVKEYCERYAK 364
           L  D A    +D+K   Q  +++ + YAK
Sbjct: 121 LANDVAQKWKEDEKTAIQTARDWTKEYAK 149



>sp|P25866|UBC2_WHEAT Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>gb:WHTUCP1A_1727724 Wheat ubiquitin carrier
           protein (UBC1) mRNA, complete cds.
          Length = 152

 Score =  103 bits (257), Expect = 5e-21
 Identities = 48/149 (32%), Positives = 92/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNITLWNAVIFGPDDTPWDGGTFKLTLQFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA +  ++K++Y++KV+E  E+
Sbjct: 119 NSPANSEAARMYSENKREYNRKVREVVEQ 147



>gb:BC076728_2559474 Xenopus laevis ubiquitin-conjugating enzyme E2D
           2 (UBC4/5 homolog, yeast), mRNA (cDNA clone MGC:81261
           IMAGE:6631362), complete cds.>gb:BC084849_2564094
           Xenopus laevis hypothetical LOC495381, mRNA (cDNA clone
           MGC:85460 IMAGE:6937002), complete cds.
          Length = 147

 Score =  102 bits (255), Expect = 9e-21
 Identities = 45/124 (36%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  KI+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPTDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A +   DK++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRLAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:BC059465_2552442 Danio rerio zgc:73096, mRNA (cDNA clone
           MGC:73096 IMAGE:4200914), complete cds.
          Length = 147

 Score =  102 bits (255), Expect = 9e-21
 Identities = 45/124 (36%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  KI+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPSDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A +   DK++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPDIAHIYKSDKEKYNRLAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AB079798_1523925 Oryza sativa (japonica cultivar-group) OsRad6
           mRNA for Rad6, complete cds.>gb:AC090871_1734510 Oryza
           sativa chromosome 3 BAC OSJNBb0060J21 genomic sequence,
           complete sequence.
          Length = 152

 Score =  102 bits (255), Expect = 9e-21
 Identities = 49/149 (32%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPHDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPVVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA L  ++K++Y++KV+E  E+
Sbjct: 119 NSPANSEAARLFSENKREYNRKVREIVEQ 147



>gb:AB026056_1516893 Nicotiana tabacum Ntubc2 mRNA for
           ubiquitin-conjugating enzyme (E2), complete cds.
          Length = 152

 Score =  102 bits (255), Expect = 9e-21
 Identities = 47/149 (31%), Positives = 92/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R +   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLVRDFKRLQQDPPAGISGAPYDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFISRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA +  ++K++Y++KV+E  E+
Sbjct: 119 NSPANSEAARMFSENKREYNRKVREIVEQ 147



>gb:AF262934_1781643 Avicennia marina ubiquitin conjugating protein
           (UBC) mRNA, complete cds.
          Length = 152

 Score =  102 bits (254), Expect = 1e-20
 Identities = 47/149 (31%), Positives = 92/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDIAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA +  ++K++Y+++V+E  E+
Sbjct: 119 NSPANSEAARMFSENKREYNRRVREIVEQ 147



>gb:LMFLCHR4B_1388543 Leishmania major Friedlin chromosome 4, right
           end.
          Length = 148

 Score =  102 bits (254), Expect = 1e-20
 Identities = 50/128 (39%), Positives = 74/128 (57%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           T  P  +    F V   GP +S YEGG++++ + LP+ YP K P + FL +I+HPNVD++
Sbjct: 22  TATPTKENPRYFMVTIQGPPQSCYEGGLFRLELFLPEEYPMKPPKVRFLTRIYHPNVDKV 81

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLD+I   WSP   L+N   + +  L+  PNP DPL  D A    +D+    Q  +
Sbjct: 82  -GRICLDIIKDKWSPAL-LINKVLLSIQILMSSPNPDDPLANDVAEHWKEDEASALQTAR 139

Query: 387 EYCERYAK 364
           E+  +YAK
Sbjct: 140 EWTRKYAK 147



>gb:AK011363_1156355 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610009I04
           product:ubiquitin-conjugating enzyme E2B, RAD6 homology
           (S. cerevisiae), full insert sequence.
          Length = 152

 Score =  102 bits (254), Expect = 1e-20
 Identities = 52/149 (34%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++ R M   K +  D  V     P  + I ++N    GP+ + +E G +K+ +E  
Sbjct: 1   MSTPARERLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ FL+K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>gb:BC071066_2555930 Xenopus laevis MGC78891 protein, mRNA (cDNA
           clone MGC:78891 IMAGE:4174331), complete
           cds.>gb:BC077659_2560354 Xenopus tropicalis MGC89687
           protein, mRNA (cDNA clone MGC:89687 IMAGE:7026370),
           complete cds.
          Length = 152

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/149 (34%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D  V     P  + I  +N    GP+ + +E G +K+ +E  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLVIEFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>gb:BC044416_2548725 Danio rerio zgc:55512, mRNA (cDNA clone
           MGC:55512 IMAGE:2641752), complete cds.
          Length = 152

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/149 (34%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D     +  P  + I  +N    GP+ + +E G +K+ VE  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTVEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>gb:AE016814_1745987 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 170

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/149 (34%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K M  D     +  P+ D +  +N    GP ++ YE G +++ +E  
Sbjct: 1   MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + FL+++FHPNV   +G +CLD++   W+P +D+ ++    +  L   PNP
Sbjct: 61  EEYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA+L    K QY ++VKE  E+
Sbjct: 119 ASPANVEAATLFKDHKSQYVKRVKETVEK 147



>gb:CR382137_1670071 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 151

 Score =  102 bits (253), Expect = 2e-20
 Identities = 50/127 (39%), Positives = 72/127 (56%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           T  P  + +  F V   GP  S Y  G++K+ + LPD YP  +P + FL KI+HPN+D+L
Sbjct: 24  TATPSEENLRYFEVTIEGPSSSPYANGLFKLELYLPDDYPMCAPKVRFLTKIYHPNIDKL 83

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLDV+  +WSP   +  +  + +  LL  PNP DPL  D A    KD+K   +  K
Sbjct: 84  -GRICLDVLKDNWSPALQIRTIL-LSVQALLGAPNPDDPLANDVAEDWKKDEKAAIEMAK 141

Query: 387 EYCERYA 367
           E+  +YA
Sbjct: 142 EWTSKYA 148



>gb:CR382123_1655713 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 164

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/149 (34%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K M  D     +  P+ D +  +N    GP ++ YE G +++ +E  
Sbjct: 1   MSTPARRRLMRDFKRMKEDSPPGVSASPLPDNVMIWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + FL+++FHPNV   +G +CLD++   W+P +D+ ++    +  L   PNP
Sbjct: 61  EEYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA+L    K QY ++VKE  E+
Sbjct: 119 ASPANVEAATLFQDHKSQYVKRVKETVEK 147



>sp|P06104|UBC2_YEAST Ubiquitin-conjugating enzyme E2-20 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>pir|A21906|A21906 ubiquitin-conjugating enzyme
           RAD6 - yeast (Saccharomyces
           cerevisiae)>gb:SCYGL058W_1711977 S.cerevisiae chromosome
           VII reading frame ORF YGL058w.>gb:YSCRAD6_1730429 Yeast
           (S.cerevisiae) RAD6 gene, complete cds.
          Length = 172

 Score =  102 bits (253), Expect = 2e-20
 Identities = 52/149 (34%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K M  D     +  P+ D +  +N    GP ++ YE G +++ +E  
Sbjct: 1   MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + FL+++FHPNV   +G +CLD++   W+P +D+ ++    +  L   PNP
Sbjct: 61  EEYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA+L    K QY ++VKE  E+
Sbjct: 119 ASPANVEAATLFKDHKSQYVKRVKETVEK 147



>gb:CR380955_1651531 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 167

 Score =  101 bits (252), Expect = 2e-20
 Identities = 52/149 (34%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K M  D     +  P+ D +  +N    GP ++ YE G +++ +E  
Sbjct: 1   MSTPARRRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + FL+++FHPNV   +G +CLD++   W+P +D+ ++    +  L   PNP
Sbjct: 61  EDYPNKPPHVKFLSEMFHPNV-YANGEICLDILQNRWTPTYDVASIL-TSIQSLFNDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA+L    K QY ++VKE  E+
Sbjct: 119 ASPANVEAATLFKDHKSQYIKRVKETVEK 147



>gb:AY048267_1561728 Arabidopsis thaliana AT5g62540/K19B1_15 mRNA,
           complete cds.
          Length = 146

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/148 (34%), Positives = 89/148 (60%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           M++P+K+R M  +K +  D  V     P ++ I  +N    GP+++ ++GG +K+ +   
Sbjct: 1   MTTPAKKRLMWDLKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++++FHPN+    GS+CLD++   WSP++D+  V    +  LL  PNP
Sbjct: 61  EDYPNKPPIVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAVL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
             P N +AA L  ++K++Y++KV E  E
Sbjct: 119 DSPANAEAARLFSENKREYNRKVIEIVE 146



>gb:AY826157_1180117 Aedes albopictus clone AL_336 ubiquitin
           conjugating enzyme E2 mRNA, complete cds.
          Length = 152

 Score =  101 bits (252), Expect = 2e-20
 Identities = 54/154 (35%), Positives = 88/154 (57%), Gaps = 3/154 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYT-VEPINDEINK--FNVEFHGPKESLYEGGVWKVRVELPD 637
           M++  +R   +  +LM      +  + DE N   F+V   GP++S +EGG++K+ + LP+
Sbjct: 1   MAALPRRIIKETQRLMQEPVPGISAVPDEQNARYFHVIVFGPEDSPFEGGLFKLELFLPE 60

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP  +P + F+ KI+HPN+D L G +CLD++   WSP   +  V  + +  LL  PNP 
Sbjct: 61  DYPMSAPKVRFITKIYHPNIDRL-GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPD 118

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKEN 355
           DPL  D A L   ++ +  +  KE+ +RYA  +N
Sbjct: 119 DPLANDVAELWKVNEAEAIRNAKEWTQRYAIVDN 152



>sp|P49459|UBCA_HUMAN Ubiquitin-conjugating enzyme E2 A (EC
           6.3.2.19) (Ubiquitin-protein ligase A) (Ubiquitin
           carrier protein A) (HR6A) (hHR6A).>sp|Q9Z255|UBCA_MOUSE
           Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)
           (Ubiquitin-protein ligase A) (Ubiquitin carrier protein
           A) (HR6A) (mHR6A).>gb:BC010175_1972541 Homo sapiens
           ubiquitin-conjugating enzyme E2A (RAD6 homolog),
           transcript variant 1, mRNA (cDNA clone MGC:20175
           IMAGE:3051041), complete cds.>gb:AF089812_2054054 Mus
           musculus ubiquitin-conjugating enzyme HR6A mRNA,
           complete cds.>gb:AF383148_2064586 Mus musculus
           ubiquitin-conjugating enzyme HR6A mRNA, complete
           cds.>gb:BC026053_2095252 Mus musculus
           ubiquitin-conjugating enzyme E2A, RAD6 homolog (S.
           cerevisiae), mRNA (cDNA clone MGC:13793 IMAGE:4012075),
           complete cds.>gb:AF120212_2475090 Gallus gallus
           ubiquitin-conjugating enzyme mRNA, complete
           cds.>gb:AL590151_2503679 Zebrafish DNA sequence from
           clone RP71-46J2 in linkage group 14 Contains genes for a
           novel mitochondrial carrier protein, the slc25a5 gene
           for solute carrier family 25 alpha, member 5, a novel
           ubiquitin-conjugating enzyme, a novel protein similar to
           human transcription factor NRF, a novel protein similar
           to vertebrate arrestin, a novel protein similar to human
           inositol polyphosphate phosphatase-like protein 1
           (INPPL1), a novel protein similar to nucleotide
           receptors, part of a novel gene, a novel gene and two
           CpG islands, complete sequence.>gb:BC053256_2550648
           Danio rerio ubiquitin-conjugating enzyme E2A (RAD6
           homolog), mRNA (cDNA clone MGC:64109 IMAGE:6795152),
           complete cds.>gb:BC059970_2552750 Xenopus laevis
           hypothetical protein MGC68540, mRNA (cDNA clone
           MGC:68540 IMAGE:4031136), complete
           cds.>gb:BC074715_2558208 Xenopus tropicalis MGC69378
           protein, mRNA (cDNA clone MGC:69378 IMAGE:5335213),
           complete cds.
          Length = 152

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/149 (34%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D     +  P  + I  +N    GP+ + +E G +K+ +E  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>sp|P35128|UBC3_DROME Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein) (Bendless protein).>pir|S35793|S35793 gene
           bendless protein - fruit fly (Drosophila
           melanogaster)>gb:AE014298_1125580 Drosophila
           melanogaster chromosome X, complete
           sequence.>gb:AE003494_1212589 Drosophila melanogaster
           chromosome X, section 46 of 74 of the complete
           sequence.>gb:AY069527_1294257 Drosophila melanogaster
           LD24448 full length cDNA.>gb:DROBENDLS_1381769
           Drosophila melanogaster bendless mRNA, complete
           cds.>gb:S70118_1396804 ben=benless [Drosophila
           melanogaster, pupa, mRNA, 1850 nt].
          Length = 151

 Score =  101 bits (252), Expect = 2e-20
 Identities = 55/153 (35%), Positives = 87/153 (56%), Gaps = 3/153 (1%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYT-VEPINDEINK--FNVEFHGPKESLYEGGVWKVRVELPD 637
           MSS  +R   +  +LM      +  I DE N   F+V   GP +S +EGGV+K+ + LP+
Sbjct: 1   MSSLPRRIIKETQRLMQEPVPGINAIPDENNARYFHVIVTGPNDSPFEGGVFKLELFLPE 60

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP  +P + F+ KI+HPN+D L G +CLDV+   WSP   +  +  + +  LL  PNP 
Sbjct: 61  DYPMSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIRTIL-LSIQALLSAPNPD 118

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYAKKE 358
           DPL  D A L   ++ +  +  +E+ ++YA ++
Sbjct: 119 DPLANDVAELWKVNEAEAIRNAREWTQKYAVED 151



>sp|P35130|UBC2_MEDSA Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>gb:ALFUBIQUIT_1819014 Medicago sativa
           ubiquitin carrier protein mRNA, complete cds.
          Length = 152

 Score =  101 bits (252), Expect = 2e-20
 Identities = 47/149 (31%), Positives = 92/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQHDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA +  ++K++Y+++V+E  E+
Sbjct: 119 NSPANSEAARMFSENKREYNRRVREVVEQ 147



>sp|P42745|UBC2_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC
           6.3.2.19) (Ubiquitin- protein ligase 2) (Ubiquitin
           carrier protein 2).>pir|S43783|S43783
           ubiquitin-conjugating enzyme UBC2 - Arabidopsis
           thaliana>gb:AC002521_1530804 Arabidopsis thaliana
           chromosome 2 clone T20F6 map CIC11A04, complete
           sequence.>gb:ATHUBIQUC_1553457 Arabidopsis thaliana
           16kDa ubiquitin conjugating enzyme (UBC2) gene, complete
           cds.>gb:ATUBC2_1557438 A.thaliana mRNA for ubiquitin
           conjugating enzyme UBC2.>gb:AY072479_1567296 Arabidopsis
           thaliana putative ubiquitin-conjugating enzyme E2
           (At2g02760; T20F6.10) mRNA, complete
           cds.>gb:AF370558_1792343 Arabidopsis thaliana putative
           ubiquitin-conjugating enzyme E2 (At2g02760; T20F6.10)
           mRNA, complete cds.
          Length = 152

 Score =  101 bits (252), Expect = 2e-20
 Identities = 47/149 (31%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA +  + K++Y+++V+E  E+
Sbjct: 119 NSPANSEAARMFSESKREYNRRVREVVEQ 147



>sp|P52478|UBC1_CAEEL Ubiquitin-conjugating enzyme E2-21.5 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>gb:AF045638_1236244 Caenorhabditis elegans
           cosmid C35B1, complete sequence.>gb:CEU08139_1368391
           Caenorhabditis elegans Bristol RAD6 homolog (ubc-1)
           gene, complete cds.
          Length = 192

 Score =  101 bits (252), Expect = 2e-20
 Identities = 51/149 (34%), Positives = 88/149 (59%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           M++PS+RR M   K +  D     +  P  D I  +     GP+E+ +E G +K+ +E  
Sbjct: 1   MTTPSRRRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+  +    +  LL  PNP
Sbjct: 61  EEYPNKPPTVKFISKMFHPNV-YADGSICLDILQNRWSPTYDVAAIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  +++++Y+++V++  E+
Sbjct: 119 NSPANSLAAQLYQENRREYEKRVQQIVEQ 147



>gb:AF508551_2498590 Fundulus heteroclitus ubiquitin conjugating
           enzyme E2A mRNA, complete cds.>gb:AY190722_2518040
           Pagrus major ubiquitin-conjugating enzyme E2A mRNA,
           complete cds.
          Length = 152

 Score =  101 bits (251), Expect = 3e-20
 Identities = 52/149 (34%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D     +  P  + I  +N    GP+ + +E G +K+ VE  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTFKLIVEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>pir|A48145|A48145 ubiquitin-conjugating enzyme ubc-2 -
           Caenorhabditis elegans
          Length = 147

 Score =  101 bits (251), Expect = 3e-20
 Identities = 44/124 (35%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP ES Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+++Y+Q  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>sp|P42746|UBC3_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC
           6.3.2.19) (Ubiquitin- protein ligase 3) (Ubiquitin
           carrier protein 3).>pir|S43782|S43782
           ubiquitin-conjugating enzyme UBC3 - Arabidopsis
           thaliana>gb:AB015469_1512513 Arabidopsis thaliana
           genomic DNA, chromosome 5, TAC
           clone:K19B1.>gb:ATHUBIQUB_1553456 Arabidopsis thaliana
           16kDa ubiquitin conjugating enzyme (UBC3) gene, complete
           cds and flanking regions.>gb:AY039851_1560365
           Arabidopsis thaliana AT5g62540/K19B1_15 mRNA, complete
           cds.>gb:AY085367_1570438 Arabidopsis thaliana clone
           148141 mRNA, complete sequence.
          Length = 150

 Score =  101 bits (251), Expect = 3e-20
 Identities = 51/149 (34%), Positives = 89/149 (59%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           M++P+K+R M   K +  D  V     P ++ I  +N    GP+++ ++GG +K+ +   
Sbjct: 1   MTTPAKKRLMWDFKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++++FHPN+    GS+CLD++   WSP++D+  V    +  LL  PNP
Sbjct: 61  EDYPNKPPIVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAVL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
             P N +AA L  ++K++Y++KV E  E+
Sbjct: 119 DSPANAEAARLFSENKREYNRKVIEIVEQ 147



>sp|P35129|UBC2_CAEEL Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>pir|T23820|T23820 hypothetical protein M7.1 -
           Caenorhabditis elegans>gb:CEM7_1366326 Caenorhabditis
           elegans cosmid M7, complete sequence.>gb:S56051_1396634
           Caenorhabditis elegans ubiquitin-conjugating enzyme
           (ubc-2) gene, complete cds.
          Length = 147

 Score =  101 bits (251), Expect = 3e-20
 Identities = 44/124 (35%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP ES Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+++Y+Q  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:CR382132_1665038 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 210

 Score =  100 bits (250), Expect = 3e-20
 Identities = 46/138 (33%), Positives = 82/138 (59%), Gaps = 1/138 (0%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPIND-EINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFL 601
           DV     +  T++ IND +I+     FHGP  + Y+GG + V +++P+ YP+K P + F 
Sbjct: 13  DVRSDSEAGITIQAINDADISHLKGTFHGPPGTPYQGGTFVVDIQIPNDYPFKPPRMKFD 72

Query: 600 NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMM 421
            +I+HPN+   +G++CLD++  +WSP+F L +   + L  LL    P+DP + + A + +
Sbjct: 73  TRIYHPNISSQTGAICLDILKDAWSPVFTLKSSL-ISLQSLLQSAEPNDPQDAEVAKIYL 131

Query: 420 KDKKQYDQKVKEYCERYA 367
            DK  +++   E+  +YA
Sbjct: 132 TDKAAFERTAAEWTAQYA 149



>gb:AY143805_1583262 Arabidopsis thaliana At5g62540/K19B1_15 mRNA,
           complete cds.
          Length = 146

 Score =  100 bits (250), Expect = 3e-20
 Identities = 51/148 (34%), Positives = 88/148 (59%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           M++P+K+R M   K +  D  V     P ++ I  +N    GP+++ ++GG +K+ +   
Sbjct: 1   MTTPAKKRLMWDFKRLQKDPPVGISGAPQDNNIMHWNALIFGPEDTPWDGGTFKLTLHFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++++FHPN+    GS+CLD++   WSP++D+  V    +  LL  PNP
Sbjct: 61  EDYPNKPPIVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAVL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
             P N +AA L  ++K++Y++KV E  E
Sbjct: 119 DSPANAEAARLFSENKREYNRKVIEIVE 146



>pir|A39392|A39392 RAD6 DNA-repair homolog Dhr6 - fruit fly
           (Drosophila melanogaster)>gb:DRO6DHR_1381557
           D.melanogaster homolog of RAD6 (DHR6) mRNA, complete
           cds.>gb:DRO6DHR2_1381558 D.melanogaster homolog of RAD6
           (DHR6) gene, exons 2 and 3.
          Length = 151

 Score =  100 bits (250), Expect = 3e-20
 Identities = 50/149 (33%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D     +  P ++ I  +N    GP ++ +E G +K+ +E  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    G +CLD++   WSP +D+  +    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKVFHPNV-YADGGICLDILQNRWSPRYDVSAIL-TSIQSLLSDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  +++++Y+++VK   E+
Sbjct: 119 NSPANSTAAQLYKENRREYEKRVKACVEQ 147



>sp|P25153|UBC6_DROME Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>gb:AE014297_1137901 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003604_1217515
           Drosophila melanogaster chromosome 3R, section 4 of 118
           of the complete sequence.>gb:BT003481_1356883 Drosophila
           melanogaster RE56673 full insert cDNA.
          Length = 151

 Score =  100 bits (250), Expect = 3e-20
 Identities = 50/149 (33%), Positives = 87/149 (58%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D     +  P ++ I  +N    GP ++ +E G +K+ +E  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    G +CLD++   WSP +D+  +    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKVFHPNV-YADGGICLDILQNRWSPTYDVSAIL-TSIQSLLSDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  +++++Y+++VK   E+
Sbjct: 119 NSPANSTAAQLYKENRREYEKRVKACVEQ 147



>gb:AF091621_1767451 Catharanthus roseus ubiquitin-conjugating
           enzyme E2 (UBIE2) mRNA, complete cds.
          Length = 153

 Score =  100 bits (249), Expect = 5e-20
 Identities = 49/127 (38%), Positives = 73/127 (57%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           +  P  D +  FNV   GP +S YEGGV+K+ + LP+ YP   P + FL KI+HPN+D+L
Sbjct: 26  SASPSEDNMRDFNVMILGPAQSPYEGGVFKLELFLPEEYPMAPPKVRFLTKIYHPNIDKL 85

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLD++   WSP   +  V  + +  LL  PNP DPL+ + A     ++ +  +  K
Sbjct: 86  -GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAK 143

Query: 387 EYCERYA 367
           E+   YA
Sbjct: 144 EWTRLYA 150



>gb:AE017341_1754626 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 169

 Score =  100 bits (249), Expect = 5e-20
 Identities = 53/148 (35%), Positives = 87/148 (58%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV----EPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ +KRR +   K + SD  +     P  D I  +N    GP E+ +E G +++ +   
Sbjct: 1   MSTAAKRRLIRDFKRLTSDAPIGISGSPNPDNIMVWNAVIFGPPETPFEDGSFRLTLTFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           DAYP K P++ F++K+FHPN+   +G +CLD++   WSP +D+  +    +  LL  PNP
Sbjct: 61  DAYPNKPPTVRFISKMFHPNI-YANGELCLDILQNRWSPTYDVAAIL-TSVQSLLNDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
           + P N DAA L  ++ K+Y+++VK+  E
Sbjct: 119 ASPANVDAAQLFKENLKEYERRVKKTVE 146



>gb:SPBC2D10_1719790 S.pombe chromosome II cosmid c2D10.
          Length = 217

 Score =  100 bits (249), Expect = 5e-20
 Identities = 46/137 (33%), Positives = 80/137 (58%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           DV +   +   V  IND+I+     F GP+ + YEGG + V +E+P  YP++ P + F  
Sbjct: 15  DVQQDKQAGIQVWTINDDISHLKGMFRGPEGTPYEGGYFVVDIEIPIDYPFRPPKMNFDT 74

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           KI+HPNV   +G++CLD++   WSP++ + +   + L  LL  P PS+P +   A + ++
Sbjct: 75  KIYHPNVSSQTGAICLDILKDQWSPVYTMKSAL-ISLQSLLCTPEPSNPQDAQVAQVYLQ 133

Query: 417 DKKQYDQKVKEYCERYA 367
           + +Q+ +  +E+   YA
Sbjct: 134 NYQQFVRTAREWTSSYA 150



>sp|O13685|UBCC_SCHPO Ubiquitin-conjugating enzyme E2 13 (EC
           6.3.2.19) (Ubiquitin-protein ligase 13) (Ubiquitin
           carrier protein 13).>pir|T37532|T37532
           ubiquitin-conjugating enzyme - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC11E3_1716348 S.pombe
           chromosome I cosmid c11E3.>gb:AF470232_1802763
           Schizosaccharomyces pombe ubiquitin conjugating enzyme
           Spu13 mRNA, complete cds.
          Length = 148

 Score =  100 bits (249), Expect = 5e-20
 Identities = 46/124 (37%), Positives = 73/124 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P  D +  F +   GP++S YEGG + + + LPD YP   P++ FL KI+HPNVD+L G 
Sbjct: 26  PTEDNLRYFKITMEGPQQSAYEGGKFHLELFLPDEYPMMPPNVRFLTKIYHPNVDKL-GR 84

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CL  + + WSP   +  V  + +  L+  PNP DPL+ D A +  +++ Q     +E+ 
Sbjct: 85  ICLSTLKKDWSPALQIRTVL-LSIQALMGAPNPDDPLDNDVAKIWKENEPQAIANAREWT 143

Query: 378 ERYA 367
           ++YA
Sbjct: 144 KKYA 147



>gb:BC055599_2551463 Danio rerio zgc:66323, mRNA (cDNA clone
           MGC:66323 IMAGE:5601898), complete cds.
          Length = 147

 Score =  100 bits (248), Expect = 6e-20
 Identities = 46/137 (33%), Positives = 79/137 (57%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ +   S  +  P+ +++  +     GP +S Y+GGV+ + +  P  YP+K P + F  
Sbjct: 12  DLQRDPPSQCSAGPLGEDLFHWQATIMGPGDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           KI+HPN++  +GS+CLD++   WSP   +  V  + +  LL  PNP DPL  D A +   
Sbjct: 72  KIYHPNINS-NGSICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPDIAHIYKS 129

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y++  +E+ ++YA
Sbjct: 130 DKDKYNRLAREWTQKYA 146



>gb:AY049261_1561903 Arabidopsis thaliana At1g78870/F9K20_8 mRNA,
           complete cds.>gb:AY085854_1570918 Arabidopsis thaliana
           clone 19071 mRNA, complete sequence.>gb:BT000544_1634822
           Arabidopsis thaliana putative ubiquitin-conjugating
           enzyme E2 (At1g78870/F9K20_8) mRNA, complete cds.
          Length = 153

 Score =  100 bits (248), Expect = 6e-20
 Identities = 49/127 (38%), Positives = 73/127 (57%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           +  P  D +  FNV   GP +S YEGGV+K+ + LP+ YP  +P + FL KI+HPN+D+L
Sbjct: 26  SASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKL 85

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLD++   WSP   +  V  + +  LL  PNP DPL+ + A     ++ +     K
Sbjct: 86  -GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLSENIAKHWKSNEAEAVDTAK 143

Query: 387 EYCERYA 367
           E+   YA
Sbjct: 144 EWTRLYA 150



>sp|P35133|UBCA_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 10/12
           (EC 6.3.2.19) (Ubiquitin- protein ligase 10/12)
           (Ubiquitin carrier protein 10/12).>pir|S32672|S32672
           ubiquitin-protein ligase (EC 6.3.2.19) UBC10 -
           Arabidopsis thaliana>gb:AB013388_1512030 Arabidopsis
           thaliana genomic DNA, chromosome 5, TAC
           clone:K19E1.>gb:ATHUBCC_1553453 Arabidopsis thaliana
           ubiquitin conjugating enzyme mRNA, complete
           cds.>gb:ATUBC10_1557436 A.thaliana UBC10 mRNA for
           ubiquitin conjugating enzyme
           homolog.>gb:AY039566_1560279 Arabidopsis thaliana
           AT5g53300/K19E1_10 mRNA, complete
           cds.>gb:AY065059_1566214 Arabidopsis thaliana
           AT5g53300/K19E1_10 mRNA, complete
           cds.>gb:AY113937_1578348 Arabidopsis thaliana putative
           E2, ubiquitin-conjugating enzyme UBC10 (At5g53300) mRNA,
           complete cds.>gb:AY129488_1581139 Arabidopsis thaliana
           AT5g53300/K19E1_10 mRNA, complete
           cds.>gb:AF324718_1786430 Arabidopsis thaliana AT5g53300
           (AT5g53300/K19E1_10) mRNA, complete
           cds.>gb:AF325005_1786459 Arabidopsis thaliana AT5g53300
           (AT5g53300/K19E1_10) mRNA, complete
           cds.>gb:AF326872_1786732 Arabidopsis thaliana putative
           E2, ubiquitin-conjugating enzyme UBC10 (At5g53300) mRNA,
           complete cds.
          Length = 148

 Score =  100 bits (248), Expect = 6e-20
 Identities = 46/137 (33%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP ES Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y+   + + ++YA
Sbjct: 130 DKNKYESTARSWTQKYA 146



>sp|P25865|UBC1_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC
           6.3.2.19) (Ubiquitin- protein ligase 1) (Ubiquitin
           carrier protein 1).>pir|S43781|S43781
           ubiquitin-conjugating enzyme UBC1 - Arabidopsis
           thaliana>gb:AE005172_890433 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATHUBIQUA_1553455 Arabidopsis thaliana
           16kDa ubiquitin conjugating enzyme (UBC1) gene, complete
           cds.>gb:ATHUCP1B_1553463 Arabidopsis thaliana ubiquitin
           carrier protein (UBC1) mRNA, complete
           cds.>gb:AY070074_1566716 Arabidopsis thaliana putative
           E2, ubiquitin-conjugating enzyme UBC1 (At1g14400) mRNA,
           complete cds.>gb:AY085783_1570849 Arabidopsis thaliana
           clone 18146 mRNA, complete sequence.>gb:AY091330_1574534
           Arabidopsis thaliana putative ubiquitin-conjugating
           enzyme 1 (UBC1) (At1g14400) mRNA, complete
           cds.>gb:F14L17_1677458 Sequence of BAC F14L17 from
           Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF332451_1787263 Arabidopsis thaliana
           putative E2, ubiquitin-conjugating enzyme 1 (At1g14400)
           mRNA, complete cds.
          Length = 152

 Score =  100 bits (248), Expect = 6e-20
 Identities = 46/149 (30%), Positives = 91/149 (61%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+++R M   K +  D     +  P ++ I  +N    GP ++ ++GG +K+ ++  
Sbjct: 1   MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLSLQFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP
Sbjct: 61  EDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N +AA +  + K++Y+++V++  E+
Sbjct: 119 NSPANSEAARMYSESKREYNRRVRDVVEQ 147



>gb:AP003223_1825567 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0007F06.>gb:AP003264_1826689 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0485G01.
          Length = 153

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 48/127 (37%), Positives = 74/127 (58%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           +  P  + +  FNV   GP +S YEGGV+K+ + LP+ YP  +P + FL KI+HPN+D+L
Sbjct: 26  SASPSEENMRYFNVMILGPAQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKL 85

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLD++   WSP   +  V  + +  LL  PNP DPL+ + A     ++ +  +  K
Sbjct: 86  -GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLSDNIAKHWKANEAEAVETAK 143

Query: 387 EYCERYA 367
           E+   YA
Sbjct: 144 EWTRLYA 150



>gb:AY086447_1571495 Arabidopsis thaliana clone 25162 mRNA, complete
           sequence.
          Length = 148

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 46/137 (33%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP ES Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y+   + + + YA
Sbjct: 130 DKNKYESTARSWTQEYA 146



>gb:CNS07EGG_1374116 chromosome X of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 162

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 49/145 (33%), Positives = 85/145 (58%), Gaps = 4/145 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+KRR M  +K +          EP+ D++  +     GP  + +EGG + + +  P
Sbjct: 1   MSTPAKRRLMKDLKRVRKSPCRTIFAEPLEDDLMTWAAVIFGPDSTPFEGGTFSLVLTFP 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP   P++ F++++FHPN+   +G +CLD+++  W+P +D++ V  + +  LL  PN 
Sbjct: 61  ETYPQDPPAVRFVSEMFHPNIYP-NGELCLDILSNRWNPSYDVIGVL-ISIQSLLNDPNT 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKE 385
           + P N DAASL   D + Y +KVK+
Sbjct: 119 TSPANTDAASLFSTDPRSYARKVKD 143



>pir|C86304|C86304 probable ubiquitin-conjugating enzyme E2
           [imported] - Arabidopsis thaliana>gb:AE005172_890664
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AC051629_1540079 Arabidopsis thaliana
           chromosome I BAC F6I1 genomic sequence, complete
           sequence.>gb:AY052307_1562680 Arabidopsis thaliana
           At1g16890/F17F16.16 mRNA, complete
           cds.>gb:AY061926_1564945 Arabidopsis thaliana
           At1g16890/F17F16.16 mRNA, complete
           cds.>gb:AY086780_1571823 Arabidopsis thaliana clone 2763
           mRNA, complete sequence.
          Length = 153

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 48/127 (37%), Positives = 74/127 (58%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           +  P  + +  FNV   GP +S YEGGV+K+ + LP+ YP  +P + FL KI+HPN+D+L
Sbjct: 26  SASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKL 85

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLD++   WSP   +  V  + +  LL  PNP DPL+ + A     ++ +  +  K
Sbjct: 86  -GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAK 143

Query: 387 EYCERYA 367
           E+   YA
Sbjct: 144 EWTRLYA 150



>gb:BC047863_2549945 Danio rerio zgc:56340, mRNA (cDNA clone
           MGC:56340 IMAGE:5604009), complete cds.
          Length = 147

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 43/124 (34%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP ES Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDVFHWQATIMGPNESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D ++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDTEKYNRIAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:BC048523_2099700 Mus musculus Similar to ubiquitin-conjugating
           enzyme E2D 2, mRNA (cDNA clone MGC:58426 IMAGE:6742435),
           complete cds.
          Length = 147

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 43/124 (34%), Positives = 77/124 (62%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ + +  +     GP++S Y+GGV+ + +  P+ YP+K P + F+ +I+HPN+ + +GS
Sbjct: 25  PVAENMFHWQATIMGPEDSPYQGGVFFLSIHFPNNYPFKPPKVSFITRIYHPNISK-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++N  WSP   +  V  + +  LL  PN  DPL  + A +  KD ++Y++  +E+ 
Sbjct: 84  ICLDILNSKWSPTLTISKVL-LSICSLLCDPNADDPLVPEIAKVYHKDLREYNRLAREWT 142

Query: 378 ERYA 367
           ER+A
Sbjct: 143 ERFA 146



>gb:AK095822_1914444 Homo sapiens cDNA FLJ38503 fis, clone
           HCHON2000056, highly similar to UBIQUITIN-CONJUGATING
           ENZYME E2-17 KDA 3 (EC 6.3.2.19).
          Length = 148

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 43/124 (34%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRLAREWT 142

Query: 378 ERYA 367
           E+YA
Sbjct: 143 EKYA 146



>gb:AF325019_1786473 Arabidopsis thaliana AT4g27960
           (AT4g27960/T13J8_70) mRNA, complete cds.
          Length = 178

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 45/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 42  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRT 101

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 102 KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 159

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y+   + + ++YA
Sbjct: 160 DKNKYESTARTWTQKYA 176



>gb:AE017343_1755756 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 220

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 45/138 (32%), Positives = 77/138 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D  K   S   +E I+D        F GP ++ YEGG ++V +++P+ YP++   + F+ 
Sbjct: 15  DCAKDKTSGIAIEMIDDNPFHLVGAFPGPPDTPYEGGYYEVDIQIPETYPFQPVKMKFIT 74

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K++HPNV   SG++CLD++  +WSP+  L +   + L  LL  P PSDP +   A   + 
Sbjct: 75  KVYHPNVSSASGAICLDILKDAWSPVLTLKSTL-ISLQSLLCEPIPSDPQDAQVAKHYLT 133

Query: 417 DKKQYDQKVKEYCERYAK 364
           D+  ++   K + + YA+
Sbjct: 134 DRNSFNDTAKHWAQAYAQ 151



>gb:CR382135_1668351 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 168

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P+KRR M   K M  D     +  P+ D +  +N    GP ++ +E G +++ ++  
Sbjct: 1   MSTPAKRRLMRDFKRMQQDAPSGVSASPLPDNVMSWNAVIIGPADTPFEDGTFRLILQFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K PS+ F++++FHPNV   SG +CLD++   WSP +D+ ++    +  LL  PN 
Sbjct: 61  EQYPNKPPSVKFISEMFHPNV-YASGELCLDILQNRWSPTYDVSSIL-TSIQSLLNDPNI 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
           S P N +AA+L    + QY ++V+E  E
Sbjct: 119 SSPANVEAANLYKDHRSQYIKRVRETVE 146



>gb:AF284603_1258841 Trypanosoma cruzi putative
           ubiquitin-conjugating enzyme mRNA, complete cds.
          Length = 151

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 44/119 (36%), Positives = 73/119 (61%)
 Frame = -1

Query: 714 FNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQ 535
           F+V+  GP +S YEGG++ + + LP+ YP   P + FL +I+HPNVD+L G +CLD+I  
Sbjct: 34  FHVKIRGPPQSSYEGGIFHLELFLPEEYPMVPPKVRFLTRIYHPNVDKL-GRICLDIIKD 92

Query: 534 SWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKE 358
            WSP   ++ V  + +  L+  PNP DPL+ + A    +D+    +  +E+ ++YA  +
Sbjct: 93  KWSPALQIIKVL-LSIQLLMASPNPDDPLDNEVAESWKRDEAAAMRTAREWTQKYASPQ 150



>pir|A41222|A41222 ubiquitin-protein ligase (EC 6.3.2.19) E2A -
           human>gb:HUMHHR6A_2031926 Human HHR6A (yeast RAD 6
           homologue) mRNA, complete cds.
          Length = 152

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 50/149 (33%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K +  D     +  P  + I  +N    GP+ + +  G +K+ +E  
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFGDGTFKLTIEFT 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAIVEQ 147



>sp|P35134|UBCB_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC
           6.3.2.19) (Ubiquitin- protein ligase 11) (Ubiquitin
           carrier protein 11).>gb:AC012562_1537726 Arabidopsis
           thaliana chromosome 3 BAC F17O14 genomic sequence,
           complete sequence.>gb:AY063869_1565817 Arabidopsis
           thaliana putative E2, ubiquitin-conjugating enzyme UBC11
           (At3g08690) mRNA, complete cds.>gb:AY086109_1571167
           Arabidopsis thaliana clone 21455 mRNA, complete
           sequence.>gb:AY091223_1574431 Arabidopsis thaliana
           putative ubiquitin conjugating enzyme 11 (UBC11)
           (At3g08690) mRNA, complete cds.
          Length = 148

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 45/137 (32%), Positives = 78/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   S+ +  P+ +++  +     GP ES Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K++HPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVYHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRSKYESTARSWTQKYA 146



>sp|P35132|UBC9_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC
           6.3.2.19) (Ubiquitin- protein ligase 9) (Ubiquitin
           carrier protein 9) (UBCAT4B).>pir|S32674|S32674
           ubiquitin-protein ligase (EC 6.3.2.19) UBC9 -
           Arabidopsis thaliana>gb:ATCHRIV68_1546676 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           68.>gb:ATHUBCB_1553452 Arabidopsis thaliana ubiquitin
           conjugating enzyme mRNA, complete
           cds.>gb:ATT13J8_1554401 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T13J8 (ESSAII
           project).>gb:ATUBC9_1557441 A.thaliana UBC9 mRNA for
           ubiquitin conjugating enzyme
           homolog.>gb:ATUCEE2B_1557445 A.thaliana UbcAT4b mRNA for
           ubiquitin conjugating enzyme E2.>gb:AY142644_1583060
           Arabidopsis thaliana E2 ubiquitin-conjugating enzyme 9
           (UBC9) (At4g27960) mRNA, complete cds.
          Length = 148

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 45/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y+   + + ++YA
Sbjct: 130 DKNKYESTARTWTQKYA 146



>sp|P15732|UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>pir|S22858|S22858 ubiquitin-protein ligase (EC
           6.3.2.19) UBC5 - yeast  (Saccharomyces
           cerevisiae)>gb:SC9609X_1706058 S.cerevisiae chromosome
           IV cosmid 9609.>gb:SCCHIVDNA_1706737 S.cerevisiae
           chromosome IV DNA segment (EU).>gb:SCUBC5_1710627 Yeast
           UBC5 gene for ubiquitin-conjugating
           enzyme.>gb:SCYDR059C_1711877 S.cerevisiae chromosome IV
           reading frame ORF YDR059c.
          Length = 148

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 45/124 (36%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y GGV+ + +  P  YP+K P + F  KI+HPN++  SG+
Sbjct: 26  PVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTDYPFKPPKVNFTTKIYHPNINS-SGN 84

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   L  V  + +  LL   NP DPL  + A +   DK +Y+   KE+ 
Sbjct: 85  ICLDILKDQWSPALTLSKVL-LSICSLLTDANPDDPLVPEIAQIYKTDKAKYEATAKEWT 143

Query: 378 ERYA 367
           ++YA
Sbjct: 144 KKYA 147



>gb:AE017345_1756993 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 134

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 47/125 (37%), Positives = 73/125 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P +D +  F+V   GP  S YEGGV+K+ + LP+ YP   P + FL +I+HPN+D+L G 
Sbjct: 12  PKDDNLRHFDVTVAGPDSSPYEGGVFKLELFLPEEYPMNPPKVRFLTRIYHPNIDKL-GR 70

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A    +++     + +E+ 
Sbjct: 71  ICLDILKDKWSPALQIRTVL-LSIQALLGAPNPDDPLANDVAQHWKENQNAAIAQAREWT 129

Query: 378 ERYAK 364
            +YA+
Sbjct: 130 RKYAQ 134



>gb:CR382130_1662934 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 147

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 45/130 (34%), Positives = 74/130 (56%)
 Frame = -1

Query: 756 SDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNV 577
           S  +  P+  ++  +     GP +S Y GGV+ + +  P  YP+K P + F  +I+HPNV
Sbjct: 19  SSCSAGPVGQDLFHWQATIMGPSDSPYSGGVFFLSIHFPTDYPFKPPKVTFTTRIYHPNV 78

Query: 576 DELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQ 397
           +  +GS+CLD++ ++WSP   +  V  + +  +L  PNP DPL  D   L   D+ +YD 
Sbjct: 79  N-TNGSICLDILKENWSPALTISKVL-LSICSMLTDPNPDDPLVPDIGHLYKNDRARYDA 136

Query: 396 KVKEYCERYA 367
             KE+ ++YA
Sbjct: 137 TAKEWTKKYA 146



>gb:AX876763_1476681 Sequence 11668 from Patent
           EP1074617.>gb:AF125044_1885036 Homo sapiens
           ubiquitin-conjugating enzyme HBUCE1 mRNA, complete
           cds.>gb:AK001446_1908443 Homo sapiens cDNA FLJ10584 fis,
           clone NT2RP2003737, highly similar to
           UBIQUITIN-CONJUGATING ENZYME E2-17 KD 2 (EC
           6.3.2.19).>gb:BC004104_1968998 Homo sapiens
           ubiquitin-conjugating enzyme E2D 4 (putative), mRNA
           (cDNA clone MGC:10513 IMAGE:3835609), complete cds.
          Length = 147

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 43/124 (34%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  KI+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A     D+++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTVSKVL-LSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AY489135_1178425 Capsicum annuum ubiquitin-conjugating enzyme 8
           mRNA, complete cds.
          Length = 148

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 45/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATLMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y+   + + ++YA
Sbjct: 130 DKSKYEATARSWTQKYA 146



>pir|I59365|I59365 ubiquitin conjugating enzyme -
           human>gb:HUMUBC_2037967 Homo sapiens ubiquitin
           conjugating enzyme (UBC4) gene, complete cds.
          Length = 147

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 42/124 (33%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYQTDREKYNRIAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:BC048896_2550071 Danio rerio zgc:55886, mRNA (cDNA clone
           MGC:55886 IMAGE:3818716), complete
           cds.>gb:BC065678_2554123 Danio rerio zgc:55886, mRNA
           (cDNA clone MGC:77149 IMAGE:6961245), complete cds.
          Length = 147

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 42/124 (33%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AY133670_1581493 Arabidopsis thaliana At1g64230/F22C12_17 mRNA,
           complete cds.>gb:AF385718_1794610 Arabidopsis thaliana
           At1g64230/F22C12_17 mRNA, complete
           cds.>gb:AF480945_1803786 Arabidopsis thaliana ubiquitin
           conjugating enzyme UBC9A (UBC9A) mRNA, complete cds.
          Length = 148

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 45/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPNV+  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNVNS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYESTARSWTQKYA 146



>gb:AB074411_1523247 Oryza sativa (japonica cultivar-group) mRNA for
           ubiquitin-conjugating enzyme OsUBC5a, complete cds.
          Length = 147

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 45/137 (32%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKDQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + +RYA
Sbjct: 130 DRHKYENTARTWTQRYA 146



>sp|P35131|UBC8_ARATH Ubiquitin-conjugating enzyme E2-17 kDa 8 (EC
           6.3.2.19) (Ubiquitin- protein ligase 8) (Ubiquitin
           carrier protein 8) (UBCAT4A).>gb:AB005233_1509325
           Arabidopsis thaliana genomic DNA, chromosome 5, P1
           clone:MBK23.>gb:ATUBC8_1557440 A.thaliana UBC8 gene for
           ubiquitin conjugating enzyme
           homolog.>gb:AY054595_1563249 Arabidopsis thaliana
           ubiquitin-conjugating enzyme E2-17 kD 8
           (ubiquitin-protein ligase 8) (ubiquitin carrier protein
           8) (MBK23.24) mRNA, complete cds.>gb:AY057631_1564044
           Arabidopsis thaliana AT5g41700/MBK23_24 mRNA, complete
           cds.>gb:AY063074_1565651 Arabidopsis thaliana putative
           ubiquitin-conjugating enzyme 8 (At5g41700) mRNA,
           complete cds.>gb:AY072514_1567331 Arabidopsis thaliana
           ubiquitin-conjugating enzyme E2-17 kD 8 (MBK23.24) mRNA,
           complete cds.>gb:AF325009_1786463 Arabidopsis thaliana
           AT5g41700 (AT5g41700/MBK23_24) mRNA, complete
           cds.>gb:AF370257_1792142 Arabidopsis thaliana putative
           E2, ubiquitin-conjugating enzyme UBC8 (At5g41700) mRNA,
           complete cds.
          Length = 148

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 45/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP ES Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYEATARNWTQKYA 146



>sp|P25867|UBC1_DROME Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein) (Effete protein).>pir|S19157|S19157
           ubiquitin-conjugating enzyme - fruit fly (Drosophila
           melanogaster)>gb:AE014297_1139584 Drosophila
           melanogaster chromosome 3R, complete
           sequence.>gb:AE003706_1221577 Drosophila melanogaster
           chromosome 3R, section 44 of 118 of the complete
           sequence.>gb:AY060304_1292216 Drosophila melanogaster
           GH14739 full length cDNA.>gb:AY588071_1339430
           Homalodisca coagulata putative ubiquitin-conjugating
           enzyme mRNA, complete cds.>gb:DMUBCD1_1381152
           D.melanogaster Ubc D1 mRNA for ubiquitin-conjugating
           enzyme.
          Length = 147

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 42/124 (33%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPPDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNELAREWT 142

Query: 378 ERYA 367
            +YA
Sbjct: 143 RKYA 146



>sp|P51669|UB5B_HUMAN Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein) (E2(17)KB 2).>pir|S53359|S53359 ubiquitin
           conjugating enzyme (E217kB) - rat>gb:AX876469_1476545
           Sequence 11374 from Patent
           EP1074617.>gb:AX876725_1476664 Sequence 11630 from
           Patent EP1074617.>gb:BC033349_1980903 Homo sapiens
           ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog,
           yeast), transcript variant 1, mRNA (cDNA clone MGC:42697
           IMAGE:4827210), complete cds.>gb:HSU39317_2024055 Human
           E2 ubiquitin conjugating enzyme UbcH5B (UBCH5B) mRNA,
           complete cds.>gb:BC003923_2089462 Mus musculus
           ubiquitin-conjugating enzyme E2D 2, mRNA (cDNA clone
           MGC:7285 IMAGE:3485259), complete
           cds.>gb:MMU62483_2122806 Mus musculus ubiquitin
           conjugating enzyme (ubc4) mRNA, complete
           cds.>gb:RNU13176_2136874 Rattus norvegicus clone ubc2e
           ubiquitin conjugating enzyme (E217kB) mRNA, complete
           cds.>gb:AB105546_2465121 Xenopus laevis Xubc4 mRNA for
           ubiquitin conjugating enzyme E2, complete
           cds.>gb:BC084359_2563740 Xenopus laevis cDNA clone
           MGC:84706 IMAGE:6947388, complete cds.
          Length = 147

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 42/124 (33%), Positives = 75/124 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:BC059548_2552525 Danio rerio zgc:73200, mRNA (cDNA clone
           MGC:73200 IMAGE:4789645), complete cds.
          Length = 147

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 42/124 (33%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D ++Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDNEKYNRIAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AF176040_1774550 Mesembryanthemum crystallinum
           ubiquitin-conjugating enzyme UBC2 (Ubc2) mRNA, complete
           cds.
          Length = 148

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 44/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GG++ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPYAGGLFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y+   + + ++YA
Sbjct: 130 DKGKYESTARSWTQKYA 146



>gb:CR382135_1668293 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 197

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 51/143 (35%), Positives = 86/143 (60%), Gaps = 1/143 (0%)
 Frame = -1

Query: 813 SRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFH-GPKESLYEGGVWKVRVELPD 637
           SR+S+   R   D+ ++ +         D  + FN +    P+E  Y+GG ++ + E+ +
Sbjct: 40  SRVSAAQLRLQKDITEIDLPRSIKLTFPDPSDLFNFKLSITPQEGYYKGGTFEFKTEINN 99

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            +P + P I  LNKI+HPN+D L G++CL+++ + WSP+ + LN   + L  L L PNP+
Sbjct: 100 NFPIEPPKIKCLNKIYHPNID-LDGNICLNILREDWSPVLN-LNSILIGLNFLFLEPNPN 157

Query: 456 DPLNGDAASLMMKDKKQYDQKVK 388
           DPLN DAA++++K+K  +   VK
Sbjct: 158 DPLNKDAANVLVKNKSVFTSNVK 180



>gb:AY769917_1627684 Arachis hypogaea ubiquitin-conjugating enzyme
           (UBC) mRNA, complete cds.
          Length = 148

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 43/124 (34%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y GGV+ V +  P  YP+K P + F  K+FHPN+   +GS
Sbjct: 25  PVGDDMFHWQATIMGPADSPYAGGVFLVNIHFPPDYPFKPPKVSFKTKVFHPNIYN-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + 
Sbjct: 84  ICLDILKEQWSPALTVSKVL-LSICSLLTDPNPDDPLMPEIAHMYKSDRAKYENTARSWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AY389584_1178222 Hyacinthus orientalis ubiquitin-conjugating
           enzyme (UBC) mRNA, partial cds.
          Length = 148

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 41/134 (30%), Positives = 85/134 (63%)
 Frame = -1

Query: 774 VMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNK 595
           ++ L ++  +  P ++ I  +N    GP ++ ++GG +K+ ++  + YP K P++ F+++
Sbjct: 12  LISLFLAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSR 71

Query: 594 IFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKD 415
           +FHPN+    GS+CLD++   WSP++D+  +    +  LL  PNP+ P N +AA +  ++
Sbjct: 72  MFHPNI-YADGSICLDILQNQWSPIYDVAAIL-TSIQSLLCDPNPNSPANSEAARMFSEN 129

Query: 414 KKQYDQKVKEYCER 373
           K++Y+++V+E  E+
Sbjct: 130 KREYNRRVREIVEQ 143



>pir|H90116|H90116 ubiquitin conjugating enzyme [imported] -
           Guillardia theta nucleomorph>pir|F90118|F90118 ubiquitin
           conjugating enzyme [imported] - Guillardia theta
           nucleomorph>pir|D90102|D90102 ubiquitin conjugating
           enzyme [imported] - Guillardia theta
           nucleomorph>pir|F90082|F90082 ubiquitin conjugating
           enzyme [imported] - Guillardia theta
           nucleomorph>pir|F90137|F90137 ubiquitin conjugating
           enzyme [imported] - Guillardia theta
           nucleomorph>gb:GTAJ10592_1681035 Guillardia theta DNA
           for complete sequence of nucleomorph chromosome
           2.>gb:GTAJ10592_1681187 Guillardia theta DNA for
           complete sequence of nucleomorph chromosome
           2.>gb:AF083031_1766711 Guillardia theta nucleomorph
           chromosome 3, complete sequence.>gb:AF083031_1766863
           Guillardia theta nucleomorph chromosome 3, complete
           sequence.>gb:AF165818_1773743 Guillardia theta
           nucleomorph chromosome 1, complete sequence.
          Length = 147

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 45/142 (31%), Positives = 82/142 (57%)
 Frame = -1

Query: 792 KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPS 613
           ++   D++K   S+ +  P ++ + ++     GP +S Y GGV+ + +  P  YP+K P 
Sbjct: 7   QKEHKDLLKDPPSNCSAGPSDENLFRWTASIIGPSDSPYAGGVFFLSILFPPDYPFKPPK 66

Query: 612 IGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAA 433
           + F  KI+HPN++  +GS+CLD++   WSP   +  V  + +  LL  PNP DPL  + A
Sbjct: 67  VQFTTKIYHPNINS-NGSICLDILRDQWSPALTVSKVL-LSISSLLTDPNPDDPLVPEIA 124

Query: 432 SLMMKDKKQYDQKVKEYCERYA 367
            +  +++ +Y+   +E+ +RYA
Sbjct: 125 RVFKENRSRYEATAREWTQRYA 146



>pir|B96818|B96818 hypothetical protein F9K20.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_895406 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F9K20_1678687 Arabidopsis thaliana
           chromosome 1 BAC F9K20 sequence, complete sequence.
          Length = 163

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 45/105 (42%), Positives = 64/105 (60%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           +  P  D +  FNV   GP +S YEGGV+K+ + LP+ YP  +P + FL KI+HPN+D+L
Sbjct: 26  SASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKL 85

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAA 433
            G +CLD++   WSP   +  V    +  LL  PNP DPL+ + A
Sbjct: 86  -GRICLDILKDKWSPALQIRTVLLRSIQALLSAPNPDDPLSENIA 129



>gb:CR456916_1993123 Homo sapiens full open reading frame cDNA clone
           RZPDo834H1015D for gene UBE2D3, ubiquitin-conjugating
           enzyme E2D 3 (UBC4/5 homolog, yeast); complete cds,
           incl. stopcodon.
          Length = 147

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 42/124 (33%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRVSREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AE017346_1757428 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 147

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 45/130 (34%), Positives = 74/130 (56%)
 Frame = -1

Query: 756 SDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNV 577
           S  +  PIND + ++     GP +S Y GGV+ + +  P  YP+K P + F  KI+HPN+
Sbjct: 19  SSCSAGPINDNLFQWQATIMGPADSPYSGGVFFLSLTFPTDYPFKPPKVQFTTKIYHPNI 78

Query: 576 DELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQ 397
           +  +GS+CLD++   WSP   +  V  + +  +L  PNP DPL  + A+    D+ +Y+ 
Sbjct: 79  N-ANGSICLDILRDQWSPALTISKVL-LSICSMLTDPNPDDPLVPEIANTYKTDRARYEA 136

Query: 396 KVKEYCERYA 367
             +E+  +YA
Sbjct: 137 TAREWTRKYA 146



>gb:OSJN00032_1693583 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0043A12, complete sequence.
          Length = 148

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 43/137 (31%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S + GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPFAGGVFLVNIHFPPDYPFKPPKVSFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYESTARSWTQKYA 146



>gb:AY085670_1570737 Arabidopsis thaliana clone 16865 mRNA, complete
           sequence.
          Length = 148

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 45/137 (32%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP ES Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y    + + ++YA
Sbjct: 130 DRAKYKATARNWTQKYA 146



>gb:AC116977_1207017 Dictyostelium discoideum chromosome 2 map
           5515173-5817331 strain AX4, complete sequence.
          Length = 139

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 47/125 (37%), Positives = 70/125 (56%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P  D    F V   GP +S +EGGV+ + + L D YP  +P + FL KI+HPN+D+L G 
Sbjct: 12  PATDNFRYFKVAISGPLDSPFEGGVFNLELFLTDDYPMSAPKVRFLTKIYHPNIDKL-GR 70

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++K+   + +E+ 
Sbjct: 71  ICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEHWKTNEKEAMARAREWT 129

Query: 378 ERYAK 364
             YA+
Sbjct: 130 RLYAE 134



>pir|T48741|T48741 probable ubiquitin-protein ligase [imported] -
           Neurospora crassa>gb:NC8D4_1688776 Neurospora crassa DNA
           linkage group V Cosmid contig 8D4.
          Length = 235

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 43/131 (32%), Positives = 78/131 (59%), Gaps = 1/131 (0%)
 Frame = -1

Query: 756 SDYTVEPINDE-INKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPN 580
           S    EP++   ++     F GP +S Y GG ++V +++PD YP+K PS+  + KI+HPN
Sbjct: 23  SGVMAEPLDSSNLSHLKGSFSGPPDSPYAGGTYEVDIQIPDKYPFKPPSMYLITKIWHPN 82

Query: 579 VDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYD 400
           V  ++G++CLD++  +WSP+  +     + +  LL  PNP DP +   A ++M++ K + 
Sbjct: 83  VSSVTGAICLDILGTAWSPVGTIKTAL-LAVRMLLESPNPKDPQDAQVAKMLMENPKLFA 141

Query: 399 QKVKEYCERYA 367
           +   ++  +YA
Sbjct: 142 RTAHDWAVKYA 152



>sp|P70711|UB5D_RAT Ubiquitin-conjugating enzyme E2-17 kDa 4 (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein) (E2(17)KB 4).>gb:AK005969_1153335 Mus musculus
           adult male testis cDNA, RIKEN full-length enriched
           library, clone:1700013N18 product:UBIQUITIN-CONJUGATING
           ENZYME E2-17 KDA 4 (EC 6.3.2.19) (UBIQUITIN- PROTEIN
           LIGASE) (UBIQUITIN CARRIER PROTEIN) (E2(17)KB 4) homolog
           [Rattus norvegicus], full insert
           sequence.>gb:BC050749_2100411 Mus musculus RIKEN cDNA
           1700013N18 gene, mRNA (cDNA clone MGC:58124
           IMAGE:6772621), complete cds.>gb:BC078808_2106964 Rattus
           norvegicus ubiquitin-conjugating enzyme E2D 2, mRNA
           (cDNA clone MGC:93393 IMAGE:7113229), complete
           cds.>gb:RNU56407_2137472 Rattus norvegicus ubiquitin
           conjugating enzyme mRNA, complete cds.
          Length = 147

 Score = 97.1 bits (240), Expect = 5e-19
 Identities = 41/124 (33%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ +++  +     GP +S Y+GG + + ++ P  YP+K P + F  +I+HPNV+  +GS
Sbjct: 25  PVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEYPFKPPKVEFTTRIYHPNVNS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSISSLLCDPNPDDPLVPEIAQIYKTDRDKYNRTAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:BC076409_2559246 Danio rerio zgc:100921, mRNA (cDNA clone
           MGC:100921 IMAGE:7145326), complete cds.
          Length = 152

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 50/149 (33%), Positives = 85/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ ++RR M   K +  D     +  P  + I  +N    GP  + +E G +K+ +E  
Sbjct: 1   MSTQARRRLMRDFKRLQEDPPTGVSGAPSENNIMLWNAVIFGPVGTPFEDGTFKLVIEFS 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+ ++    +  LL  PNP
Sbjct: 61  EEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           + P N  AA L  ++K++Y+++V    E+
Sbjct: 119 NSPANSQAAQLYQENKREYEKRVSAVVEQ 147



>gb:BC066917_1987154 Homo sapiens ubiquitin-conjugating enzyme E2D 3
           (UBC4/5 homolog, yeast), transcript variant 7, mRNA
           (cDNA clone MGC:87126 IMAGE:4792462), complete cds.
          Length = 147

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 42/124 (33%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPELARIYKTDRDKYNRISREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AP004078_1837347 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1020_C02.>gb:AP005851_1859092 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0088N06.
          Length = 148

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 42/124 (33%), Positives = 72/124 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P++D++  +     GP +S Y GGV+ V +  P  YP+K P + F  K+FHPN++  +G+
Sbjct: 25  PVSDDMFHWQATIMGPNDSPYSGGVFLVTIHFPPDYPFKPPKVAFKTKVFHPNINS-NGN 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + 
Sbjct: 84  ICLDILKDQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMCKTDRLRYESTARGWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AF034946_1762835 Zea mays ubiquitin conjugating enzyme (UBC)
           mRNA, complete cds.
          Length = 148

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/137 (32%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P  +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPAGEDMFHWQATIMGPPDSPYAGGVFLVNIHFPPDYPFKPPKVSFKT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRPKYESTARSWTQKYA 146



>gb:AY135219_1581754 Pavlova lutheri ubiquitin-conjugating enzyme E2
           (ubc1) mRNA, complete cds.
          Length = 153

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 45/127 (35%), Positives = 72/127 (56%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           +  P  D +  FNV   GP  S +EGG++++ + LP+ YP   P + FL KI+HPN+D+L
Sbjct: 24  SASPYQDNLRYFNVVLAGPATSPFEGGIFRLELFLPEEYPMAPPKVRFLTKIYHPNIDKL 83

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLD++   WSP   +  V  + +  LL  PNP DPL+   A     ++    ++ K
Sbjct: 84  -GRICLDILKDKWSPALQVRTVL-LSIQALLSAPNPEDPLDAGVADHWKSNEAAAIEEAK 141

Query: 387 EYCERYA 367
            + ++YA
Sbjct: 142 RWTQQYA 148



>gb:AE014296_1136020 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003541_1214682 Drosophila melanogaster
           chromosome 3L, section 44 of 83 of the complete
           sequence.>gb:AF410850_1268837 Drosophila melanogaster
           E2-C type ubiquitin conjugating enzyme (vihar) mRNA,
           complete cds.
          Length = 178

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 49/145 (33%), Positives = 86/145 (59%), Gaps = 3/145 (2%)
 Frame = -1

Query: 795 SKRRDMDVMKLMMSD---YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPY 625
           SKR   ++M LMM++    +  P  + I K+     GP+ ++Y G  +++ ++ P++YPY
Sbjct: 34  SKRLHKELMNLMMANERGISAFPDGENIFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPY 93

Query: 624 KSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLN 445
            +P + FL   FHPNVD L G++CLD++   WS ++D+  +  + +  LL  PN   PLN
Sbjct: 94  AAPVVKFLTSCFHPNVD-LQGAICLDILKDKWSALYDVRTIL-LSIQSLLGEPNNESPLN 151

Query: 444 GDAASLMMKDKKQYDQKVKEYCERY 370
             AA +M  D+K+Y + +  + E++
Sbjct: 152 AQAA-MMWNDQKEYKKYLDAFYEKH 175



>sp|P46595|UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 (EC
           6.3.2.19) (Ubiquitin-protein ligase 4) (Ubiquitin
           carrier protein 4).>pir|T39300|T39300
           ubiquitin-conjugating enzyme - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC119_1718787 S.pombe
           chromosome II cosmid c119.
          Length = 147

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 45/137 (32%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   S  +  P+ D++  +     GP +S Y GGV+ + +  P  YP+K P + F  
Sbjct: 12  DLGKDPPSSCSAGPVGDDLFHWQATIMGPADSPYAGGVFFLSIHFPTDYPFKPPKVNFTT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           +I+HPN++  +GS+CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  RIYHPNINS-NGSICLDILRDQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHVYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   +E+  +YA
Sbjct: 130 DRSRYELSAREWTRKYA 146



>sp|P35135|UBC4_LYCES Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>gb:TOM1KUC_1725583 Lycopersicon esculentum
           ubiquitin carrier protein (Ubc) mRNA, complete cds.
          Length = 148

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 44/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYETTARSWTQKYA 146



>sp|P61077|UB5C_HUMAN Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein) (E2(17)KB 3).>sp|P61079|UB5C_MOUSE
           Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)
           (Ubiquitin- protein ligase) (Ubiquitin carrier protein)
           (E2(17)KB 3).>sp|P61078|UB5C_RAT Ubiquitin-conjugating
           enzyme E2-17 kDa 3 (EC 6.3.2.19) (Ubiquitin- protein
           ligase) (Ubiquitin carrier protein) (E2(17)KB 3)
           (Phosphoarginine phosphatase)
           (PAPase).>pir|S53358|S53358 ubiquitin-conjugating enzyme
           E2.17kB - rat>gb:AK004001_1152178 Mus musculus 18-day
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:1110031F06 product:UBIQUITIN-CONJUGATING
           ENZYME E2-17 KDA 3 (EC 6.3.2.19) (UBIQUITIN- PROTEIN
           LIGASE) (UBIQUITIN CARRIER PROTEIN) (E2(17)KB 3) homolog
           [Homo sapiens], full insert
           sequence.>gb:AK032885_1163115 Mus musculus 12 days
           embryo male wolffian duct includes surrounding region
           cDNA, RIKEN full-length enriched library,
           clone:6720467J07 product:UBIQUITIN-CONJUGATING ENZYME
           E2-17 KDA 3 (EC 6.3.2.19) (UBIQUITIN- PROTEIN LIGASE)
           (UBIQUITIN CARRIER PROTEIN) (E2(17)KB 3) homolog [Homo
           sapiens], full insert sequence.>gb:AK049906_1169029 Mus
           musculus adult male hippocampus cDNA, RIKEN full-length
           enriched library, clone:C630010F02
           product:UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 3 (EC
           6.3.2.19) (UBIQUITIN- PROTEIN LIGASE) (UBIQUITIN CARRIER
           PROTEIN) (E2(17)KB 3) homolog [Homo sapiens], full
           insert sequence.>gb:AK077666_1171991 Mus musculus 8 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:5730513O13 product:UBIQUITIN-CONJUGATING
           ENZYME E2-17 KDA 3 (EC 6.3.2.19) (UBIQUITIN- PROTEIN
           LIGASE) (UBIQUITIN CARRIER PROTEIN) (E2(17)KB 3) homolog
           [Homo sapiens], full insert
           sequence.>gb:AK088448_1175408 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430016N16
           product:UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 3 (EC
           6.3.2.19) (UBIQUITIN- PROTEIN LIGASE) (UBIQUITIN CARRIER
           PROTEIN) (E2(17)KB 3) homolog [Homo sapiens], full
           insert sequence.>gb:CR861134_1185148 Pongo pygmaeus
           mRNA; cDNA DKFZp459K2314 (from clone
           DKFZp459K2314).>gb:AF213884S2_1890370 Homo sapiens
           mannosidase, beta A, lysosomal (MANBA) gene, and
           ubiquitin-conjugating enzyme E2D 3 (UBE2D3) genes,
           complete cds.>gb:BC003395_1968808 Homo sapiens
           ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog,
           yeast), transcript variant 5, mRNA (cDNA clone MGC:5416
           IMAGE:3447673), complete cds.>gb:BC037894_1982246 Homo
           sapiens ubiquitin-conjugating enzyme E2D 3 (UBC4/5
           homolog, yeast), transcript variant 1, mRNA (cDNA clone
           MGC:43926 IMAGE:5275356), complete
           cds.>gb:HSU39318_2024056 Human E2 ubiquitin conjugating
           enzyme UbcH5C (UBCH5C) mRNA, complete
           cds.>gb:AB006852_2043350 Rattus norvegicus mRNA for
           phosphoarginine phosphatase, complete
           cds.>gb:BC057941_2102973 Mus musculus
           ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog,
           yeast), mRNA (cDNA clone MGC:68121 IMAGE:5323636),
           complete cds.>gb:BC072696_2106637 Rattus norvegicus
           ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog,
           yeast), mRNA (cDNA clone MGC:91644 IMAGE:7105617),
           complete cds.>gb:RNU13175_2136873 Rattus norvegicus
           clone ubc10a ubiquitin conjugating enzyme (E217kB) mRNA,
           complete cds.>gb:RNU13177_2136875 Rattus norvegicus
           clone ubc4a ubiquitin conjugating enzyme (E217kB) mRNA,
           complete cds.>gb:AJ719875_2502062 Gallus gallus mRNA for
           hypothetical protein, clone 7i20.
          Length = 147

 Score = 96.7 bits (239), Expect = 7e-19
 Identities = 42/124 (33%), Positives = 74/124 (59%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AP006156_1861013 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1043F11.
          Length = 148

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 43/138 (31%), Positives = 77/138 (55%)
 Frame = -1

Query: 780 MDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFL 601
           MD+ K   +  +  P  +++  +     GP +S Y GGV+ V +  P  YP+K P + F 
Sbjct: 11  MDLRKDPPTSCSAGPAGEDLFHWQATIMGPSDSPYAGGVFFVNIHFPPDYPFKPPKVNFQ 70

Query: 600 NKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMM 421
            K++HPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +  
Sbjct: 71  TKVYHPNINS-NGSICLDILKEQWSPALTISKVL-LSISSLLTDPNPDDPLVPEIAHVYK 128

Query: 420 KDKKQYDQKVKEYCERYA 367
             + +Y++  + + ++YA
Sbjct: 129 SQRPRYEETARAWTQKYA 146



>gb:AP003446_1829528 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OJ1529_G03.>gb:AP003446_1829531 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OJ1529_G03.
          Length = 148

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 44/137 (32%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P  +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPAGEDMFHWQATIMGPPDSPYAGGVFLVNIHFPPDYPFKPPKVSFKT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRPKYETTARSWTQKYA 146



>gb:PEAUBC4_1699751 Pisum sativum ubiquitin conjugating enzyme
           (UBC4), complete cds.
          Length = 148

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 44/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIVGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRTKYEATARSWTQKYA 146



>gb:CR382139_1672271 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 147

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 44/130 (33%), Positives = 74/130 (56%)
 Frame = -1

Query: 756 SDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNV 577
           S  +  P+ D++  +     GP +S Y GGV+ + +  P  YP+K P I F  KI+HPN+
Sbjct: 19  SSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKIAFTTKIYHPNI 78

Query: 576 DELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQ 397
           +  +G++CLD++   WSP   +  V  + +  LL   NP DPL  + A +  +D+ +Y+ 
Sbjct: 79  NG-NGNICLDILKDQWSPALTISKVL-LSICSLLTDANPDDPLVPEIAHIYKQDRAKYES 136

Query: 396 KVKEYCERYA 367
             KE+ ++YA
Sbjct: 137 TAKEWTKKYA 146



>gb:AY082009_1569038 Gossypium thurberi ubiquitin-conjugating enzyme
           E2 gene, complete cds.>gb:AY082010_1569039 Gossypium
           raimondii ubiquitin-conjugating enzyme E2 gene, complete
           cds.
          Length = 148

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 44/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVSIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYEATARGWTQKYA 146



>gb:AY082008_1569037 Gossypium arboreum ubiquitin-conjugating enzyme
           E2 gene, complete cds.
          Length = 148

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 44/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATLMGPSDSPYAGGVFLVSIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYEATARGWTQKYA 146



>gb:PFA929354_1393172 Plasmodium falciparum strain 3D7, chromosome
           5, segment 4/4.
          Length = 152

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 44/124 (35%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ +    FN+  +GP  + YEGG +K+ + LP+ YP + P + FL KI+HPN+D+L G 
Sbjct: 26  PVPENYRHFNILINGPDGTPYEGGTYKLELFLPEQYPMEPPKVRFLTKIYHPNIDKL-GR 84

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  P P DPL+   A    +DK   +   +++ 
Sbjct: 85  ICLDILKDKWSPALQIRTVL-LSIQALLSSPEPDDPLDSKVAEHFKQDKNDAEHVARQWN 143

Query: 378 ERYA 367
           + YA
Sbjct: 144 KIYA 147



>pir|F84543|F84543 probable ubiquitin-conjugating enzyme E2
           [imported] - Arabidopsis thaliana>gb:AC005825_1533075
           Arabidopsis thaliana chromosome 2 clone T24I21 map
           mi398, complete sequence.>gb:AY063872_1565820
           Arabidopsis thaliana putative E2, ubiquitin-conjugating
           enzyme (At2g16740) mRNA, complete
           cds.>gb:AY086787_1571830 Arabidopsis thaliana clone
           27679 mRNA, complete sequence.>gb:AY091232_1574440
           Arabidopsis thaliana putative ubiquitin-conjugating
           enzyme E2 (At2g16740) mRNA, complete cds.
          Length = 148

 Score = 96.3 bits (238), Expect = 9e-19
 Identities = 48/145 (33%), Positives = 78/145 (53%), Gaps = 4/145 (2%)
 Frame = -1

Query: 789 RRDMDVMKLMMSDYTVE----PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYK 622
           RR +  +K +  D  V     P  +++  +     GP ES Y GGV+ V +  P  YP+K
Sbjct: 4   RRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFK 63

Query: 621 SPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNG 442
            P + F  K+FHPN++  +G++CLD++   WSP   +  V  + +  LL  PNP DPL  
Sbjct: 64  PPKVVFRTKVFHPNINS-NGNICLDILKDQWSPALTISKVL-LSICSLLTDPNPDDPLVP 121

Query: 441 DAASLMMKDKKQYDQKVKEYCERYA 367
           + A +   DK +Y+   + + ++YA
Sbjct: 122 EIAHIYKTDKTKYEAMARSWTQKYA 146



>gb:AF461687_1801830 Pinus pinaster putative ubiquitin mRNA, partial
           cds.
          Length = 140

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 41/124 (33%), Positives = 72/124 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ +++  +     GP ES Y GGV+ V +  P  YP+K P + F  K++HPN++  +GS
Sbjct: 17  PVGEDLFHWQATIMGPTESPYAGGVFFVMIHFPPDYPFKPPKVNFQTKVYHPNINS-NGS 75

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +    + +Y++  + + 
Sbjct: 76  ICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHIYKSQRSRYEETARAWT 134

Query: 378 ERYA 367
           ++YA
Sbjct: 135 QKYA 138



>gb:LEUBC_1684800 L.esculentum mRNA for ubiquitin conjugating enzyme
           E2.
          Length = 148

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 43/137 (31%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYSGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + +++A
Sbjct: 130 DRSKYETTARSWTQKFA 146



>gb:AY736121_1626035 Triticum aestivum ubiquitin-conjugating enzyme
           mRNA, complete cds.
          Length = 148

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 42/137 (30%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S + GG++ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPFTGGLFLVNIHFPPDYPFKPPKVSFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYESTARSWTQKYA 146



>gb:AE014134_1129189 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003644_1219296 Drosophila melanogaster
           chromosome 2L, section 53 of 83 of the complete
           sequence.>gb:AY113266_1299214 Drosophila melanogaster
           AT16033 full insert cDNA.
          Length = 151

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 50/123 (40%), Positives = 74/123 (60%), Gaps = 2/123 (1%)
 Frame = -1

Query: 729 DEINK--FNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSV 556
           DE N   F+V   GPK+S +EGG +K+ + LP+ YP K+P + FL KIFHPN+D + G +
Sbjct: 28  DECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRV-GRI 86

Query: 555 CLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCE 376
           CLD++   WSP   +  V  + +  LL  PNP DPL  D A L   ++++  Q  +E   
Sbjct: 87  CLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAELWKVNERRAIQLARECTL 145

Query: 375 RYA 367
           ++A
Sbjct: 146 KHA 148



>gb:AJ843120_1814505 Plantago major mRNA for Ubiquitin-conjugating
           enzyme (ubc1 gene).
          Length = 148

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 42/124 (33%), Positives = 70/124 (56%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+  ++  +     GP +S Y GGV++V +  P  YP+K P + F  K+FHPN++  +G+
Sbjct: 25  PVAQDMFHWQATIIGPNDSPYAGGVFQVTIHFPTDYPFKPPKVAFRTKVFHPNINN-NGN 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   DK +Y+   + + 
Sbjct: 84  ICLDILKDQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHIYKNDKPKYESMARNWT 142

Query: 378 ERYA 367
            +YA
Sbjct: 143 HKYA 146



>gb:AF517850_1807652 Griffithsia japonica isolate Gj75
           ubiquitin-conjugating enzyme mRNA, complete cds.
          Length = 147

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 45/138 (32%), Positives = 78/138 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   S+ +  P +D++  +     GP +S Y GGV+ + +  P  YP+K P I F  
Sbjct: 12  DLGKDPPSNCSAGPASDDLFHWQATIMGPPDSPYSGGVYFLTIHFPTDYPFKPPKISFTT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           +I+HPN++  +GS+CLD++   WSP   +  V  + +  LL  PNP DPL  + A     
Sbjct: 72  RIYHPNINS-NGSICLDILRDQWSPALTVSKVL-LSICSLLTDPNPDDPLVPEIAQTYKT 129

Query: 417 DKKQYDQKVKEYCERYAK 364
           ++ +Y++  +E+  +YA+
Sbjct: 130 NRARYEETAREWTRKYAQ 147



>gb:AF424651_1798986 Phytophthora infestans clone MY-07-B-10
           ubiquitin-conjugating enzyme mRNA, complete cds.
          Length = 149

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 48/124 (38%), Positives = 67/124 (54%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P  D +  F V   GP+ S YE G++K+ + LP  YP   P + FL +I+HPN+D+L G 
Sbjct: 28  PYEDNLRYFQVVIAGPQTSPYENGIFKLELFLPADYPMAPPKVRFLTRIYHPNIDKL-GR 86

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     D+    Q   E+ 
Sbjct: 87  ICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVADHWKTDEVGAVQMAAEWT 145

Query: 378 ERYA 367
            RYA
Sbjct: 146 RRYA 149



>gb:AY082005_1569034 Gossypium hirsutum ubiquitin-conjugating enzyme
           E2 (UBC2) mRNA, complete cds.>gb:AY082007_1569036
           Gossypium hirsutum ubiquitin-conjugating enzyme E2
           (UBC2) gene, complete cds.
          Length = 148

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 44/137 (32%), Positives = 77/137 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYAGGVFLVSIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVLEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYEATARGWTQKYA 146



>gb:AY080741_1568455 Arabidopsis thaliana putative E2,
           ubiquitin-conjugating enzyme UBC9 (At4g27960) mRNA,
           complete cds.
          Length = 148

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 44/137 (32%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K   + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPHKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           DK +Y+   + + ++YA
Sbjct: 130 DKNKYESTARTWTQKYA 146



>gb:AY542992_1334448 Bigelowiella natans ubiquitin conjugating
           enzyme E2 1 mRNA, complete cds.
          Length = 156

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 52/150 (34%), Positives = 77/150 (51%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYP 628
           +S    R    + K  +S     P+++    F +   GP +S YEGG + + + LP  YP
Sbjct: 3   LSKRIMRETARLEKNSISGIIAVPMSNNPRHFRITIDGPSDSAYEGGKFHLELFLPGEYP 62

Query: 627 YKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL 448
              P + FL  I+HPNVD L G +CLD++   WSP   +  V  + L  LL  PNP DPL
Sbjct: 63  MVPPQVRFLTNIYHPNVDAL-GRICLDILKDKWSPALQIDKVC-LSLQLLLSAPNPDDPL 120

Query: 447 NGDAASLMMKDKKQYDQKVKEYCERYAKKE 358
           +   A    K++K  +   K + ++YAK E
Sbjct: 121 DNKIADHWKKNEKAANDTAKAWVKKYAKVE 150



>pir|T32959|T32959 hypothetical protein C35B1.1 - Caenorhabditis
           elegans
          Length = 205

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 17/162 (10%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSDYTV-----------------EPINDEINKFNVEFHGPKESL 679
           M++PS+RR M   K +     +                  P  D I  +     GP+E+ 
Sbjct: 1   MTTPSRRRLMRDFKKLQKKLDIFGIFDKFLEDPPAGVSGAPTEDNILTWEAIIFGPQETP 60

Query: 678 YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVF 499
           +E G +K+ +E  + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+  + 
Sbjct: 61  FEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNV-YADGSICLDILQNRWSPTYDVAAIL 119

Query: 498 EVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCER 373
              +  LL  PNP+ P N  AA L  +++++Y+++V++  E+
Sbjct: 120 -TSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVEQ 160



>gb:AE016818_1748319 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 147

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 43/124 (34%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y GGV+ + +  P  YP+K P I F  KI+HPN++  +G+
Sbjct: 25  PVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNIN-ANGN 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL   NP DPL  + A +   D+ +Y+   KE+ 
Sbjct: 84  ICLDILKDQWSPALTISKVL-LSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAKEWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 KKYA 146



>gb:CR382125_1657779 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 148

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 43/124 (34%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y GGV+ + +  P  YP+K P I F  KI+HPN++  +G+
Sbjct: 26  PVGDDVYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNIN-ANGN 84

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL   NP DPL  + A L   D+ +Y+   +E+ 
Sbjct: 85  ICLDILKDQWSPALTISKVL-LSICSLLTDANPDDPLVPEIAHLYKTDRAKYEATAREWT 143

Query: 378 ERYA 367
           ++YA
Sbjct: 144 KKYA 147



>gb:AY220735_1590527 Hordeum vulgare ubiquitin-conjugating enzyme
           (UBC) mRNA, complete cds.
          Length = 148

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/137 (32%), Positives = 75/137 (54%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P  +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPSGEDMFHWQATIMGPHDSPYAGGVFLVNIHFPPDYPFKPPKVSFKT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+     + ++YA
Sbjct: 130 DRSKYETTAXSWTQKYA 146



>gb:AB074412_1523248 Oryza sativa (japonica cultivar-group) mRNA for
           ubiquitin-conjugating enzyme OsUBC5b, complete
           cds.>gb:AP005777_1857699 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0026F09.
          Length = 148

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 43/137 (31%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P +    
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATLMGPSDSPYAGGVFLVTIHFPPDYPFKPPKVALKT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYESTARSWTQKYA 146



>gb:ECA270223_1384169 Entodinium caudatum partial mRNA for putative
           ubiquitin carrier, clone L31.
          Length = 186

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 48/150 (32%), Positives = 84/150 (56%)
 Frame = -1

Query: 822 TTFSRMSSPSKRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVEL 643
           T F R++      D  V+          P  D+I  ++    GP+ S++E GV+K+++E 
Sbjct: 37  TDFKRINQSQDNDDESVL--------ATPHEDDIMIWDCIIFGPENSVWENGVFKLKMEF 88

Query: 642 PDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPN 463
            + YP K P +    K+FHPN   ++G +C+D++   WSP++D+ ++    +  LL  PN
Sbjct: 89  SEEYPNKPPHVLMKTKVFHPNF-YVNGEICIDILKDQWSPIYDIKSIL-TSIQSLLTDPN 146

Query: 462 PSDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           P+ P N +AA L   + ++Y++KVKE  E+
Sbjct: 147 PASPANVEAAKLYSDNIQEYNKKVKECVEK 176



>gb:AK003163_1151691 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1100001F19
           product:UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 3 (EC
           6.3.2.19) (UBIQUITIN- PROTEIN LIGASE) (UBIQUITIN CARRIER
           PROTEIN) (E2(17)KB 3) homolog [Homo sapiens], full
           insert sequence.
          Length = 147

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 42/124 (33%), Positives = 73/124 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D +  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDGMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y++  +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>sp|P43102|UBC4_CANAL Ubiquitin-conjugating enzyme E2 4 (EC
           6.3.2.19) (Ubiquitin-protein ligase 4) (Ubiquitin
           carrier protein 4).
          Length = 147

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 44/130 (33%), Positives = 73/130 (56%)
 Frame = -1

Query: 756 SDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNV 577
           S  +  P+ D++  +     GP +S Y GGV+ + +  P  YP K P I    KI+HPN+
Sbjct: 19  SSCSAGPVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPLKPPKIALTTKIYHPNI 78

Query: 576 DELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQ 397
           +  +G++CLD++   WSP   +  V  + +  LL   NP DPL  + A +  +D+K+Y+ 
Sbjct: 79  NS-NGNICLDILKDQWSPALTISKVL-LSICSLLTDANPDDPLVPEIAHIYKQDRKKYEA 136

Query: 396 KVKEYCERYA 367
             KE+ ++YA
Sbjct: 137 TAKEWTKKYA 146



>sp|O74201|UBC2_CANAL Ubiquitin-conjugating enzyme E2-20 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>gb:AF036707_1762982 Candida albicans RAD6
           (RAD6) mRNA, complete cds.>gb:AF118145_1769612 Candida
           albicans RAD6 (RAD6) gene, complete cds.
          Length = 179

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 50/148 (33%), Positives = 84/148 (56%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+P++RR M   K M  D     +  P+ D + K+N    GP ++ +E G +++ +   
Sbjct: 1   MSTPARRRLMRDFKRMQQDPPSGVSASPLPDNVMKWNAVIIGPSDTPFEDGTFRLLLSFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++++FHPNV   SG +CLD++   WSP +D+ ++    +  LL  PN 
Sbjct: 61  EQYPNKPPQVKFISEMFHPNV-YASGELCLDILQNRWSPTYDVSSIL-TSVQSLLNDPNI 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
           S P N +AA+L    +  Y ++V+E  E
Sbjct: 119 SSPANVEAANLYKDHRSLYVKRVRETVE 146



>gb:AY653733_2371310 Mimivirus, complete genome.
          Length = 158

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 44/135 (32%), Positives = 80/135 (59%), Gaps = 1/135 (0%)
 Frame = -1

Query: 765 LMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFH 586
           L    + +  +++ I  + V   GP+ SLYE   +++ +EL + YPY SP + F+  I H
Sbjct: 22  LYADSFQINMVDENIFLWKVNIKGPENSLYENYNFELEIELSNDYPYSSPKVKFITPIQH 81

Query: 585 PNVDELSGSVCLDVINQ-SWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKK 409
            NV++  G +CL+++ +  W+   +++++    +  LL  PNP DP N + ASL   DK 
Sbjct: 82  MNVND-KGDICLNILKKDGWNASLNIISIIWSII-VLLDQPNPEDPFNSELASLYRNDKL 139

Query: 408 QYDQKVKEYCERYAK 364
            YD+K+++YC+ ++K
Sbjct: 140 SYDKKIRDYCKTHSK 154



>gb:AB032739_2044825 Rattus norvegicus rbendless mRNA for bendless
           protein, complete cds.>gb:BC090072_2111200 Rattus
           norvegicus ubiquitin-conjugating enzyme E2N (homologous
           to yeast UBC13), mRNA (cDNA clone MGC:93937
           IMAGE:7113593), complete cds.
          Length = 152

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 46/125 (36%), Positives = 70/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP       F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEQWKSNEAQAIETARAW 143

Query: 381 CERYA 367
              YA
Sbjct: 144 TRLYA 148



>gb:CR380951_1650139 Candida glabrata strain CBS138 chromosome E
           complete sequence.
          Length = 147

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 43/124 (34%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y GGV+ + +  P  YP+K P I F  KI+HPN++  +G+
Sbjct: 25  PVGDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNIN-ANGN 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   L  V  + +  LL   NP DPL  + A +   D+ +Y+   +E+ 
Sbjct: 84  ICLDILKDQWSPALTLSKVL-LSICSLLTDANPDDPLVPEIAHIYKTDRAKYEATAREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 KKYA 146



>pir|D96666|D96666 protein F22C12.2 [imported] - Arabidopsis
           thaliana>gb:AE005173_894081 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007764_1536164 Genomic sequence for
           Arabidopsis thaliana BAC F22C12 from chromosome I,
           complete sequence.
          Length = 146

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 42/110 (38%), Positives = 66/110 (60%)
 Frame = -1

Query: 696 GPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF 517
           GP +S Y GGV+ V +  P  YP+K P + F  K+FHPNV+  +GS+CLD++ + WSP  
Sbjct: 37  GPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNS-NGSICLDILKEQWSPAL 95

Query: 516 DLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + ++YA
Sbjct: 96  TISKVL-LSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYA 144



>sp|P15731|UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 (EC
           6.3.2.19) (Ubiquitin-protein ligase 4) (Ubiquitin
           carrier protein 4).>pir|S22857|S22857 ubiquitin-protein
           ligase (EC 6.3.2.19) UBC4 - yeast  (Saccharomyces
           cerevisiae)>gb:SCTRAAA_1709660 S.cerevisiae (S288C)
           HSP26, SEC18, UBC4, tRNA-Arg and tRNA-Asp
           genes.>gb:SCUBC4_1710626 Yeast UBC4 gene for
           ubiquitin-conjugating enzyme.>gb:SCYBR082C_1711302
           S.cerevisiae chromosome II reading frame ORF YBR082c.
          Length = 148

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 43/124 (34%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y GGV+ + +  P  YP+K P I F  KI+HPN++  +G+
Sbjct: 26  PVGDDLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNIN-ANGN 84

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   L  V  + +  LL   NP DPL  + A +   D+ +Y+   +E+ 
Sbjct: 85  ICLDILKDQWSPALTLSKVL-LSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWT 143

Query: 378 ERYA 367
           ++YA
Sbjct: 144 KKYA 147



>gb:BC053141_2550533 Danio rerio ubiquitin-conjugating enzyme
           E2N-like, mRNA (cDNA clone MGC:63901 IMAGE:6790185),
           complete cds.
          Length = 154

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 46/125 (36%), Positives = 70/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP       F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEQWKSNEAQAIETARTW 143

Query: 381 CERYA 367
              YA
Sbjct: 144 TRLYA 148



>gb:BT007560_2150492 Synthetic construct Homo sapiens
           ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
           mRNA, partial cds.
          Length = 153

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 46/125 (36%), Positives = 70/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP       F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAW 143

Query: 381 CERYA 367
              YA
Sbjct: 144 TRLYA 148



>gb:AY082004_1569033 Gossypium hirsutum ubiquitin-conjugating enzyme
           E2 (UBC1) mRNA, complete cds.>gb:AY082006_1569035
           Gossypium hirsutum ubiquitin-conjugating enzyme E2
           (UBC1) gene, complete cds.
          Length = 148

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 44/137 (32%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATLMGPSDSPYAGGVFLVSIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+     + ++YA
Sbjct: 130 DRAKYEATACGWTQKYA 146



>gb:DDU67838_1377398 Dictyostelium discoideum putative ubiquitin
           conjugating enzyme UbcB (ubcB) gene, complete cds.
          Length = 148

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 43/138 (31%), Positives = 80/138 (57%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D++K   S  +   ++D + K+     GP+ S +E GV+ + +++P  YP+K P++ F  
Sbjct: 13  DMLKTPPSWCSAHLVDDNLQKWKATVQGPEGSPFEKGVFSMDIDIPADYPFKPPTLKFTT 72

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           KI+HPN+    G++C +V + +WSP   +L+V    +  +L  PNP +PL  + A     
Sbjct: 73  KIYHPNIKTSDGAICAEVFS-TWSPQLKILDVLTT-IRSILTDPNPDNPLETEIAQQFKT 130

Query: 417 DKKQYDQKVKEYCERYAK 364
           D+  +++  KE+ ++YAK
Sbjct: 131 DRNAFNKTAKEWTKKYAK 148



>sp|P61088|UBCN_HUMAN Ubiquitin-conjugating enzyme E2 N (EC
           6.3.2.19) (Ubiquitin-protein ligase N) (Ubiquitin
           carrier protein N) (Ubc13) (Bendless-like ubiquitin
           conjugating enzyme).>sp|P61089|UBCN_MOUSE
           Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)
           (Ubiquitin-protein ligase N) (Ubiquitin carrier protein
           N) (Ubc13) (Bendless-like ubiquitin conjugating
           enzyme).>pir|JC4894|JC4894 ubiquitin-protein ligase (EC
           6.3.2.19) E2N - human>gb:AK005302_1152937 Mus musculus
           adult male cerebellum cDNA, RIKEN full-length enriched
           library, clone:1500026J17 product:ubiquitin-conjugating
           enzyme E2N, full insert sequence.>gb:CR860119_1184209
           Pongo pygmaeus mRNA; cDNA DKFZp459H2311 (from clone
           DKFZp459H2311).>gb:BC000396_1966684 Homo sapiens
           ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast),
           mRNA (cDNA clone MGC:8489 IMAGE:2822013), complete
           cds.>gb:BC003365_1968782 Homo sapiens
           ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast),
           mRNA (cDNA clone MGC:5063 IMAGE:2900313), complete
           cds.>gb:BT006873_1990311 Homo sapiens
           ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast)
           mRNA, complete cds.>gb:D83004_1994958 Human epidermoid
           carcinoma mRNA for ubiquitin-conjugating enzyme E2
           similar to Drosophila bendless gene product, complete
           cds.>gb:AY039837_2074379 Mus musculus E2 ubiquitin
           conjugating enzyme UBC13 (Ubc13) mRNA, complete
           cds.>gb:BC034898_2097797 Mus musculus
           ubiquitin-conjugating enzyme E2N, mRNA (cDNA clone
           MGC:41464 IMAGE:1382079), complete
           cds.>gb:BC067069_2105949 Mus musculus
           ubiquitin-conjugating enzyme E2N, mRNA (cDNA clone
           MGC:86116 IMAGE:30550024), complete
           cds.>gb:MMBLU_2114325 Mus musculus mRNA for
           bendless-like ubiquitin conjugating
           enzyme.>gb:BC087283_2565137 Xenopus laevis hypothetical
           LOC496136, mRNA (cDNA clone MGC:98774 IMAGE:7201627),
           complete cds.
          Length = 152

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 46/125 (36%), Positives = 70/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP       F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAW 143

Query: 381 CERYA 367
              YA
Sbjct: 144 TRLYA 148



>gb:BC053797_2550747 Xenopus laevis ubiquitin-conjugating enzyme
           E2N, mRNA (cDNA clone MGC:64428 IMAGE:6879945), complete
           cds.
          Length = 152

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 46/125 (36%), Positives = 71/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP  +    F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDENNARFFHVAIAGPQDSPFEGGSFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAW 143

Query: 381 CERYA 367
              YA
Sbjct: 144 TRLYA 148



>gb:BC044461_2548767 Danio rerio ubiquitin-conjugating enzyme E2N,
           mRNA (cDNA clone MGC:55726 IMAGE:3816061), complete cds.
          Length = 154

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 46/125 (36%), Positives = 70/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP       F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDEGNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARTW 143

Query: 381 CERYA 367
              YA
Sbjct: 144 TRLYA 148



>gb:AF532622_1809424 Glycine max ubiquitin-conjugation enzyme gene,
           complete cds.
          Length = 148

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 43/137 (31%), Positives = 76/137 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S Y GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVAEDMFHWQATIMGPADSPYAGGVFLVTIHFPPDYPFKPPKVAFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +     + +  LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKGL-LSICSLLTDPNPDDPLVPEIAHMYKT 129

Query: 417 DKKQYDQKVKEYCERYA 367
           D+ +Y+   + + ++YA
Sbjct: 130 DRAKYEATARSWTQKYA 146



>gb:CR380951_1649962 Candida glabrata strain CBS138 chromosome E
           complete sequence.
          Length = 213

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 41/123 (33%), Positives = 74/123 (60%)
 Frame = -1

Query: 726 EINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLD 547
           +I+     F GP  + YEGG + V +E+P  YP+K P + F +K++HPN+  ++G++CLD
Sbjct: 31  DIHHLKGSFLGPPGTPYEGGKFIVDIEVPMEYPFKPPKMKFDSKVYHPNISSVTGAICLD 90

Query: 546 VINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
           ++  +WSP+  L +   + L  LL  P P+DP + + A   ++D++ +D+    + + YA
Sbjct: 91  ILKNAWSPVITLKSAL-ISLQALLQSPEPNDPQDAEVAQHYLRDRQSFDKTAALWTKLYA 149

Query: 366 KKE 358
             E
Sbjct: 150 SAE 152



>gb:ATHUBCD_1553454 Arabidopsis thaliana ubiquitin conjugating
           enzyme mRNA, 3' end.>gb:ATUBC11_1557437 A.thaliana UBC11
           mRNA for ubiquitin conjugating enzyme homolog.
          Length = 118

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 41/110 (37%), Positives = 66/110 (60%)
 Frame = -1

Query: 696 GPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF 517
           GP ES Y GGV+ V +  P  YP+K P + F  K++HPN++  +GS+CLD++ + WSP  
Sbjct: 9   GPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINS-NGSICLDILKEQWSPAL 67

Query: 516 DLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + ++YA
Sbjct: 68  TISKVL-LSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYA 116



>gb:AB011476_1511404 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDA7.>gb:AY059806_1564650 Arabidopsis thaliana
           ubiquitin-conjugating enzyme-like protein (MDA7.21)
           mRNA, complete cds.>gb:AY081511_1568771 Arabidopsis
           thaliana ubiquitin-conjugating enzyme-like protein
           (MDA7.21) mRNA, complete cds.>gb:AY084220_1569313
           Arabidopsis thaliana clone 10022 mRNA, complete
           sequence.
          Length = 148

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 41/124 (33%), Positives = 72/124 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P  D++ ++     GP +S + GGV+ V +  P  YP+K P + F  K++HPN++  +GS
Sbjct: 25  PTGDDMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + 
Sbjct: 84  ICLDILKEQWSPALTVSKVL-LSICSLLTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AK005788_1153228 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700009A02
           product:ubiquitin-conjugating enzyme E2N, full insert
           sequence.
          Length = 152

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 46/125 (36%), Positives = 70/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP       F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSDPNPDDPLANDVAEQWKTNEAQAIETARAW 143

Query: 381 CERYA 367
              YA
Sbjct: 144 TRLYA 148



>pir|S32673|S32673 ubiquitin-protein ligase (EC 6.3.2.19) UBC11 -
           Arabidopsis thaliana (fragment)
          Length = 118

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 41/110 (37%), Positives = 66/110 (60%)
 Frame = -1

Query: 696 GPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF 517
           GP ES Y GGV+ V +  P  YP+K P + F  K++HPN++  +GS+CLD++ + WSP  
Sbjct: 9   GPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINS-NGSICLDILKEQWSPAL 67

Query: 516 DLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + ++YA
Sbjct: 68  TISKVL-LSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYA 116



>pir|S61417|S61417 ubiquitin-protein ligase (EC 6.3.2.19) - rice
          Length = 148

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 41/124 (33%), Positives = 71/124 (57%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ +++  +     GP +S Y GGV+ V +  P  YP+  P + F  K+FHPN++  +GS
Sbjct: 25  PVAEDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFNRPKVAFKTKVFHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + 
Sbjct: 84  ICLDILKEQWSPALTVSKVL-LSICSLLTVPNPDDPLVPEMAHMYKTDRAKYESTARGWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>sp|P52493|UBC2_NEUCR Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase 2) (Ubiquitin
           carrier protein).>pir|S71430|S71430 DNA repair protein
           mus-8 - Neurospora crassa>gb:NEUMUS8_1690852 Neurospora
           crassa DNA for mus-8, complete cds.
          Length = 151

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 48/149 (32%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ ++RR M   K M +D     +  P+ D +  +N    GP ++ +E G +++ +   
Sbjct: 1   MSTAARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFEDGTFRLVMHFE 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K PS+ F++++FHPNV   +G +CLD++   WSP +D+  V    +  LL  PN 
Sbjct: 61  EQYPNKPPSVKFISEMFHPNV-YATGELCLDILQNRWSPTYDVAAVL-TSIQSLLNDPNT 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
             P N +A++L   ++K+Y ++V+E  E+
Sbjct: 119 GSPANVEASNLYKDNRKEYHKRVRETVEK 147



>gb:BC079353_2107473 Rattus norvegicus cDNA clone MGC:94810
           IMAGE:7108236, complete cds.
          Length = 162

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 51/159 (32%), Positives = 87/159 (54%), Gaps = 14/159 (8%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGV-------- 664
           MS+P++RR M   K +  D     +  P  + I  +N    GP+ + +E G         
Sbjct: 1   MSTPARRRLMRDFKRLQEDPPAGVSGAPSENNIMVWNAVIFGPEGTPFEDGTHVETTGQL 60

Query: 663 --WKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVF 490
             +K+ +E  + YP K P++ F++K+FHPNV    GS+CLD++   WSP +D+ ++    
Sbjct: 61  GTFKLTIEFTEEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSIL-TS 118

Query: 489 LPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           +  LL  PNP+ P N  AA L  ++K++Y+++V    E+
Sbjct: 119 IQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQ 157



>gb:AF001948_1760557 Pinus resinosa putative ubiquitin conjugating
           enzyme mRNA, complete cds.
          Length = 148

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 41/124 (33%), Positives = 72/124 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y GGV+ + +  P  YP+K P + F  K++HPNV+  +GS
Sbjct: 25  PVGDDLFHWQATIMGPVDSPYAGGVFFIVIHFPPDYPFKPPKVTFKTKVYHPNVNS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +    + +Y++  + + 
Sbjct: 84  ICLDILKEQWSPALTVSKVL-LSICSLLTDPNPDDPLVPEIAHIYKSQRARYEETARAWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AY084297_1569389 Arabidopsis thaliana clone 102813 mRNA,
           complete sequence.
          Length = 157

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 44/120 (36%), Positives = 73/120 (60%), Gaps = 2/120 (1%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEIN--KFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGF 604
           +V +  ++D  ++ I D+ N  K+     GP E+ YEGGV+++   +P+ YP + P + F
Sbjct: 14  EVQREKVADPDIQLICDDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRF 73

Query: 603 LNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLM 424
           L KIFHPNV   +G +CLD++  +WSP + L +V    +  L+ +P P  PLN D+ +L+
Sbjct: 74  LTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAII-ALMAHPEPDSPLNCDSGNLL 132



>gb:AC012562_1537727 Arabidopsis thaliana chromosome 3 BAC F17O14
           genomic sequence, complete sequence.
          Length = 149

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 49/149 (32%), Positives = 84/149 (56%), Gaps = 2/149 (1%)
 Frame = -1

Query: 807 MSSPSKRRDM-DVMKLMMSDYTVEPINDE-INKFNVEFHGPKESLYEGGVWKVRVELPDA 634
           M+S    R++ D+ +   ++ +  P+ +E I  +     GP +S Y GGV+ V ++    
Sbjct: 1   MASKRISRELRDMQRHPPANCSAGPVAEEDIFHWQATIMGPHDSPYSGGVFTVSIDFSSD 60

Query: 633 YPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSD 454
           YP+K P + F  K++HPN+D   GS+CLD++ + WSP      V  + +  LL  PNP+D
Sbjct: 61  YPFKPPKVNFKTKVYHPNIDS-KGSICLDILKEQWSPAPTTSKVL-LSICSLLTDPNPND 118

Query: 453 PLNGDAASLMMKDKKQYDQKVKEYCERYA 367
           PL  + A L   DK +Y+   +++ ++YA
Sbjct: 119 PLVPEIAHLYKVDKSKYESTAQKWTQKYA 147



>gb:AE014188_967848 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014844_1229240 Plasmodium
           falciparum 3D7 chromosome 12, section 1 of 9 of the
           complete sequence.
          Length = 147

 Score = 93.6 bits (231), Expect = 6e-18
 Identities = 46/138 (33%), Positives = 78/138 (56%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   ++ +  PI D++  +     GP +S YE GV+ + ++ P  YP+K P I F  
Sbjct: 12  DLNKDPPTNCSAGPIGDDLFFWQATIMGPGDSPYENGVYFLNIKFPPDYPFKPPKIIFTT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           KI+HPN++  +G++CLD++   WSP   +  V  + +  LL  PN  DPL  + A +   
Sbjct: 72  KIYHPNIN-TAGAICLDILKDQWSPALTISKVL-LSISSLLTDPNADDPLVPEIAHVYKT 129

Query: 417 DKKQYDQKVKEYCERYAK 364
           D+ +Y Q  K + ++YA+
Sbjct: 130 DRTKYHQTAKAWTQKYAQ 147



>gb:AF317220_1896474 Homo sapiens ubiquitin-conjugating enzyme
           (PUBC1) mRNA, complete cds.
          Length = 118

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 40/110 (36%), Positives = 69/110 (62%)
 Frame = -1

Query: 696 GPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF 517
           GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS+CLD++   WSP  
Sbjct: 10  GPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPAL 68

Query: 516 DLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            +  V  + +  LL  PNP DPL  + A +   D+++Y++  +E+ ++YA
Sbjct: 69  TISKVL-LSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYA 117



>gb:CR382123_1656294 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 228

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 42/120 (35%), Positives = 68/120 (56%)
 Frame = -1

Query: 726 EINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLD 547
           +I+     F GP  + YEGG + V + +P  YPYK P + F  K++HPNV  ++G++CLD
Sbjct: 31  DIHHMKGSFIGPSGTPYEGGKFVVDINIPVEYPYKPPQMKFDTKVYHPNVSSVTGAICLD 90

Query: 546 VINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
           ++  +W+P+  L +   + L  LL  P P+DP +   A   + DKK +D+    +   YA
Sbjct: 91  ILKNAWTPVITLKSAL-ISLQALLQSPEPNDPQDAQVAKHYLTDKKSFDETAALWTRTYA 149



>gb:AY486137_1178414 Capsicum annuum ubiquitin-conjugating protein
           mRNA, complete cds.
          Length = 119

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 41/110 (37%), Positives = 66/110 (60%)
 Frame = -1

Query: 696 GPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF 517
           GP +S Y GGV+ V +  P  YP+K P + F  K+FHPN++  +GS+CLD++ + WSP  
Sbjct: 10  GPTDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPAL 68

Query: 516 DLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + ++YA
Sbjct: 69  TISKVL-LSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYA 117



>pir|T51931|T51931 hypothetical protein NhRAD6 [imported] -
           Haematonectria haematococca>gb:NHU86521_1690973 Nectria
           haematococca NhRAD6 and NhKIN1 genes, complete cds.
          Length = 151

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 47/149 (31%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ ++RR M   K M +D     +  P+ D +  +N    GP ++ +E G +++ ++  
Sbjct: 1   MSTAARRRLMRDFKRMQTDPPAGVSASPVPDNVMTWNAVIIGPADTPFEDGTFRLVMQFE 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++++FHPNV   +G +CLD++   WSP +D+  V    +  LL  PN 
Sbjct: 61  EQYPNKPPQVKFISEMFHPNV-YATGELCLDILQNRWSPTYDVAAVL-TSIQSLLNDPNT 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
             P N +A++L   ++K+Y ++V+E  E+
Sbjct: 119 GSPANVEASNLYKDNRKEYTKRVRETVEK 147



>pir|T11716|T11716 ubiquitin conjugating enzyme - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC777_1721619 S.pombe
           chromosome III cosmid c777.
          Length = 177

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 49/132 (37%), Positives = 83/132 (62%)
 Frame = -1

Query: 783 DMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGF 604
           D+++   M + +  +PI  ++N  ++E   P E  Y+GG +K R+++ D YP+  P +  
Sbjct: 34  DLEIPSTMSTSWP-DPI--KLNVLHLEIR-PDEGYYKGGKFKFRIQIDDNYPHDPPKVKC 89

Query: 603 LNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLM 424
           LNKI+HPN+D + G+VCL+++ Q W+P+ + LN   V L  L L PN  DPLN +AA+ +
Sbjct: 90  LNKIYHPNID-IEGNVCLNILRQDWNPVLN-LNSILVGLQFLFLSPNAEDPLNKEAAADL 147

Query: 423 MKDKKQYDQKVK 388
            KD + +  +V+
Sbjct: 148 HKDPQGFASRVR 159



>sp|Q95044|UBCB_SPISO Ubiquitin-conjugating enzyme E2-C (EC
           6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier
           protein).>gb:SSU52949_1398128 Spisula solidissima
           cyclin-specific ubiquitin carrier protein E2-C mRNA,
           complete cds.
          Length = 177

 Score = 93.2 bits (230), Expect = 7e-18
 Identities = 52/149 (34%), Positives = 83/149 (55%), Gaps = 3/149 (2%)
 Frame = -1

Query: 822 TTFSRMSSPSKRRDMDVMKLMMSD---YTVEPINDEINKFNVEFHGPKESLYEGGVWKVR 652
           TT     S SKR   ++  L+MS     T  P  D + K+     GPK+++YE   +K+ 
Sbjct: 23  TTSKERHSVSKRLQQELRTLLMSGDPGITAFPDGDNLFKWVATLDGPKDTVYESLKYKLT 82

Query: 651 VELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLL 472
           +E P  YPYK P + F    +HPNVD+ SG++CLD++ ++W+  +D+  +  + L  LL 
Sbjct: 83  LEFPSDYPYKPPVVKFTTPCWHPNVDQ-SGNICLDILKENWTASYDVRTIL-LSLQSLLG 140

Query: 471 YPNPSDPLNGDAASLMMKDKKQYDQKVKE 385
            PN + PLN  AA  M  ++ +Y + + E
Sbjct: 141 EPNNASPLNAQAAD-MWSNQTEYKKVLHE 168



>gb:CR382132_1666055 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 151

 Score = 92.8 bits (229), Expect = 9e-18
 Identities = 48/148 (32%), Positives = 85/148 (57%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ ++RR M   K M  D     +  P+ D +  +N    GP E+ +E G +++ ++  
Sbjct: 1   MSTTARRRLMRDFKRMQQDPPQGVSASPVADNVLTWNAVIIGPAETPFEDGTFRMVLQFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P++ F++++FHPNV   SG +CLD++   WSP +D+  +    +  LL  PN 
Sbjct: 61  EQYPNKPPAVKFVSQMFHPNVYS-SGELCLDILQNRWSPTYDVAAIL-TSVQSLLNDPNT 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
           S P N +A+ L    ++QY+++V++  E
Sbjct: 119 SSPANVEASMLYKDHRQQYEKRVRDTVE 146



>gb:DROSADH04_1382759 Drosophila melanogaster, chromosome 2L, region
           34C4-36A7 (Adh region), section 4 of 10 of the complete
           sequence.
          Length = 201

 Score = 92.8 bits (229), Expect = 9e-18
 Identities = 47/103 (45%), Positives = 64/103 (62%), Gaps = 2/103 (1%)
 Frame = -1

Query: 729 DEINK--FNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSV 556
           DE N   F+V   GPK+S +EGG +K+ + LP+ YP K+P + FL KIFHPN+D + G +
Sbjct: 28  DECNARYFHVLVTGPKDSPFEGGNFKLELFLPEDYPMKAPKVRFLTKIFHPNIDRV-GRI 86

Query: 555 CLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASL 427
           CLD++   WSP   +  V  + +  LL  PNP DPL  D A L
Sbjct: 87  CLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEL 128



>gb:BC064184_2553737 Xenopus tropicalis hypothetical protein
           MGC75672, mRNA (cDNA clone MGC:75672 IMAGE:5379998),
           complete cds.
          Length = 152

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 45/125 (36%), Positives = 71/125 (56%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           EP  +    F+V   GP++S +EGG +K+ + LP+ YP  +P + F+ KI+HPNVD+L G
Sbjct: 26  EPDENNARYFHVLIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-G 84

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ Q  +  + +
Sbjct: 85  RICLDILKDKWSPALQIRTVL-LSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAW 143

Query: 381 CERYA 367
              +A
Sbjct: 144 TRLHA 148



>gb:CR382137_1669597 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 220

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 38/112 (33%), Positives = 70/112 (62%)
 Frame = -1

Query: 702 FHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSP 523
           F GP  + YEGG+++V + +P+ YP+K P + F  KI+HPN+  ++G++CLD++  +W+P
Sbjct: 39  FRGPPGTPYEGGLFQVDINIPNEYPFKPPQMKFATKIYHPNISSVTGAICLDILKDAWTP 98

Query: 522 MFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
           +  L +   + L  LL  P P+DP + + A   + +KK +++    + + YA
Sbjct: 99  ILTLKSSL-ISLQSLLQSPEPNDPQDAEVAKHYLTNKKGFEETATYWTKIYA 149



>gb:AB017063_1513329 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K3K7.>gb:AY065303_1566450 Arabidopsis thaliana
           putative ubiquitin-conjugating enzyme (At5g50870) mRNA,
           complete cds.>gb:AY096429_1575973 Arabidopsis thaliana
           putative ubiquitin-conjugating enzyme protein
           (At5g50870) mRNA, complete cds.
          Length = 192

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 43/135 (31%), Positives = 72/135 (53%)
 Frame = -1

Query: 756 SDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNV 577
           S   V P +D + +      GP  + YEGG +++ + +PD YP++ P + F  K++HPN+
Sbjct: 21  SGIRVCPKSDNLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFSTKVWHPNI 80

Query: 576 DELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQ 397
              SG++CLD++   WSP   L     V +  LL  P P DP +   A   MK+ + +  
Sbjct: 81  SSQSGAICLDILKDQWSPALTLKTAL-VSIQALLSAPEPKDPQDAVVAEQYMKNYQVFVS 139

Query: 396 KVKEYCERYAKKENI 352
             + + E +AKK ++
Sbjct: 140 TARYWTETFAKKSSL 154



>pir|T40123|T40123 ubiquitin-conjugating enzyme - fission yeast
           (Schizosaccharomyces pombe)
          Length = 198

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 39/112 (34%), Positives = 69/112 (61%)
 Frame = -1

Query: 702 FHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSP 523
           F GP+ + YEGG + V +E+P  YP++ P + F  KI+HPNV   +G++CLD++   WSP
Sbjct: 21  FRGPEGTPYEGGYFVVDIEIPIDYPFRPPKMNFDTKIYHPNVSSQTGAICLDILKDQWSP 80

Query: 522 MFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
           ++ + +   + L  LL  P PS+P +   A + +++ +Q+ +  +E+   YA
Sbjct: 81  VYTMKSAL-ISLQSLLCTPEPSNPQDAQVAQVYLQNYQQFVRTAREWTSSYA 131



>pir|T45220|T45220 ubiquitin-protein ligase (EC 6.3.2.19) rhp6
           [imported] - fission yeast (Schizosaccharomyces
           pombe)>gb:SPRHP6_1722053 S.pombe rhp6+ gene.
          Length = 151

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 48/148 (32%), Positives = 85/148 (57%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ ++RR M   K M  D     +  P++D +  +N    GP ++ +E G +K+ +   
Sbjct: 1   MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++ +FHPNV   +G +CLD++   WSP +D+  +    + +LL  PN 
Sbjct: 61  EQYPNKPPLVKFVSTMFHPNV-YANGELCLDILQNRWSPTYDVAAIL-TSIQRLLNDPNN 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
           + P N +AA L  ++KK+Y ++V++  E
Sbjct: 119 ASPANAEAAQLHRENKKEYVRRVRKTVE 146



>gb:AY083611_1569253 Oryza sativa elicitor and UV light related
           transcription factor (Elr) mRNA, complete cds.
          Length = 147

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 43/126 (34%), Positives = 70/126 (55%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           D+ K   +  +  P+ +++  +     GP +S + GGV+ V +  P  YP+K P + F  
Sbjct: 12  DLQKDPPTSCSAGPVGEDMFHWQATIMGPSDSPFAGGVFLVNIHFPPDYPFKPPKVSFRT 71

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMK 418
           K+FHPN++  +GS+CLD++ + WSP   +  V   F   LL  PNP DPL  + A +   
Sbjct: 72  KVFHPNINS-NGSICLDILKEQWSPALTISKVLCQFC-SLLTDPNPDDPLVPEIAYMYKT 129

Query: 417 DKKQYD 400
           D+ +YD
Sbjct: 130 DRAKYD 135



>gb:AY032592_1559373 Aspergillus nidulans UVSJ (uvsJ) gene, complete
           cds.
          Length = 151

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 47/149 (31%), Positives = 86/149 (57%), Gaps = 4/149 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ ++RR M   K M +D     +  P+ D +  +N    GP ++ +E G +++ +   
Sbjct: 1   MSTSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMHFE 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++++FHPNV   +G +CLD++   WSP +D+  +    +  LL  PN 
Sbjct: 61  EQYPNKPPGVKFISQMFHPNVYG-TGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNT 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCER 373
           S P N +A++L   ++K+Y ++V+E  E+
Sbjct: 119 SSPANVEASNLYRDNRKEYIKRVRETVEK 147



>gb:AY542993_1334449 Bigelowiella natans ubiquitin conjugating
           enzyme mRNA, complete cds.
          Length = 110

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 42/111 (37%), Positives = 70/111 (63%)
 Frame = -1

Query: 696 GPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMF 517
           GP++S Y+ GV+ + +  P  YP+K P I FL KI+H NV++  G +CLD++  +WSP  
Sbjct: 2   GPRDSPYQDGVYFLEIVFPQDYPFKPPKIKFLTKIYHCNVND-KGGICLDILKDNWSPAL 60

Query: 516 DLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAK 364
            +  V  + +  LL  PNP DPL  + A +  +++KQ+D+   E+ ++YA+
Sbjct: 61  TISKVL-LSICSLLTDPNPDDPLVPEIAKMYKENRKQHDKTAAEWTKKYAQ 110



>sp|P23566|UBC2_SCHPO Ubiquitin-conjugating enzyme E2-17 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase 2) (Ubiquitin
           carrier protein) (RAD6 homolog).>pir|S12529|S12529
           ubiquitin-conjugating enzyme rhp6 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC18B11_1716845 S.pombe
           chromosome I cosmid c18B11.
          Length = 151

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 48/148 (32%), Positives = 84/148 (56%), Gaps = 4/148 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ ++RR M   K M  D     +  P++D +  +N    GP ++ +E G +K+ +   
Sbjct: 1   MSTTARRRLMRDFKRMQQDPPAGVSASPVSDNVMLWNAVIIGPADTPFEDGTFKLVLSFD 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP K P + F++ +FHPNV   +G +CLD++   WSP +D+  +    +  LL  PN 
Sbjct: 61  EQYPNKPPLVKFVSTMFHPNV-YANGELCLDILQNRWSPTYDVAAIL-TSIQSLLNDPNN 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVKEYCE 376
           + P N +AA L  ++KK+Y ++V++  E
Sbjct: 119 ASPANAEAAQLHRENKKEYVRRVRKTVE 146



>sp|Q9UVR2|UBC1_MAGGR Ubiquitin-conjugating enzyme E2-16 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>gb:AF161722_1773420 Magnaporthe grisea
           ubiquitin-conjugating protein (Ubc1) gene, complete cds.
          Length = 147

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 41/130 (31%), Positives = 72/130 (55%)
 Frame = -1

Query: 756 SDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNV 577
           S  +  P+ +++  +     GP +S Y GGV+ + +  P  YP+K P + F  +I+HPN+
Sbjct: 19  SSCSAGPVGEDLFHWQATIMGPSDSPYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNI 78

Query: 576 DELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQ 397
           +  +GS+CLD++   WSP   +  V  + +  +L  PNP DPL  + A +    + QY+ 
Sbjct: 79  NS-NGSICLDILRDQWSPALTISKVL-LSICSMLTDPNPDDPLVPEIAHVYRTARAQYEA 136

Query: 396 KVKEYCERYA 367
             +E+  +YA
Sbjct: 137 TAREWTPKYA 146



>sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein) (Colletotrichum hard- surface-induced protein
           1).>gb:AF030296_1762474 Glomerella cingulata ubiquitin
           conjugating enzyme UBC1 (UBC1) mRNA, complete cds.
          Length = 147

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 40/130 (30%), Positives = 73/130 (56%)
 Frame = -1

Query: 756 SDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNV 577
           S  +  P+ +++  +     GP +S Y GGV+ + +  P  YP+K P + F  +I+HPN+
Sbjct: 19  SSCSAGPVGEDLFHWQATIMGPGDSPYSGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNI 78

Query: 576 DELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQ 397
           +  +GS+CLD++   WSP   +  V  + +  +L  PNP +PL  + A +   D+ +Y+ 
Sbjct: 79  NS-NGSICLDILRDQWSPALTISKVL-LSICSMLTDPNPDEPLVPEIAHVYKTDRARYEA 136

Query: 396 KVKEYCERYA 367
             +E+  +YA
Sbjct: 137 TAREWTRKYA 146



>gb:PFMAL8P1_1192213 Plasmodium falciparum 3D7 chromosome 8, ***
           SEQUENCING IN PROGRESS ***, 25 ordered pieces.
          Length = 163

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 43/144 (29%), Positives = 88/144 (61%), Gaps = 4/144 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMSD----YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           MS+ +K+R +   + + +D     +  PI ++I K+     GP ++ +EGG + + +   
Sbjct: 1   MSNLAKKRLIRDFRKLQTDSPFGVSGSPIGNDIMKWRAVIFGPADTPWEGGTFHLELLFG 60

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNP 460
           + YP + P + FL K+FHPN+  + G++C+D++ + WSP++D+  +    +  LL  PNP
Sbjct: 61  NEYPNRPPKVKFLTKMFHPNI-YMDGNICIDILQKHWSPIYDISAIL-TSIQSLLSDPNP 118

Query: 459 SDPLNGDAASLMMKDKKQYDQKVK 388
           + P N +AA L ++++ +Y++++K
Sbjct: 119 NSPANQEAALLFVENRIEYNRRIK 142



>gb:AP004069_1837211 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1626_B09.>gb:AP004192_1838821 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1643_A10.
          Length = 157

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/135 (34%), Positives = 76/135 (56%), Gaps = 3/135 (2%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEIN--KFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGF 604
           +V +   +D  ++ I D+ N  K+     GP E+ +EGGV+++   +P+ YP   P + F
Sbjct: 14  EVQREKSADPDIQLICDDSNIFKWTALIKGPSETPFEGGVFQLAFSIPEQYPLLPPQVRF 73

Query: 603 LNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLM 424
           L KIFHPNV   +G +CLD++  +WSP + L +V    +  L+ +P P  PLN D+ +L+
Sbjct: 74  LTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAII-ALMAHPEPDSPLNCDSGNLL 132

Query: 423 MK-DKKQYDQKVKEY 382
              D + Y    + Y
Sbjct: 133 RSGDIRGYQSMARMY 147



>gb:AC024817_1204818 Caenorhabditis elegans cosmid Y54G2A, complete
           sequence.
          Length = 151

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 44/128 (34%), Positives = 71/128 (55%)
 Frame = -1

Query: 747 TVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDEL 568
           +  P       F+V   GP +S + GGV+K+ + LP+ YP  +P + F+ KI+HPN+D+L
Sbjct: 25  SANPDESNARYFHVMIAGPDDSPFAGGVFKLELFLPEEYPMAAPKVRFMTKIYHPNIDKL 84

Query: 567 SGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
            G +CLD++   WSP   +  V  + +  LL  PNP DPL  D A     ++ +  +  K
Sbjct: 85  -GRICLDILKDKWSPALQIRTVL-LSIQALLSAPNPEDPLATDVAEQWKTNEAEAIKTAK 142

Query: 387 EYCERYAK 364
           ++   YA+
Sbjct: 143 QWTMNYAQ 150



>gb:AK009276_1155043 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310010L05
           product:UBIQUITIN-CONJUGATING ENZYME E2-17 KDA 3 (EC
           6.3.2.19) (UBIQUITIN- PROTEIN LIGASE) (UBIQUITIN CARRIER
           PROTEIN) (E2(17)KB 3) homolog [Homo sapiens], full
           insert sequence.
          Length = 147

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 40/124 (32%), Positives = 73/124 (58%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +S Y+GGV+ + +  P  YP+K P + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL  PNP +PL  + A +   D+ +++   +E+ 
Sbjct: 84  ICLDILRSQWSPALTISKVL-LSICSLLCDPNPDNPLVPEIARIYKTDRDKFNGFSREWD 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:OSU15971_1698407 Oryza sativa ubiquitin conjugating enzyme (UBC)
           gene, complete cds.
          Length = 148

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 40/124 (32%), Positives = 70/124 (56%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ +++  +     GP +S Y GGV+ V +  P  Y +  P + F  K+FHPN++  +GS
Sbjct: 25  PVAEDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYRFNRPKVAFKTKVFHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++ + WSP   +  V  + +  LL  PNP DPL  + A +   D+ +Y+   + + 
Sbjct: 84  ICLDILKEQWSPALTVSKVL-LSICSLLTVPNPDDPLVPEMAHMYKTDRAKYESTARGWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>sp|P21734|UBC1_YEAST Ubiquitin-conjugating enzyme E2-24 kDa (EC
           6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier
           protein).>pir|S12493|S12493 ubiquitin-protein ligase (EC
           6.3.2.19) UBC1 - yeast  (Saccharomyces
           cerevisiae)>gb:AY557675_1613902 Saccharomyces cerevisiae
           clone FLH001812.01X YDR177W gene, complete
           cds.>gb:SC9395_1705899 S.cerevisiae chromosome IV cosmid
           9395.>gb:SCUBC1G_1710625 S. cerevisiae UBC1 gene for
           ubiquitin-conjugating enzyme.
          Length = 215

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 41/130 (31%), Positives = 78/130 (60%), Gaps = 1/130 (0%)
 Frame = -1

Query: 747 TVEPIND-EINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDE 571
           T+E +++ +I+     F GP  + YEGG + V +E+P  YP+K P + F  K++HPN+  
Sbjct: 23  TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISS 82

Query: 570 LSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKV 391
           ++G++CLD++  +WSP+  L +   + L  LL  P P+DP + + A   ++D++ +++  
Sbjct: 83  VTGAICLDILKNAWSPVITLKSAL-ISLQALLQSPEPNDPQDAEVAQHYLRDRESFNKTA 141

Query: 390 KEYCERYAKK 361
             +   YA +
Sbjct: 142 ALWTRLYASE 151



>gb:AE014296_1134587 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003478_1211886 Drosophila melanogaster
           chromosome 3L, section 12 of 83 of the complete
           sequence.
          Length = 354

 Score = 90.1 bits (222), Expect = 6e-17
 Identities = 42/126 (33%), Positives = 70/126 (55%)
 Frame = -1

Query: 741 EPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSG 562
           E + D +  +     GP E++YEGG ++V +  P  YP+  P + FL K +H N+  LSG
Sbjct: 231 EMVGDNLFHWVATIPGPSETVYEGGRFRVEIVFPRNYPFYPPYLAFLTKTYHCNI-ALSG 289

Query: 561 SVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEY 382
            +CLD++   WSP   +  V  + +  LL  PNP DP+    A +   ++  +D+  +E+
Sbjct: 290 RICLDILGSKWSPALSVSKVL-ISIMSLLADPNPHDPMEVSVADVFKGNRALHDKNAREW 348

Query: 381 CERYAK 364
            ++YAK
Sbjct: 349 TKKYAK 354



>gb:CR382132_1665178 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 178

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 48/146 (32%), Positives = 86/146 (58%), Gaps = 4/146 (2%)
 Frame = -1

Query: 801 SPSKRRDMDVMKLMMSD---YTVEPIND-EINKFNVEFHGPKESLYEGGVWKVRVELPDA 634
           S +KR   ++M+LMMSD    +  P++D ++  +     GP+ ++YE   +K+ +  P  
Sbjct: 30  SVTKRLQNELMQLMMSDTPGISAFPVSDADLLNWTGTLTGPEGTVYEDLTFKISLAFPQN 89

Query: 633 YPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSD 454
           YPY +P+I F++ ++HPNVD +SG++CLD++ + WS ++++  +  + L  L   PN   
Sbjct: 90  YPYTAPTIKFISPMWHPNVD-MSGNICLDILKEKWSAVYNVQTIL-LSLQSLFGEPNNKS 147

Query: 453 PLNGDAASLMMKDKKQYDQKVKEYCE 376
           PLN  AA L   D  +Y + + +  E
Sbjct: 148 PLNAQAAQLWDTDMDEYKRLLMQRYE 173



>gb:CNS07EGG_1374079 chromosome X of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 158

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 44/130 (33%), Positives = 76/130 (58%), Gaps = 1/130 (0%)
 Frame = -1

Query: 747 TVEPIN-DEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDE 571
           +  PI+ +E++K+     GP  S+YE G++++ +  P  YP+  P + F  +IFH N+ E
Sbjct: 27  SASPISPNELDKWIAVITGPPGSVYEDGIFELLIVFPPFYPFSPPKVTFKTRIFHCNIFE 86

Query: 570 LSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKV 391
              ++CLD++   WSP   +  +  + +  LL  PNP DPLN +AA L   ++ +Y++K 
Sbjct: 87  --KNICLDILKDQWSPALTIDKIL-LSIISLLQDPNPDDPLNKEAADLYRNNRAEYNRKA 143

Query: 390 KEYCERYAKK 361
           KE+   +A K
Sbjct: 144 KEWVRLHASK 153



>gb:CR382398_1374891 Plasmodium falciparum chromosome 6, complete
           sequence; segment 1/5.
          Length = 155

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 48/147 (32%), Positives = 78/147 (53%), Gaps = 1/147 (0%)
 Frame = -1

Query: 792 KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPS 613
           K+ D D+  L  S+Y        + ++     GPK+S YEGG WK+ ++    YP   P 
Sbjct: 15  KQNDPDI-SLTHSEYN-------LYEWQAVIRGPKDSPYEGGKWKLNIKCKSTYPIDPPL 66

Query: 612 IGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAA 433
           I F+ K FHPNV+ ++G +C+D++  +WSP + + ++    L  L   PN   PLN DA 
Sbjct: 67  ITFVTKFFHPNVNFVTGELCMDILKANWSPAWTIQSLCRAIL-FLFNEPNADSPLNCDAG 125

Query: 432 SLMMK-DKKQYDQKVKEYCERYAKKEN 355
           +L+   D K +    + Y   YA +++
Sbjct: 126 NLIRSGDIKGFQSMARMYTVEYAMEDD 152



>gb:AY223405_1176864 Schistosoma japonicum clone ZZZ337 mRNA
           sequence.
          Length = 150

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 46/128 (35%), Positives = 74/128 (57%), Gaps = 3/128 (2%)
 Frame = -1

Query: 801 SPSKRRDMDVMKLMMSD---YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAY 631
           S SKR   ++M+L+MS+    T  P  + + ++     GP  ++YE   +K+ +E    Y
Sbjct: 4   SVSKRLQKELMELLMSNDKSVTAFPDGENLTRWLASIRGPDGTVYEDQQYKLSLEFGPNY 63

Query: 630 PYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDP 451
           PY  P++ F++K +HPNVD   G +CLD++ + WSP+  + N+  + +  LL  PN   P
Sbjct: 64  PYSPPNVRFVSKCYHPNVD-TRGVICLDILKEMWSPLLTVENLL-LSIRSLLAEPNNDSP 121

Query: 450 LNGDAASL 427
           LNG AA L
Sbjct: 122 LNGQAAQL 129



>gb:AE017344_1756168 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 260

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 46/142 (32%), Positives = 76/142 (53%)
 Frame = -1

Query: 792 KRRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPS 613
           K+   D+ K  +    + P    I  +     GP  S YEGGV+ V + +P  YP+  P 
Sbjct: 17  KKEIADLAKEDLGSIILAPEETNILHWKARIPGPVGSPYEGGVFDVDIRVPHDYPFSPPH 76

Query: 612 IGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAA 433
           + F+ K++H NV   +G++CLD++  +WSP   L  V  + L  LL  PNP+DPL    A
Sbjct: 77  LQFMTKVYHCNVAS-NGAICLDLLKTAWSPALSLYKVI-LSLSSLLTDPNPADPLVPPIA 134

Query: 432 SLMMKDKKQYDQKVKEYCERYA 367
           S    +++++D   +E+  ++A
Sbjct: 135 SEYRNNRRKHDATAREWVRKFA 156



>pir|E86484|E86484 hypothetical protein F7F23.6 - Arabidopsis
           thaliana>gb:AE005172_892412 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC021199_1538724 Arabidopsis thaliana
           chromosome 1 BAC F7F23 genomic sequence, complete
           sequence.>gb:BT015146_1642116 Arabidopsis thaliana
           At1g36340 gene, complete cds.>gb:BT015658_1642276
           Arabidopsis thaliana At1g36340 gene, complete cds.
          Length = 154

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 47/155 (30%), Positives = 85/155 (54%), Gaps = 5/155 (3%)
 Frame = -1

Query: 816 FSRMSSPSKRRDMDVMKLMMSD---YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVE 646
           F +M   + +R     + M+S    +++   ++ I ++     GP  + YEGG++ + ++
Sbjct: 2   FKKMDKKAAQRIAMEYRAMISKESLFSIGQNSNNIYEWTAVIRGPDGTPYEGGMFNLSIK 61

Query: 645 LPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY- 469
            P  YP+K P   F   I+HPN+++  GS+C++++   W+P    L V +V L  LLL  
Sbjct: 62  FPTDYPFKPPKFTFKTPIYHPNIND-EGSICMNILKDKWTP---ALMVEKVLLSILLLLE 117

Query: 468 -PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            PNP DPL  +   L   ++ Q+DQ+ +E+  R+A
Sbjct: 118 KPNPDDPLVPEIGQLFKNNRFQFDQRAREFTARHA 152



>gb:AF125045_1885037 Homo sapiens ubiquitin-conjugating enzyme 1
           isoform mRNA, complete cds.
          Length = 109

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 39/107 (36%), Positives = 66/107 (61%)
 Frame = -1

Query: 687 ESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLL 508
           +S Y+GGV+ + +  P  YP+K P + F  KI+HPN++  +GS+CLD++   WSP   + 
Sbjct: 4   DSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGSICLDILRSQWSPALTVS 62

Query: 507 NVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            V  + +  LL  PNP DPL  + A     D+++Y++  +E+ ++YA
Sbjct: 63  KVL-LSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYA 108



>gb:AF132073_1414624 Sus scrofa RAD6 homolog (PHR6A) gene, partial
           cds.
          Length = 126

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 41/110 (37%), Positives = 67/110 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P  + I  +N    GP+ + +E G +K+ +EL + YP K P++ F++K+FHPNV    GS
Sbjct: 19  PSENNIMVWNAVIFGPEGTPFEDGTFKLTIELTEEYPNKPPTVRFVSKMFHPNV-YADGS 77

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKK 409
           +CLD++   WSP +D+ ++    +  LL  PNP+ P N  AA L  ++K+
Sbjct: 78  ICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQAAQLYQENKR 126



>gb:BC088818_2565910 Xenopus laevis hypothetical LOC496302, mRNA
           (cDNA clone MGC:84916 IMAGE:3751221), complete cds.
          Length = 179

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 51/159 (32%), Positives = 85/159 (53%), Gaps = 3/159 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMSD---YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +   S  KR   ++M LMMS     +  P +D + K+     G   ++YE   +K+ +
Sbjct: 24  TSAARGSVGKRLQQELMTLMMSGNKGISAFPESDNLFKWIGTIDGAVGTVYENLRYKLSL 83

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
           E P  YPY +P++ F+   FHPNVD   G++CLD++   WS ++D+  +  + L  LL  
Sbjct: 84  EFPSGYPYNAPTVKFVTPCFHPNVDS-HGNICLDILKDKWSALYDVRTIL-LSLQSLLGE 141

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYAKKENI 352
           PN   PLN  AA L  K++  Y + + E  ++  +++ I
Sbjct: 142 PNNESPLNPHAAEL-WKNQTAYKKHLHEQYQKQVREKEI 179



>gb:BC082942_2563011 Xenopus laevis hypothetical LOC494805, mRNA
           (cDNA clone MGC:86250 IMAGE:6959662), complete cds.
          Length = 201

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/154 (29%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 49  TAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 108

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 109 AFSPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 166

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  M ++ ++D+  +++ +RYA
Sbjct: 167 CNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200



>gb:BC082838_2562914 Xenopus laevis hypothetical LOC494742, mRNA
           (cDNA clone MGC:80712 IMAGE:5511794), complete cds.
          Length = 201

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/154 (29%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 49  TAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 108

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 109 TFSPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 166

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  M ++ ++D+  +++ +RYA
Sbjct: 167 CNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200



>gb:AE016817_1747554 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 211

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 39/120 (32%), Positives = 68/120 (56%)
 Frame = -1

Query: 726 EINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLD 547
           +I+     F GP  + Y GG + V +++P  YP+K P + F  K++HPN+  ++G++CLD
Sbjct: 31  DIHHLKGTFLGPPGTPYHGGTFIVDIQVPLEYPFKPPKMQFDTKVYHPNISSVTGAICLD 90

Query: 546 VINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
           ++  SWSP+  L     + L  LL  P P+DP + + A   + D+  +D+    + + YA
Sbjct: 91  ILKNSWSPVLTLKTSL-ISLQALLQSPEPNDPQDAEVAKHYLSDRASFDRTAALWTKTYA 149



>sp|Q91W82|UB6B_MOUSE Ubiquitin-conjugating enzyme E2 E2 (EC
           6.3.2.19) (Ubiquitin-protein ligase E2) (Ubiquitin
           carrier protein E2).>gb:BC016265_2092266 Mus musculus
           ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog,
           yeast), mRNA (cDNA clone MGC:28917 IMAGE:4923869),
           complete cds.
          Length = 201

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/154 (29%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 49  TAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 108

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 109 TFSPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 166

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  M ++ ++D+  +++ +RYA
Sbjct: 167 CNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200



>sp|Q96LR5|UB6B_HUMAN Ubiquitin-conjugating enzyme E2 E2 (EC
           6.3.2.19) (Ubiquitin-protein ligase E2) (Ubiquitin
           carrier protein E2) (UbcH8).>gb:AK057886_1912153 Homo
           sapiens cDNA FLJ25157 fis, clone CBR08008, highly
           similar to UBIQUITIN-CONJUGATING ENZYME E2-23 KDA (EC
           6.3.2.19).>gb:BC022332_1977794 Homo sapiens
           ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog,
           yeast), mRNA (cDNA clone MGC:22765 IMAGE:4295679),
           complete cds.
          Length = 201

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 45/154 (29%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 49  TAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 108

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 109 TFSPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 166

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  M ++ ++D+  +++ +RYA
Sbjct: 167 CNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 200



>gb:BC042331_2548142 Danio rerio zgc:76906, mRNA (cDNA clone
           MGC:55923 IMAGE:3819145), complete
           cds.>gb:BC067146_2554622 Danio rerio zgc:76906, mRNA
           (cDNA clone MGC:76906 IMAGE:6524025), complete cds.
          Length = 209

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 45/154 (29%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++SS +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 57  TTAKLSSSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 116

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 117 TFSSDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 174

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  + ++ ++D+  +++ +RYA
Sbjct: 175 CNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 208



>gb:AE016817_1747350 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 200

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 43/102 (42%), Positives = 65/102 (63%)
 Frame = -1

Query: 693 PKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFD 514
           P+E +Y GG ++  V   D YP + P++  LN I+HPN+D  SG++CL+V+ + WSP+ D
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNID-YSGNICLNVLREDWSPVMD 141

Query: 513 LLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVK 388
           L  V  + L  L L PN SDPLN  AA  M++D  +++  V+
Sbjct: 142 LQTVV-LGLLFLFLEPNGSDPLNRQAADTMLRDPYRFETNVQ 182



>gb:BX649605_1643264 Aspergillus fumigatus BAC pilot project
           supercontig; segment 1/3.
          Length = 530

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 38/121 (31%), Positives = 69/121 (57%)
 Frame = -1

Query: 750 YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDE 571
           +  E  +D++ +      GP+ + Y  G+W++ +++P+ YP   P   F  +I+HPNV+E
Sbjct: 127 FPTEESSDDLTQLTTLLAGPQGTPYSQGLWRLHLKMPEDYPKSPPKATFKTRIWHPNVEE 186

Query: 570 LSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKV 391
            +G+VC+D + + W     L +V  V +  LL+YPNP   LN  A +L+ +D   + ++ 
Sbjct: 187 STGAVCVDTLKRDWKSTLTLKDVL-VTISCLLIYPNPDSALNSTAGALLQEDYDAFARQA 245

Query: 390 K 388
           K
Sbjct: 246 K 246



>pir|T37559|T37559 ubiquitin-conjugating enzyme e2-16 kd - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPAC1250_1716375
           S.pombe chromosome I cosmid c1250.
          Length = 155

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 51/153 (33%), Positives = 82/153 (53%), Gaps = 6/153 (3%)
 Frame = -1

Query: 804 SSPSKRRDM-----DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELP 640
           +SPS  R +     D+ +  + D  V  ++D +  +     GP +S+Y GG +   ++ P
Sbjct: 4   ASPSSSRRLTKEYSDLREHPIPDIRVNLVDDNLFHWACTALGPSDSVYAGGKFHFSLKFP 63

Query: 639 DAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQS-WSPMFDLLNVFEVFLPQLLLYPN 463
             YP++ P+I F  +I+HPN D   G+VCL ++ Q  + P   L +V E  L QLL  PN
Sbjct: 64  LDYPFQPPTIEFTTRIYHPNFDS-EGNVCLAILKQQVFKPSIKLRSVLEQIL-QLLREPN 121

Query: 462 PSDPLNGDAASLMMKDKKQYDQKVKEYCERYAK 364
           P DPL    A     D+  +D+  ++Y E++AK
Sbjct: 122 PDDPLVASIAEQYRNDRPSFDKIARDYVEQFAK 154



>gb:BC076483_2559319 Danio rerio zgc:92467, mRNA (cDNA clone
           MGC:92467 IMAGE:7043653), complete cds.
          Length = 201

 Score = 87.0 bits (214), Expect = 5e-16
 Identities = 45/154 (29%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 49  TAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 108

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 109 AFTPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 166

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  + ++ ++D+  K++ +RYA
Sbjct: 167 CNPADPLVGSIATQYLTNRTEHDRIAKQWTKRYA 200



>gb:AF424641_1798976 Phytophthora infestans clone MY-03-C-08
           ubiquitin-conjugating enzyme mRNA, complete cds.
          Length = 147

 Score = 87.0 bits (214), Expect = 5e-16
 Identities = 39/124 (31%), Positives = 69/124 (55%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP++S Y GGV+ + +  P  YP+K P + F  +I+H N++  +G 
Sbjct: 25  PVGDDLFHWQATIMGPEDSPYAGGVYFLNIYFPADYPFKPPKVNFTTRIYHCNIN-ANGG 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           +CLD++   WSP   +  V  + +  LL   NP DPL  + A +   D+ ++D   +E+ 
Sbjct: 84  ICLDILKDQWSPALTISKVL-LSICSLLTDANPDDPLVPEIAQIYRTDRARHDATAREWT 142

Query: 378 ERYA 367
            +YA
Sbjct: 143 AKYA 146



>gb:AB022024_2461008 Carassius auratus mRNA for cyclin-selective
           ubiquitin carrier protein E2-C, complete cds.
          Length = 172

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 46/128 (35%), Positives = 74/128 (57%), Gaps = 3/128 (2%)
 Frame = -1

Query: 801 SPSKRRDMDVMKLMMSD---YTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAY 631
           S +KR   ++M LMMS     +  P +D + K+     G + ++YEG  +K+ +E P  Y
Sbjct: 30  SVTKRLQQELMTLMMSGDKGISAFPESDNLFKWIGTIDGAQGTVYEGLRYKLSLEFPSGY 89

Query: 630 PYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDP 451
           PY +P + F+   FHPNVDE +G +CLD++   WS ++D+ ++  + +  LL  PN   P
Sbjct: 90  PYNAPRVKFVTTCFHPNVDE-NGFICLDILKDKWSALYDVRSIL-LSIQSLLGEPNNDSP 147

Query: 450 LNGDAASL 427
           +N  AA L
Sbjct: 148 MNSAAAEL 155



>gb:AF419316_1419733 Bos taurus RAD6-like protein HR6A (BHR6A) mRNA,
           partial cds.
          Length = 124

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 40/109 (36%), Positives = 66/109 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P  ++I  +N    GP+ + +E G +K+ +E  + YP K P++ F++K+FHPNV    GS
Sbjct: 18  PSENDIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNV-YADGS 76

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDK 412
           +CLD++   WSP +D+ ++    +  LL  PNP+ P N  AA L  ++K
Sbjct: 77  ICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQAAQLYQENK 124



>gb:AF132074_1414625 Equus caballus RAD6 homolog (EHR6A) gene,
           partial cds.
          Length = 126

 Score = 86.7 bits (213), Expect = 7e-16
 Identities = 40/110 (36%), Positives = 66/110 (60%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P  + I  +N    GP+ + +E G +K+ +E  + YP K P++ F++K+FHPNV    GS
Sbjct: 19  PSENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNV-YADGS 77

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKK 409
           +CLD++   WSP +D+ ++    +  LL  PNP+ P N  AA L  ++K+
Sbjct: 78  ICLDILQNRWSPTYDVSSIL-TSIQSLLDEPNPNSPANSQAAQLYQENKR 126



>gb:AY281323_2524706 Xenopus laevis ubiquitin-conjugating enzyme
           UBE2E3 mRNA, complete cds.>gb:BC064216_2553769 Xenopus
           tropicalis hypothetical protein MGC76120, mRNA (cDNA
           clone MGC:76120 IMAGE:5308964), complete
           cds.>gb:BC070614_2555593 Xenopus laevis cDNA clone
           MGC:81343 IMAGE:6633329, complete
           cds.>gb:BC082739_2562880 Xenopus tropicalis hypothetical
           protein MGC76120, mRNA (cDNA clone MGC:89955
           IMAGE:7025681), complete cds.
          Length = 207

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 44/154 (28%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 55  TTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 114

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 115 TFSSDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 172

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  + ++ ++D+  +++ +RYA
Sbjct: 173 CNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206



>gb:BT019344_2151302 Synthetic construct Homo sapiens
           ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog,
           yeast) mRNA, partial cds.
          Length = 208

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 44/154 (28%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 55  TTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 114

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 115 TFSSDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 172

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  + ++ ++D+  +++ +RYA
Sbjct: 173 CNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206



>gb:MMUBCM2_2124225 M.musculus mRNA for ubiquitin-conjugating enzyme
           UbcM2.
          Length = 207

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 44/154 (28%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 55  TTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 114

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 115 TFSSDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 172

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  + ++ ++D+  +++ +RYA
Sbjct: 173 CNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206



>gb:HSDJ680N4_2012370 Human DNA sequence from clone RP4-680N4 on
           chromosome 20 Contains the 3' end of the CDS2 gene for
           CDP-diacylglycerol synthase (phosphatidate
           cytidylyltransferase) 2, the gene for a novel protein
           similar to ubiquitin-conjugating enzyme E2D 3 (UBC4/5
           homolog, yeast) (UBE2D3), the GPR73L1 gene for G
           protein-coupled receptor 73-like 1 (prokineticin
           receptor 2, PKR2, GPR73b) and a CpG island, complete
           sequence.
          Length = 147

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 40/124 (32%), Positives = 70/124 (56%)
 Frame = -1

Query: 738 PINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGS 559
           P+ D++  +     GP +  Y+GGV+   +  P  YP+K   + F  +I+HPN++  +GS
Sbjct: 25  PVGDDMFHWQATIMGPHDRPYQGGVFFWTIRFPTDYPFKPSKVAFTTRIYHPNINS-NGS 83

Query: 558 VCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYC 379
           + LD++   WSP   L  V  + +  LL  PNP DPL  + A +   D+ +Y++  +E+ 
Sbjct: 84  IFLDILRSQWSPALTLSKVL-LSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWT 142

Query: 378 ERYA 367
           ++YA
Sbjct: 143 QKYA 146



>gb:AE017350_1759038 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 177

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 45/134 (33%), Positives = 77/134 (57%)
 Frame = -1

Query: 789 RRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSI 610
           ++D+  + L  +  TV P  +++  F +    P E +Y+GGV+     +   YP++ P +
Sbjct: 29  QKDLTELDLPSTMKTVFPDPNDVLNFKLTIT-PDEGIYKGGVFTFSFVINPNYPHEPPKV 87

Query: 609 GFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAAS 430
             L KI+HPN+D L G+VCL+++ + W P+  L +V  + +  L L PNP DPLN DAA 
Sbjct: 88  KCLEKIYHPNLD-LEGNVCLNILREDWKPVLTLSSVM-IGIQYLFLEPNPDDPLNKDAAE 145

Query: 429 LMMKDKKQYDQKVK 388
              ++++ +   VK
Sbjct: 146 DFRRNRESFIHNVK 159



>pir|T00789|T00789 ubiquitin-protein ligase homolog F24L7.7 -
           Arabidopsis thaliana>gb:AC003974_1531249 Arabidopsis
           thaliana chromosome 2 clone F24L7 map TEn5, complete
           sequence.
          Length = 177

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 50/140 (35%), Positives = 76/140 (54%), Gaps = 2/140 (1%)
 Frame = -1

Query: 777 DVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSIGFLN 598
           DV+K+ +  +   P N  I ++    +GP    YE GV+ V V +P  YPY+ P I F  
Sbjct: 43  DVLKIHVRSWLPSPEN--IFRWEATVNGPVGCPYEKGVFTVSVHIPPKYPYEPPKITFKT 100

Query: 597 KIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPL--NGDAASLM 424
           KIFHPN+ E+ G + +D++   WS     L +  V L    +  NP +PL  +  AA L 
Sbjct: 101 KIFHPNISEI-GEIFVDILGSRWS---SALTINLVLLSICSILSNPVEPLLVSNHAARLY 156

Query: 423 MKDKKQYDQKVKEYCERYAK 364
            KD+K Y++  +E+  +YAK
Sbjct: 157 QKDRKAYEKVAREWTLKYAK 176



>sp|Q969T4|UB6C_HUMAN Ubiquitin-conjugating enzyme E2 E3 (EC
           6.3.2.19) (Ubiquitin-protein ligase E3) (Ubiquitin
           carrier protein E3) (Ubiquitin-conjugating enzyme E2-23
           kDa) (UbcH9).>sp|P52483|UB6C_MOUSE Ubiquitin-conjugating
           enzyme E2 E3 (EC 6.3.2.19) (Ubiquitin-protein ligase E3)
           (Ubiquitin carrier protein E3) (Ubiquitin-conjugating
           enzyme E2-23 kDa) (UbcM2).>gb:AF085362_1149784 Homo
           sapiens UbcM2 mRNA, complete cds.>gb:AK076011_1171167
           Mus musculus 10 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2610029E03
           product:ubiquitin-conjugating enzyme E2E 3, UBC4/5
           homolog (yeast), full insert
           sequence.>gb:AB017644_1864872 Homo sapiens mRNA for
           ubiquitin-conjugating enzyme E2, complete
           cds.>gb:BC003554_1968870 Homo sapiens
           ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog,
           yeast), transcript variant 1, mRNA (cDNA clone MGC:1316
           IMAGE:3537280), complete cds.>gb:BT019345_1991030 Homo
           sapiens ubiquitin-conjugating enzyme E2E 3 (UBC4/5
           homolog, yeast) mRNA, complete cds.>gb:AF003346_2050115
           Mus musculus ubiquitin-conjugating enzyme UbcM2 mRNA,
           complete cds.>gb:BC011477_2091445 Mus musculus
           ubiquitin-conjugating enzyme E2E 3, UBC4/5 homolog
           (yeast), mRNA (cDNA clone MGC:18411 IMAGE:4195671),
           complete cds.
          Length = 207

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 44/154 (28%), Positives = 87/154 (56%), Gaps = 3/154 (1%)
 Frame = -1

Query: 819 TFSRMSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRV 649
           T +++S+ +KR   ++ ++ +    + +  P  D I ++     GP  S+YEGGV+ + +
Sbjct: 55  TTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDI 114

Query: 648 ELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLY 469
                YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL  
Sbjct: 115 TFSSDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTD 172

Query: 468 PNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            NP+DPL G  A+  + ++ ++D+  +++ +RYA
Sbjct: 173 CNPADPLVGSIATQYLTNRAEHDRIARQWTKRYA 206



>gb:BC077923_2560569 Xenopus laevis hypothetical LOC494592, mRNA
           (cDNA clone MGC:80856 IMAGE:5514645), complete cds.
          Length = 202

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/150 (29%), Positives = 84/150 (56%), Gaps = 3/150 (2%)
 Frame = -1

Query: 807 MSSPSKRRDMDVMKLMMS---DYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPD 637
           +S+ +KR   ++  + +    + +  P  D I ++     GP  S+YEGGV+ + +    
Sbjct: 54  LSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDIAFTP 113

Query: 636 AYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPS 457
            YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V  + +  LL   NP+
Sbjct: 114 EYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL-LSICSLLTDCNPA 171

Query: 456 DPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
           DPL G  A+  M +++++D+  +++ +RYA
Sbjct: 172 DPLVGSIATQYMTNREEHDRMARQWTKRYA 201



>gb:BC061394_2553168 Xenopus tropicalis hypothetical protein
           MGC75971, mRNA (cDNA clone MGC:75971 IMAGE:5384233),
           complete cds.
          Length = 200

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/164 (29%), Positives = 86/164 (52%), Gaps = 10/164 (6%)
 Frame = -1

Query: 828 KHTTFSRMSSPSKRRDMDVMKLM--MSDYTVEPI--------NDEINKFNVEFHGPKESL 679
           K +  S MS  SK       ++   ++D T++P          D I ++     GP  S+
Sbjct: 38  KESKGSSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSV 97

Query: 678 YEGGVWKVRVELPDAYPYKSPSIGFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVF 499
           YEGGV+ + +     YP+K P + F  +I+H N++   G +CLD++  +WSP   +  V 
Sbjct: 98  YEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL 156

Query: 498 EVFLPQLLLYPNPSDPLNGDAASLMMKDKKQYDQKVKEYCERYA 367
            + +  LL   NP+DPL G  A+  M ++ ++D+  +++ +RYA
Sbjct: 157 -LSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYA 199



>gb:CR382130_1662631 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 179

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 44/134 (32%), Positives = 76/134 (56%)
 Frame = -1

Query: 789 RRDMDVMKLMMSDYTVEPINDEINKFNVEFHGPKESLYEGGVWKVRVELPDAYPYKSPSI 610
           ++D+  + L  +  T  P  ++I  F +    P E  Y+GG ++    +   +P++ P +
Sbjct: 30  QKDLSELSLPSTMKTHFPSAEDIMNFELTVR-PDEGFYQGGEFRFSFYVNPNFPHEPPKV 88

Query: 609 GFLNKIFHPNVDELSGSVCLDVINQSWSPMFDLLNVFEVFLPQLLLYPNPSDPLNGDAAS 430
             L K++HPN+D L G+VCL+++ + W P+   LN   + L  L L PN SDPLN DAA 
Sbjct: 89  KCLQKVYHPNID-LEGNVCLNILREDWKPVLS-LNAVMIGLQYLFLEPNASDPLNKDAAH 146

Query: 429 LMMKDKKQYDQKVK 388
            M  +++++ + VK
Sbjct: 147 QMTANREEFKRNVK 160


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 925,174,145
Number of Sequences: 1806583
Number of extensions: 18436856
Number of successful extensions: 44543
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 42338
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43819
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 74067780800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)