BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12888
         (983 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T47337|T47337 nucleic acid binding protein-like - Arabidopsi...   140   4e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AC137623_1743703 Oryza sativa (japonica cultivar-group) chrom...   134   2e-30   
pir|T51145|T51145 nucleic acid binding protein [imported] - rice...   133   5e-30   Oryza sativa [red rice]
pir|T02745|T02745 nucleic acid binding protein - rice>gb:AF04742...   133   5e-30   Oryza sativa [red rice]
gb:AF045571_1763830 Oryza sativa nucleic acid binding protein mR...   132   8e-30   
pir|A84437|A84437 probable PHD-type zinc finger protein [importe...   132   8e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AY087820_1572847 Arabidopsis thaliana clone 38635 mRNA, compl...   132   1e-29   
gb:BT015937_1642555 Arabidopsis thaliana At5g20510 mRNA, complet...   131   2e-29   
gb:AY088087_1573111 Arabidopsis thaliana clone 41104 mRNA, compl...   131   2e-29   
pir|A86280|A86280 F14L17.29 protein - Arabidopsis thaliana>gb:AE...   131   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AY087173_1572207 Arabidopsis thaliana clone 32443 mRNA, compl...   130   3e-29   
pir|T00616|T00616 probable nucleic acid-binding protein T8K22.23...   130   3e-29   Arabidopsis thaliana [mouse-ear cress]
pir|T01840|T01840 hypothetical protein F9D12.13 - Arabidopsis th...   128   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb:ALFNABP_1818997 Alfalfa nucleic acid binding protein (alfin-1...   123   6e-27   
pir|T09646|T09646 probable zinc finger protein - alfalfa (fragment)   123   6e-27   Medicago sativa [alfalfa]
gb:AP005895_1859795 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:AC079038_1541804 Oryza sativa chromosome 7 clone OSJNBb0024A2...   122   1e-26   
gb:AC124144_1740444 Oryza sativa (japonica cultivar-group) chrom...   120   3e-26   
gb:AY553842_1613501 Lycopersicon esculentum nucleic acid-binding...   116   6e-25   
gb:AC133007_1741283 Oryza sativa chromosome 3 BAC OSJNBa0094J08 ...   114   4e-24   
gb:AC104433_1737619 Oryza sativa chromosome 3 BAC OJ1754_E06 gen...   114   4e-24   
gb:AP004144_1838205 Oryza sativa (japonica cultivar-group) genom...   113   5e-24   
gb:AC073395_1541025 Arabidopsis thaliana chromosome 3 BAC F11B9 ...   112   1e-23   
gb:AB005241_1509494 Arabidopsis thaliana genomic DNA, chromosome...   111   2e-23   
gb:AP005246_1849464 Oryza sativa (japonica cultivar-group) genom...   110   4e-23   
gb:OSJN00235_1697148 Oryza sativa genomic DNA, chromosome 4, BAC...   105   1e-21   
gb:BC067234_1987264 Homo sapiens fetal Alzheimer antigen, mRNA (...    57   4e-07   
gb:BC050566_1984403 Homo sapiens fetal Alzheimer antigen, mRNA (...    57   7e-07   
gb:AY282495_1941893 Homo sapiens bromodomain PHD finger transcri...    56   9e-07   
gb:AB032251_1866046 Homo sapiens BPTF mRNA for bromodomain PHD f...    56   9e-07   
gb:AF417921_1269439 Drosophila melanogaster nucleosome remodelin...    55   2e-06   
gb:AE014296_1133983 Drosophila melanogaster chromosome 3L, compl...    55   2e-06   
gb:AE014296_1133982 Drosophila melanogaster chromosome 3L, compl...    55   2e-06   
gb:BC060715_2104161 Mus musculus fetal Alzheimer antigen, mRNA (...    55   2e-06   
gb:BC021489_2093498 Mus musculus fetal Alzheimer antigen, mRNA (...    55   2e-06   
gb:AE014298_1124943 Drosophila melanogaster chromosome X, comple...    55   2e-06   
gb:CR382130_1663380 Yarrowia lipolytica chromosome D of strain C...    54   4e-06   
gb:CEF26H11_1363033 Caenorhabditis elegans cosmid F26H11, comple...    53   1e-05   
gb:CEF26H11_1363030 Caenorhabditis elegans cosmid F26H11, comple...    53   1e-05   
gb:CEF26H11_1363027 Caenorhabditis elegans cosmid F26H11, comple...    53   1e-05   
gb:AE014298_1124944 Drosophila melanogaster chromosome X, comple...    53   1e-05   
pir|T21435|T21435 hypothetical protein F26H11.3c - Caenorhabditi...    53   1e-05   Caenorhabditis elegans [roundworm]
pir|T21430|T21430 hypothetical protein F26H11.3b - Caenorhabditi...    53   1e-05   Caenorhabditis elegans [roundworm]
pir|T21433|T21433 hypothetical protein F26H11.3a - Caenorhabditi...    53   1e-05   Caenorhabditis elegans [roundworm]
gb:BC056775_2551962 Danio rerio zgc:63512, mRNA (cDNA clone MGC:...    49   2e-04   
gb:BC052918_2550500 Danio rerio CXXC finger 1 (PHD domain), mRNA...    48   3e-04   
gb:AL844847_2504591 Zebrafish DNA sequence from clone DKEY-13A21...    48   3e-04   
gb:HSDJ22I17_2011983 Human DNA sequence from clone RP1-22I17 on ...    48   3e-04   
gb:D87685_1995367 Human mRNA for KIAA0244 gene, partial cds.           48   3e-04   
gb:BC015733_1975270 Homo sapiens CXXC finger 1 (PHD domain), mRN...    48   3e-04   
gb:AF149758_1886213 Homo sapiens CpG binding protein (CGBP) mRNA...    48   3e-04   
gb:BT020741_1436099 Bos taurus CXXC finger 1 (PHD domain) (CXXC1...    48   3e-04   
gb:CR860060_1184153 Pongo pygmaeus mRNA; cDNA DKFZp469O086 (from...    48   3e-04   
sp|Q92576|PHF3_HUMAN|PHF3_HUMAN PHD finger protein 3.>gb:AF091622_1882605 H...    48   3e-04   Homo sapiens [man]
sp|Q9CWW7|CGBP_MOUSE|CGBP_MOUSE CpG binding protein (Protein containing PHD...    48   3e-04   Mus musculus [mouse]
sp|Q9P0U4|CGBP_HUMAN|CGBP_HUMAN CpG binding protein (Protein containing PHD...    48   3e-04   Homo sapiens [man]
gb:BC072285_2556537 Xenopus laevis MGC82437 protein, mRNA (cDNA ...    48   3e-04   
pir|T47966|T47966 hypothetical protein F15G16.130 - Arabidopsis ...    47   6e-04   Arabidopsis thaliana [mouse-ear cress]
gb:BC056031_2551614 Xenopus laevis hypothetical protein LOC39868...    47   8e-04   
gb:AK122447_2069112 Mus musculus mRNA for mKIAA1111 protein.           46   0.001   
gb:BC053861_1985077 Homo sapiens PHD finger protein 8, mRNA (cDN...    46   0.001   
gb:AL732374_1932713 Human DNA sequence from clone RP13-444K19 on...    46   0.001   
gb:AL732374_1932712 Human DNA sequence from clone RP13-444K19 on...    46   0.001   
gb:AL732374_1932710 Human DNA sequence from clone RP13-444K19 on...    46   0.001   
gb:AL589872_1929214 Human DNA sequence from clone RP11-161N3 on ...    46   0.001   
gb:AB029034_1865890 Homo sapiens mRNA for KIAA1111 protein, part...    46   0.001   
gb:AX878605_1477493 Sequence 13510 from Patent EP1074617.>gb:AK0...    46   0.001   
gb:CR933612_1185657 Homo sapiens mRNA; cDNA DKFZp686E0868 (from ...    46   0.001   
gb:AK040969_1165808 Mus musculus adult male aorta and vein cDNA,...    46   0.001   
gb:AK040943_1165800 Mus musculus adult male aorta and vein cDNA,...    46   0.001   
gb:AK036609_1164550 Mus musculus adult male bone cDNA, RIKEN ful...    46   0.001   
gb:BX842636_1644113 Neurospora crassa DNA linkage group I cosmid...    46   0.001   
gb:AE014297_1139213 Drosophila melanogaster chromosome 3R, compl...    46   0.001   
gb:BX537168_2567605 Zebrafish DNA sequence from clone DKEY-105O6...    45   0.002   
gb:BX537168_2567604 Zebrafish DNA sequence from clone DKEY-105O6...    45   0.002   
gb:BC085577_2564477 Danio rerio cDNA clone IMAGE:7256204, partia...    45   0.002   
gb:BC072971_2556888 Xenopus laevis MGC82519 protein, mRNA (cDNA ...    45   0.003   
gb:BC060927_2553020 Danio rerio cDNA clone IMAGE:4200679, partia...    45   0.003   
gb:MMU238332_2119378 Mus musculus mRNA for death inducer-obliter...    45   0.003   
gb:AK129117_2069348 Mus musculus mRNA for mKIAA0333 protein.           45   0.003   
gb:HS885L7_1999682 Human DNA sequence from clone RP5-885L7 on ch...    45   0.003   
gb:HS885L7_1999681 Human DNA sequence from clone RP5-885L7 on ch...    45   0.003   
gb:BC004237_1969099 Homo sapiens death associated transcription ...    45   0.003   
gb:BC000770_1967016 Homo sapiens death associated transcription ...    45   0.003   
gb:AB002331_1863638 Homo sapiens KIAA0333 mRNA, partial cds.           45   0.003   
gb:AX878224_1477351 Sequence 13129 from Patent EP1074617.>gb:AK0...    45   0.003   
gb:CR857698_1181915 Pongo pygmaeus mRNA; cDNA DKFZp469J1523 (fro...    45   0.003   
sp|Q8C9B9|DAT1_MOUSE|DAT1_MOUSE Death associated transcription factor 1 (De...    45   0.003   Mus musculus [mouse]
sp|Q9BTC0|DAT1_HUMAN|DAT1_HUMAN Death associated transcription factor 1.          45   0.003   Homo sapiens [man]
gb:AJ719708_2501895 Gallus gallus mRNA for hypothetical protein,...    44   0.004   
gb:AF043726_2052189 Mus musculus PHD-finger protein (Grc5) mRNA,...    44   0.004   
gb:BC064613_1986589 Homo sapiens PHD finger protein 2, mRNA (cDN...    44   0.004   
gb:AF043725_1878592 Homo sapiens PHD-finger protein (GRC5) mRNA,...    44   0.004   
gb:HSM805295_1187433 Homo sapiens mRNA; cDNA DKFZp761K187 (from ...    44   0.004   
gb:AK042834_1166423 Mus musculus 7 days neonate cerebellum cDNA,...    44   0.004   
gb:AK042327_1166272 Mus musculus 3 days neonate thymus cDNA, RIK...    44   0.004   
sp|Q9WTU0|PHF2_MOUSE|PHF2_MOUSE PHD finger protein 2 (GRC5).>gb:BC051633_21...    44   0.004   Mus musculus [mouse]
sp|O75151|PHF2_HUMAN|PHF2_HUMAN PHD finger protein 2 (GRC5).                      44   0.004   Homo sapiens [man]
gb:BC082851_2562927 Xenopus laevis hypothetical LOC494751, mRNA ...    44   0.005   
gb:AK131497_1918030 Homo sapiens cDNA FLJ16696 fis, clone TRACH3...    44   0.005   
gb:AC104321_1737547 Oryza sativa chromosome 3 BAC OSJNBa0052F07 ...    44   0.005   
pir|T41449|T41449 probable phd finger transcription regulator - ...    44   0.005   Schizosaccharomyces pombe
gb:BC071280_2556026 Danio rerio zgc:85741, mRNA (cDNA clone MGC:...    44   0.006   
gb:BC060442_2552909 Xenopus laevis hypothetical protein MGC68807...    44   0.006   
gb:AL159172_1921626 Human DNA sequence from clone RP11-554F11 on...    44   0.006   
gb:CR382134_1667053 Debaryomyces hansenii chromosome B of strain...    44   0.006   
gb:AP003753_1832910 Oryza sativa (japonica cultivar-group) genom...    43   0.008   
gb:MMU292189_2120333 Mus musculus partial mRNA for TAFII140 prot...    43   0.011   
gb:BC089030_2110686 Mus musculus TAF3 RNA polymerase II, TATA bo...    43   0.011   
gb:NC3H10_1688525 Neurospora crassa DNA linkage group V Cosmid c...    43   0.011   
gb:AK084574_1174269 Mus musculus 13 days embryo heart cDNA, RIKE...    43   0.011   
gb:AF528164_1188187 Mus musculus strain 129/Sv chromosome 17 clo...    42   0.014   
gb:AE017347_1757796 Cryptococcus neoformans var. neoformans JEC2...    42   0.019   
gb:AY142507_1582936 Arabidopsis thaliana putative receptor prote...    42   0.019   
gb:AC010657_1536977 Genomic sequence for Arabidopsis thaliana BA...    42   0.019   
pir|C85253|C85253 receptor like protein (partial) [imported] - A...    42   0.019   Arabidopsis thaliana [mouse-ear cress]
pir|T49121|T49121 receptor like protein - Arabidopsis thaliana (...    42   0.019   Arabidopsis thaliana [mouse-ear cress]
gb:AP005301_1850178 Oryza sativa (japonica cultivar-group) genom...    42   0.024   
gb:AY231397_1591585 Arabidopsis thaliana hypothetical protein (A...    42   0.024   
pir|B84460|B84460 hypothetical protein At2g04680 [imported] - Ar...    42   0.024   Arabidopsis thaliana [mouse-ear cress]
gb:AP002745_1822737 Oryza sativa (japonica cultivar-group) genom...    41   0.032   
gb:CR382129_1661976 Yarrowia lipolytica chromosome C of strain C...    41   0.041   
gb:AP002031_1821474 Arabidopsis thaliana genomic DNA, chromosome...    40   0.054   
gb:AP002745_1822736 Oryza sativa (japonica cultivar-group) genom...    40   0.070   
gb:AF512557S2_1807296 Arabidopsis thaliana HAC5 mRNA, partial cds.     40   0.092   
gb:CR380959_1653761 Candida glabrata strain CBS138 chromosome M ...    40   0.092   
gb:AY064131_1566013 Arabidopsis thaliana AT5g09790/F17I14_20 mRN...    40   0.092   
gb:AB026645_1517170 Arabidopsis thaliana genomic DNA, chromosome...    40   0.092   
gb:AB020752_1514691 Arabidopsis thaliana genomic DNA, chromosome...    40   0.092   
gb:DME292191_1379182 Drosophila melanogaster partial mRNA for TA...    40   0.092   
gb:DME251945_1379065 Drosophila melanogaster bip2 gene for BIP2 ...    40   0.092   
gb:AE014185_937656 Plasmodium falciparum 3D7 chromosome 10 compl...    40   0.092   
pir|T49919|T49919 hypothetical protein F17I14.20 - Arabidopsis t...    40   0.092   Arabidopsis thaliana [mouse-ear cress]
gb:BC090215_2566432 Xenopus laevis cDNA clone MGC:85078 IMAGE:68...    39   0.12    
sp|P29375|RBB2_HUMAN|RBB2_HUMAN Retinoblastoma-binding protein 2 (RBBP-2).>...    39   0.12    Homo sapiens [man]
gb:BC048180_2099574 Mus musculus jumonji, AT rich interactive do...    39   0.16    
gb:BC019446_2092924 Mus musculus jumonji, AT rich interactive do...    39   0.16    
gb:AY082429_2075966 Mus musculus PLU1 (Plu1) mRNA, complete cds....    39   0.16    
gb:AE017347_1757812 Cryptococcus neoformans var. neoformans JEC2...    39   0.16    
gb:AE017347_1757811 Cryptococcus neoformans var. neoformans JEC2...    39   0.16    
pir|T24864|T24864 hypothetical protein T12D8.1 - Caenorhabditis ...    39   0.16    Caenorhabditis elegans [roundworm]
gb:AP003074_1824582 Oryza sativa (japonica cultivar-group) genom...    39   0.20    
gb:CR382139_1672747 Debaryomyces hansenii chromosome G of strain...    39   0.20    
gb:CR382131_1664711 Yarrowia lipolytica chromosome E of strain C...    39   0.20    
gb:BT005934_1638856 Arabidopsis thaliana At2g19260 gene, complet...    39   0.20    
gb:AY088603_1573619 Arabidopsis thaliana clone 8278 mRNA, comple...    39   0.20    
gb:AY050934_1562421 Arabidopsis thaliana putative ES43 protein (...    39   0.20    
gb:AC007789_1536193 Oryza sativa BAC OSJNBa0049B20 genomic seque...    39   0.20    
gb:AY069276_1294006 Drosophila melanogaster GM10839 full length ...    39   0.20    
gb:AK045780_1167537 Mus musculus adult male corpora quadrigemina...    39   0.20    
gb:AE014135_1137651 Drosophila melanogaster chromosome 4, comple...    39   0.20    
pir|H85462|H85462 ES43 like protein [imported] - Arabidopsis tha...    39   0.20    Arabidopsis thaliana [mouse-ear cress]
pir|T06070|T06070 ES43 protein homolog F19H22.200 - Arabidopsis ...    39   0.20    Arabidopsis thaliana [mouse-ear cress]
pir|T01274|T01274 hypothetical protein At2g19260 [imported] - Ar...    39   0.20    Arabidopsis thaliana [mouse-ear cress]
gb:HSM802382_2017479 Homo sapiens mRNA; cDNA DKFZp434I2412 (from...    38   0.27    
gb:HSM801343_2017298 Homo sapiens mRNA; cDNA DKFZp434I0617 (from...    38   0.27    
gb:HSM801319_2017286 Homo sapiens mRNA; cDNA DKFZp434D0815 (from...    38   0.27    
gb:HSM801308_2017283 Homo sapiens mRNA; cDNA DKFZp434N0335 (from...    38   0.27    
gb:HSA243706_2001055 Homo sapiens mRNA for RB-binding protein (r...    38   0.27    
gb:HSA132440_2000289 Homo sapiens mRNA for PLU-1 protein.              38   0.27    
gb:AF087481_1881845 Homo sapiens retinoblastoma binding protein ...    38   0.27    
gb:AP005452_1852036 Oryza sativa (japonica cultivar-group) genom...    38   0.27    
gb:AX879260_1477740 Sequence 14165 from Patent EP1074617.              38   0.27    
pir|S44281|S44281 ES43 protein - barley>gb:HVES43_1682352 H.vulg...    38   0.27    Hordeum vulgare [barley]
pir|T42697|T42697 hypothetical protein DKFZp434N0335.1 - human (...    38   0.27    Homo sapiens [man]
gb:AP005474_1852539 Oryza sativa (japonica cultivar-group) genom...    38   0.35    
pir|T38660|T38660 probable transcription regulator protein - fis...    38   0.35    Schizosaccharomyces pombe
pir|T52301|T52301 GYMNOS/PICKLE protein [imported] - Arabidopsis...    38   0.35    Arabidopsis thaliana [mouse-ear cress]
pir|B84645|B84645 hypothetical protein At2g25170 [imported] - Ar...    38   0.35    Arabidopsis thaliana [mouse-ear cress]
gb:CR382124_1656648 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.46    
gb:CEZK593_1371664 Caenorhabditis elegans cosmid ZK593, complete...    37   0.46    
pir|T27924|T27924 hypothetical protein ZK593.4 - Caenorhabditis ...    37   0.46    Caenorhabditis elegans [roundworm]
gb:SPBP4H10_1720628 S.pombe chromosome II P1 clone p4H10.              37   0.60    
gb:SPBP19A11_1720579 S.pombe chromosome II cosmid p19A11.              37   0.60    
gb:CR382136_1668690 Debaryomyces hansenii chromosome D of strain...    37   0.60    
gb:BT005981_1638903 Arabidopsis thaliana At5g53430 gene, complet...    37   0.60    
gb:U70849_1405986 Caenorhabditis elegans cosmid F29B9, complete ...    37   0.60    
gb:CR382401_1375118 Plasmodium falciparum chromosome 6, complete...    37   0.60    
pir|T29935|T29935 hypothetical protein F29B9.2 - Caenorhabditis ...    37   0.60    Caenorhabditis elegans [roundworm]
gb:AF323954_1786316 Arabidopsis thaliana p300/CBP acetyltransfer...    37   0.78    
gb:AY692957_1623004 Saccharomyces cerevisiae clone FLH006802.01X...    37   0.78    
pir|S65193|S65193 hypothetical protein YPL181w - yeast (Saccharo...    37   0.78    Saccharomyces cerevisiae [brewer's yeast]
pir|T01055|T01055 hypothetical protein YUP8H12R.38 - Arabidopsis...    37   0.78    Arabidopsis thaliana [mouse-ear cress]
sp|Q9TSV4|TF19_PIG|TF19_PIG Transcription factor 19 (Transcription factor...    37   0.78    Sus scrofa [pigs]
gb:BT008209_2151141 Synthetic construct Homo sapiens transcripti...    36   1.0     
gb:BC002493_1968159 Homo sapiens transcription factor 19 (SC1), ...    36   1.0     
gb:AL662833_1931667 Human DNA sequence from clone XXbac-101P6 on...    36   1.0     
gb:AB128049_1873955 Macaca mulatta genes, MHC class I region, pa...    36   1.0     
gb:AB029517_1865920 Homo sapiens SCI(TCF19)-4 gene, complete cds...    36   1.0     
gb:CR382132_1665938 Yarrowia lipolytica chromosome F of strain C...    36   1.0     
gb:AF411835_1268884 Aedes albopictus cell fusing agent virus pol...    36   1.0     
pir|S69047|S69047 hypothetical protein YPL138c - yeast (Saccharo...    36   1.0     Saccharomyces cerevisiae [brewer's yeast]
sp|Q7YR48|TF19_PANTR|TF19_PANTR Transcription factor 19 (Transcription fact...    36   1.0     Pan troglodytes
sp|Q9Y242|TF19_HUMAN|TF19_HUMAN Transcription factor 19 (Transcription fact...    36   1.0     Homo sapiens [man]
gb:AE016816_1746805 Ashbya gossypii (= Eremothecium gossypii) AT...    36   1.3     
gb:CR548612_1375276 Paramecium tetraurelia macronuclear largest ...    36   1.3     
gb:AY069824_1294554 Drosophila melanogaster SD07276 full length ...    36   1.3     
gb:AE014297_1142361 Drosophila melanogaster chromosome 3R, compl...    36   1.3     
gb:AE014297_1142360 Drosophila melanogaster chromosome 3R, compl...    36   1.3     
gb:AE014297_1142359 Drosophila melanogaster chromosome 3R, compl...    36   1.3     
gb:AE014134_1127322 Drosophila melanogaster chromosome 2L, compl...    36   1.3     
gb:AF286030_1783184 Ustilago maydis regulator Ustilago maydis 1 ...    35   1.7     
gb:BT011675_1641197 Arabidopsis thaliana At2g19660 gene, complet...    35   1.7     
gb:ATAC010870_1543187 Arabidopsis thaliana chromosome III BAC T1...    35   1.7     
gb:AC009894_1536885 Arabidopsis thaliana chromosome I BAC T6H22 ...    35   1.7     
gb:AC005917_1533210 Arabidopsis thaliana chromosome 2 clone F3P1...    35   1.7     
gb:AC005169_1532281 Arabidopsis thaliana chromosome 2 clone F6F2...    35   1.7     
pir|T19201|T19201 hypothetical protein C11G6.3 - Caenorhabditis ...    35   1.7     Caenorhabditis elegans [roundworm]
pir|T12968|T12968 hypothetical protein T6H20.170 - Arabidopsis t...    35   1.7     Arabidopsis thaliana [mouse-ear cress]
pir|E84579|E84579 hypothetical protein At2g19660 [imported] - Ar...    35   1.7     Arabidopsis thaliana [mouse-ear cress]
sp|P40034|YEO1_YEAST|YEO1_YEAST Hypothetical 56.5 kDa protein in CAJ1-HOM3 ...    35   1.7     Saccharomyces cerevisiae [brewer's yeast]
gb:DROPLYCMB_1382548 Drosophila melanogaster polycomblike nuclea...    35   2.3     
pir|E86302|E86302 hypothetical protein F17F16.8 [imported] - Ara...    35   2.3     Arabidopsis thaliana [mouse-ear cress]
pir|T50313|T50313 hypothetical phd finger protein [imported] - f...    35   2.3     Schizosaccharomyces pombe
sp|Q24459|PCL_DROME|PCL_DROME Polycomb protein Pcl (Polycomblike protein)....    35   2.3     Drosophila melanogaster
gb:AB111948_2465634 Tetraodon nigroviridis retrotransposon KenoT...    35   3.0     
gb:AY138582_2076730 Mus musculus mixed-lineage leukemia 3 protei...    35   3.0     
gb:AY024361_1934335 Homo sapiens MLL3 mRNA, complete cds.              35   3.0     
gb:AF264750_1893756 Homo sapiens ALR-like protein mRNA, complete...    35   3.0     
gb:AC006474_1875155 Homo sapiens PAC clone RP4-669I17 from 7, co...    35   3.0     
gb:AB040939_1866868 Homo sapiens mRNA for KIAA1506 protein, part...    35   3.0     
gb:AY442258_1606336 Populus alba x Populus tremula clone cET-1-p...    35   3.0     
gb:AK054270_1170760 Mus musculus 2 days pregnant adult female ov...    35   3.0     
gb:AE005173_893481 Arabidopsis thaliana chromosome 1, bottom arm...    35   3.0     
pir|F84833|F84833 probable SNF2/SWI2 family transcription factor...    35   3.0     Arabidopsis thaliana [mouse-ear cress]
sp|Q8BRH4|MLL3_MOUSE|MLL3_MOUSE Myeloid/lymphoid or mixed-lineage leukemia ...    35   3.0     Mus musculus [mouse]
sp|Q8NEZ4|MLL3_HUMAN|MLL3_HUMAN Myeloid/lymphoid or mixed-lineage leukemia ...    35   3.0     Homo sapiens [man]
gb:AY260488_2081112 Mus pahari SmcY protein gene, partial cds.         34   3.9     
gb:CR382126_1659574 Kluyveromyces lactis strain NRRL Y-1140 chro...    34   3.9     
gb:AY093116_1575070 Arabidopsis thaliana putative PHD-type zinc ...    34   3.9     
gb:AX876548_1476582 Sequence 11453 from Patent EP1074617.>gb:AK0...    34   3.9     
gb:AK008164_1154422 Mus musculus adult male small intestine cDNA...    34   3.9     
pir|T03455|T03455 ALR protein - human>gb:AF010404_1876230 Homo s...    34   3.9     Homo sapiens [man]
sp|O14686|MLL2_HUMAN|MLL2_HUMAN Myeloid/lymphoid or mixed-lineage leukemia ...    34   3.9     Homo sapiens [man]
gb:S78570_2041761 MLL=trx zinc-finger domain homolog {alternativ...    34   5.0     
gb:HUMTRXLP_2037918 Human trithorax-like protein (TRX1) mRNA, pa...    34   5.0     
gb:HUMMLL_2034848 Human mRNA for MLL.                                  34   5.0     
gb:HUMHRX_2032183 Human germline HRX mRNA, complete cds.               34   5.0     
gb:AY373585_1948315 Homo sapiens myeloid/lymphoid or mixed-linea...    34   5.0     
gb:AF492830_1905096 Homo sapiens CDK6/MLL fusion protein mRNA, p...    34   5.0     
gb:AP006616_1862490 Oryza sativa (japonica cultivar-group) genom...    34   5.0     
gb:AE017347_1757691 Cryptococcus neoformans var. neoformans JEC2...    34   5.0     
gb:AB006699_1509893 Arabidopsis thaliana genomic DNA, chromosome...    34   5.0     
pir|T18543|T18543 probable cell-adhesion protein MFB1 - shiitake...    34   5.0     Lentinula edodes
pir|T41530|T41530 hypothetical protein SPCC645.13 - fission yeas...    34   5.0     Schizosaccharomyces pombe
pir|B96696|B96696 protein F1N21.4 [imported] - Arabidopsis thali...    34   5.0     Arabidopsis thaliana [mouse-ear cress]
pir|I53035|I53035 trithorax homolog HTX - human (fragment)             34   5.0     Homo sapiens [man]
pir|A44265|A44265 trithorax homolog HTX, version 2 - human             34   5.0     Homo sapiens [man]
sp|Q03164|HRX_HUMAN|HRX_HUMAN Zinc finger protein HRX (ALL-1) (Trithorax-l...    34   5.0     Homo sapiens [man]
gb:BC054499_1985182 Homo sapiens Smcy homolog, X-linked (mouse),...    33   6.6     
gb:AL139396_1920695 Human DNA sequence from clone RP11-258C19 on...    33   6.6     
gb:AL139396_1920694 Human DNA sequence from clone RP11-258C19 on...    33   6.6     
gb:AL139396_1920693 Human DNA sequence from clone RP11-258C19 on...    33   6.6     
gb:AE017344_1756341 Cryptococcus neoformans var. neoformans JEC2...    33   6.6     
gb:AC087852_1734202 Oryza sativa chromosome 3 BAC OJ1124_H03 gen...    33   6.6     
gb:CR859025_1183165 Pongo pygmaeus mRNA; cDNA DKFZp468O0728 (fro...    33   6.6     
gb:AE014134_1127749 Drosophila melanogaster chromosome 2L, compl...    33   6.6     
pir|S78428|S78428 destabilase 2 - medicinal leech                      33   6.6     Hirudo medicinalis
sp|P42948|SET4_YEAST|SET4_YEAST SET domain protein 4.>pir|S53382|S53382 pro...    33   6.6     Saccharomyces cerevisiae [brewer's yeast]
sp|P41229|JD1C_HUMAN|JD1C_HUMAN Jumonji/ARID domain-containing protein 1C (...    33   6.6     Homo sapiens [man]
gb:BC043096_2098829 Mus musculus jumonji, AT rich interactive do...    33   8.6     
gb:AY260500_2081124 Mus pahari SmcX protein gene, partial cds.         33   8.6     
gb:AY260498_2081122 Mus cookii SmcX protein gene, partial cds.>g...    33   8.6     
gb:AY260495_2081119 Mus spicilegus SmcX protein gene, partial cd...    33   8.6     
gb:AY260493_2081117 Mus musculus musculus SmcX protein gene, par...    33   8.6     
gb:AY260491_2081115 Hylomyscus alleni SmcX protein gene, partial...    33   8.6     
gb:AK129096_2069327 Mus musculus mRNA for mKIAA0234 protein.           33   8.6     
gb:AF127245_2055525 Mus musculus Smcx (Smcx) mRNA, complete cds.       33   8.6     
gb:AP000366_1819726 Oryza sativa (japonica cultivar-group) genom...    33   8.6     
gb:AF542530_1810115 Cryptococcus neoformans var. neoformans stra...    33   8.6     
gb:OSJN00042_1693763 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.6     
gb:OSJN00029_1693558 Oryza sativa genomic DNA, chromosome 4, BAC...    33   8.6     
gb:CR382137_1670337 Debaryomyces hansenii chromosome E of strain...    33   8.6     
gb:CR382125_1658064 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   8.6     
gb:AY710429_1623904 Cryptococcus gattii strain E566 MATa locus, ...    33   8.6     
gb:AY059087_1564452 Arabidopsis thaliana unknown protein (At1g72...    33   8.6     
gb:AB020754_1514697 Arabidopsis thaliana genomic DNA, chromosome...    33   8.6     
gb:AX528700_1469909 Sequence 33 from Patent WO0246443.                 33   8.6     
sp|P41230|JD1C_MOUSE|JD1C_MOUSE Jumonji/ARID domain-containing protein 1C (...    33   8.6     Mus musculus [mouse]


>pir|T47337|T47337 nucleic acid binding protein-like - Arabidopsis
           thaliana>gb:ATT21C14_1555104 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T21C14.>gb:AY062851_1565507
           Arabidopsis thaliana nucleic acid binding protein-like
           (T21C14.1) mRNA, complete cds.>gb:AY114574_1578616
           Arabidopsis thaliana nucleic acid binding protein-like
           (At3g42790) mRNA, complete cds.
          Length = 250

 Score =  140 bits (353), Expect = 4e-32
 Identities = 64/135 (47%), Positives = 80/135 (59%)
 Frame = -2

Query: 547 SFYCMCRKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRA 368
           SF+   RK LFNMIN++PT+FE+VTG AK  ++ S    +G                 + 
Sbjct: 115 SFHKEERKRLFNMINDVPTIFEVVTGMAKAKDKSSAANQNGNKSKSNSKVRTSEGKSSKT 174

Query: 367 MNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEH 188
                           +HG TLCGACG   G DEFWI CD CE+WFHG+CVK+TPA+AEH
Sbjct: 175 KQPKEEDEEIDEDDEDDHGETLCGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEH 234

Query: 187 MKHYKCPSCSSKRIR 143
           +K YKCPSCS+KR R
Sbjct: 235 IKQYKCPSCSNKRAR 249



>gb:AC137623_1743703 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0426G01, complete sequence.
          Length = 258

 Score =  134 bits (338), Expect = 2e-30
 Identities = 68/137 (49%), Positives = 85/137 (62%), Gaps = 8/137 (5%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHN-EKSVITNHGGXXXXXXXXSRPAESHGRA----- 368
           R+ LFNMIN LPT+FE+VTGAAKK   EK+  + +           RP ESH +A     
Sbjct: 122 RRRLFNMINNLPTIFEVVTGAAKKQTKEKAPNSTNKPNKPSSKMQPRP-ESHSKAPKPPA 180

Query: 367 --MNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKA 194
              + +            E  NTLCG+CG + G DEFWI CD CERW+HG+CVK+TPA+A
Sbjct: 181 PPKDDDESGDEYADEEEEERDNTLCGSCGTNDGKDEFWICCDSCERWYHGKCVKITPARA 240

Query: 193 EHMKHYKCPSCSSKRIR 143
           EH+KHYKCP C +KR R
Sbjct: 241 EHIKHYKCPDCGNKRAR 257



>pir|T51145|T51145 nucleic acid binding protein [imported] -
           rice>gb:AF133118_1770903 Oryza sativa nucleic acid
           binding protein (NBP) gene, complete cds.
          Length = 273

 Score =  133 bits (335), Expect = 5e-30
 Identities = 63/134 (47%), Positives = 80/134 (59%), Gaps = 5/134 (3%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNPH 350
           R+ LFNMIN LPT+FE+VTGAAKK  ++    +              AES  ++    P 
Sbjct: 139 RRRLFNMINNLPTIFEVVTGAAKKQAKEKTPNSSSKSNKPSSKVQSKAESRSKSKLSAPK 198

Query: 349 XXXXXXXXXXE-----HGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM 185
                     E     H NTLCG CG + G DEFWI CD CE+W+HG+CVK+TPA+AEH+
Sbjct: 199 DEEGSGDDEGEEEEDDHDNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHI 258

Query: 184 KHYKCPSCSSKRIR 143
           K YKCP C++KR R
Sbjct: 259 KQYKCPDCTNKRTR 272



>pir|T02745|T02745 nucleic acid binding protein -
           rice>gb:AF047428_1763902 Oryza sativa nucleic acid
           binding protein mRNA, complete cds.>gb:AP003346_1828434
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0434C04.>gb:AP003431_1829230
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, BAC clone:B1099D03.
          Length = 272

 Score =  133 bits (335), Expect = 5e-30
 Identities = 63/134 (47%), Positives = 80/134 (59%), Gaps = 5/134 (3%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNPH 350
           R+ LFNMIN LPT+FE+VTGAAKK  ++    +              AES  ++    P 
Sbjct: 138 RRRLFNMINNLPTIFEVVTGAAKKQAKEKTPNSSSKSNKPSSKVQSKAESRSKSKLSAPK 197

Query: 349 XXXXXXXXXXE-----HGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM 185
                     E     H NTLCG CG + G DEFWI CD CE+W+HG+CVK+TPA+AEH+
Sbjct: 198 DEEGSGDDEGEEEEDDHDNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHI 257

Query: 184 KHYKCPSCSSKRIR 143
           K YKCP C++KR R
Sbjct: 258 KQYKCPDCTNKRAR 271



>gb:AF045571_1763830 Oryza sativa nucleic acid binding protein mRNA,
           complete cds.
          Length = 271

 Score =  132 bits (333), Expect = 8e-30
 Identities = 65/134 (48%), Positives = 79/134 (58%), Gaps = 5/134 (3%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNPH 350
           R+ LFNMIN LPT+FE+VTGAAKK   K    N              AES  ++    P 
Sbjct: 138 RRRLFNMINNLPTIFEVVTGAAKKQ-AKEKTPNSSSKSNKPSSKVSKAESRSKSKLSAPK 196

Query: 349 XXXXXXXXXXE-----HGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM 185
                     E     H NTLCG CG + G DEFWI CD CE+W+HG+CVK+TPA+AEH+
Sbjct: 197 DEEGSGDDEGEEEEDDHDNTLCGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHI 256

Query: 184 KHYKCPSCSSKRIR 143
           K YKCP C++KR R
Sbjct: 257 KQYKCPDCTNKRAR 270



>pir|A84437|A84437 probable PHD-type zinc finger protein [imported]
           - Arabidopsis thaliana>gb:AC005312_1532534 Arabidopsis
           thaliana chromosome 2 clone T16F16 map CIC11A04,
           complete sequence.>gb:BT003905_1637031 Arabidopsis
           thaliana clone RAFL15-12-N24 (R20654) putative PHD-type
           zinc finger protein (At2g02470) mRNA, complete
           cds.>gb:BT005004_1637950 Arabidopsis thaliana clone
           U20654 putative PHD-type zinc finger protein (At2g02470)
           mRNA, complete cds.
          Length = 256

 Score =  132 bits (333), Expect = 8e-30
 Identities = 65/138 (47%), Positives = 84/138 (60%), Gaps = 8/138 (5%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP- 353
           RK LF MINELPT+FE+V+G AK+  + SV  N+          SR +ES  +   ++  
Sbjct: 120 RKRLFQMINELPTIFEVVSGNAKQSKDLSV-NNNNSKSKPSGVKSRQSESLSKVAKMSSP 178

Query: 352 -------HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKA 194
                             +    +CGACG + G DEFWI CD CE+WFHG+CVK+TPAKA
Sbjct: 179 PPKEEEEEEDESEDESEDDEQGAVCGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKA 238

Query: 193 EHMKHYKCPSCSSKRIRP 140
           EH+KHYKCP+CS+KR RP
Sbjct: 239 EHIKHYKCPTCSNKRARP 256



>gb:AY087820_1572847 Arabidopsis thaliana clone 38635 mRNA, complete
           sequence.
          Length = 256

 Score =  132 bits (331), Expect = 1e-29
 Identities = 65/138 (47%), Positives = 84/138 (60%), Gaps = 8/138 (5%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP- 353
           RK LF MINELPT+FE+V+G AK+  + SV  N+          SR +ES  +   ++  
Sbjct: 120 RKRLFQMINELPTIFEVVSGNAKQSKDLSV-NNNNSKSKPSGVKSRQSESLTKVAKMSSP 178

Query: 352 -------HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKA 194
                             +    +CGACG + G DEFWI CD CE+WFHG+CVK+TPAKA
Sbjct: 179 PPKEEEEEEDESEDESEDDEQGAVCGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKA 238

Query: 193 EHMKHYKCPSCSSKRIRP 140
           EH+KHYKCP+CS+KR RP
Sbjct: 239 EHIKHYKCPTCSNKRARP 256



>gb:BT015937_1642555 Arabidopsis thaliana At5g20510 mRNA, complete
           cds.>gb:BT020505_1642899 Arabidopsis thaliana At5g20510
           gene, complete cds.
          Length = 260

 Score =  131 bits (330), Expect = 2e-29
 Identities = 68/140 (48%), Positives = 81/140 (57%), Gaps = 10/140 (7%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKH-NEKSVITNHGGXXXXXXXXSRPAES------HGR 371
           RK LF+MINE+PTV+E+VTG A+K   E     N  G         R  ES      H +
Sbjct: 121 RKRLFSMINEVPTVYEVVTGNAEKQTKEMPSSANQNGNRSKSNSKMRGLESKSSKTIHAK 180

Query: 370 AMNVN---PHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPA 200
                               EHG TLCGACG +   DEFWI CD CE+WFHG CVK+TPA
Sbjct: 181 DEEEGLELEEGEEEEDEDEDEHGETLCGACGDNYASDEFWICCDMCEKWFHGECVKITPA 240

Query: 199 KAEHMKHYKCPSCSSKRIRP 140
           +AEH+KHYKCP+CS+KR RP
Sbjct: 241 RAEHIKHYKCPTCSNKRARP 260



>gb:AY088087_1573111 Arabidopsis thaliana clone 41104 mRNA, complete
           sequence.>gb:BT006199_1639091 Arabidopsis thaliana
           At1g14510 mRNA, complete cds.
          Length = 252

 Score =  131 bits (330), Expect = 2e-29
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXS-RPAESHGRAMNVNP 353
           RK LF MIN+LPT+FE+VTG AK+  ++S   NH            R +ESH +A  ++P
Sbjct: 120 RKRLFQMINDLPTIFEVVTGNAKQSKDQSA--NHNSSRSKSSGGKPRHSESHTKASKMSP 177

Query: 352 HXXXXXXXXXXEHGN---TLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMK 182
                      +  +    +CGACG + G DEFWI CD CE+WFHG+CVK+TPAKAEH+K
Sbjct: 178 PPRKEDESGDEDEDDEQGAVCGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIK 237

Query: 181 HYKCPSCSSKR 149
           HYKCPSC++ +
Sbjct: 238 HYKCPSCTTSK 248



>pir|A86280|A86280 F14L17.29 protein - Arabidopsis
           thaliana>gb:AE005172_890445 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F14L17_1677470 Sequence of BAC F14L17 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 273

 Score =  131 bits (330), Expect = 2e-29
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 4/131 (3%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXS-RPAESHGRAMNVNP 353
           RK LF MIN+LPT+FE+VTG AK+  ++S   NH            R +ESH +A  ++P
Sbjct: 141 RKRLFQMINDLPTIFEVVTGNAKQSKDQSA--NHNSSRSKSSGGKPRHSESHTKASKMSP 198

Query: 352 HXXXXXXXXXXEHGN---TLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMK 182
                      +  +    +CGACG + G DEFWI CD CE+WFHG+CVK+TPAKAEH+K
Sbjct: 199 PPRKEDESGDEDEDDEQGAVCGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIK 258

Query: 181 HYKCPSCSSKR 149
           HYKCPSC++ +
Sbjct: 259 HYKCPSCTTSK 269



>gb:AY087173_1572207 Arabidopsis thaliana clone 32443 mRNA, complete
           sequence.
          Length = 255

 Score =  130 bits (328), Expect = 3e-29
 Identities = 62/135 (45%), Positives = 77/135 (57%), Gaps = 6/135 (4%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP- 353
           RK LFNM+N+LPT+FE+V G AKK  +     ++           R +ES  +     P 
Sbjct: 120 RKRLFNMVNDLPTIFEVVAGTAKKQGKDKSSVSNNSSNRSKSSSKRGSESRAKFSKPEPK 179

Query: 352 -----HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEH 188
                           E G T CGACG+    DEFWI CD CE WFHG+CVK+TPA+AEH
Sbjct: 180 DDEEEEEEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEH 239

Query: 187 MKHYKCPSCSSKRIR 143
           +K YKCPSCS+KR R
Sbjct: 240 IKQYKCPSCSNKRAR 254



>pir|T00616|T00616 probable nucleic acid-binding protein T8K22.23 -
           Arabidopsis thaliana (fragment)
          Length = 142

 Score =  130 bits (328), Expect = 3e-29
 Identities = 64/137 (46%), Positives = 83/137 (60%), Gaps = 8/137 (5%)
 Frame = -2

Query: 526 KVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP-- 353
           K LF MINELPT+FE+V+G AK+  + SV  N+          SR +ES  +   ++   
Sbjct: 7   KRLFQMINELPTIFEVVSGNAKQSKDLSV-NNNNSKSKPSGVKSRQSESLSKVAKMSSPP 65

Query: 352 ------HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAE 191
                            +    +CGACG + G DEFWI CD CE+WFHG+CVK+TPAKAE
Sbjct: 66  PKEEEEEEDESEDESEDDEQGAVCGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKAE 125

Query: 190 HMKHYKCPSCSSKRIRP 140
           H+KHYKCP+CS+KR RP
Sbjct: 126 HIKHYKCPTCSNKRARP 142



>pir|T01840|T01840 hypothetical protein F9D12.13 - Arabidopsis
           thaliana>gb:F9D12_1678662 Arabidopsis thaliana BAC
           F9D12.
          Length = 251

 Score =  128 bits (322), Expect = 2e-28
 Identities = 65/142 (45%), Positives = 82/142 (57%), Gaps = 13/142 (9%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHN-EKSVITNHGGXXXXXXX------XSRPAESHGR 371
           RK LFNM+N+LPT+FE+V G AKK   +KS ++N+                +R +ES  +
Sbjct: 109 RKRLFNMVNDLPTIFEVVAGTAKKQGKDKSSVSNNSSNRSKSSSKVETLFSTRGSESRAK 168

Query: 370 AMNVNP------HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKV 209
                P                 E G T CGACG+    DEFWI CD CE WFHG+CVK+
Sbjct: 169 FSKPEPKDDEEEEEEGVEEEDEDEQGETQCGACGESYAADEFWICCDLCEMWFHGKCVKI 228

Query: 208 TPAKAEHMKHYKCPSCSSKRIR 143
           TPA+AEH+K YKCPSCS+KR R
Sbjct: 229 TPARAEHIKQYKCPSCSNKRAR 250



>gb:ALFNABP_1818997 Alfalfa nucleic acid binding protein (alfin-1)
           mRNA, complete cds.
          Length = 257

 Score =  123 bits (308), Expect = 6e-27
 Identities = 62/135 (45%), Positives = 80/135 (59%), Gaps = 6/135 (4%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXX-SRPAESHGRAMNVNP 353
           RK LF MIN+LPTVFE+ TG AK+  ++    N+G          SR +ES  + + ++ 
Sbjct: 121 RKRLFQMINDLPTVFELATGTAKQSKDQLTAHNNGSNSKYKSSGKSRQSESQTKGVKMSA 180

Query: 352 HXXXXXXXXXXEHGN-----TLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEH 188
                      E  +       CGACG + G DEFWI CD CE+WFHG+CVK+TPAKAEH
Sbjct: 181 PVKEEVDSGEEEEEDDDEQGATCGACGDNYGTDEFWICCDMCEKWFHGKCVKITPAKAEH 240

Query: 187 MKHYKCPSCSSKRIR 143
           +K YKCP CS K+ R
Sbjct: 241 IKQYKCPGCSIKKPR 255



>pir|T09646|T09646 probable zinc finger protein - alfalfa (fragment)
          Length = 257

 Score =  123 bits (308), Expect = 6e-27
 Identities = 62/135 (45%), Positives = 80/135 (59%), Gaps = 6/135 (4%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXX-SRPAESHGRAMNVNP 353
           RK LF MIN+LPTVFE+ TG AK+  ++    N+G          SR +ES  + + ++ 
Sbjct: 121 RKRLFQMINDLPTVFELATGTAKQSKDQLTAHNNGSNSKYKSSGKSRQSESQTKGVKMSA 180

Query: 352 HXXXXXXXXXXEHGN-----TLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEH 188
                      E  +       CGACG + G DEFWI CD CE+WFHG+CVK+TPAKAEH
Sbjct: 181 PVKEEVDSGEEEEEDDDEQGATCGACGDNYGTDEFWICCDMCEKWFHGKCVKITPAKAEH 240

Query: 187 MKHYKCPSCSSKRIR 143
           +K YKCP CS K+ R
Sbjct: 241 IKQYKCPGCSIKKPR 255



>gb:AP005895_1859795 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBb0018L13.>gb:AP006458_1861969 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0072I06.
          Length = 278

 Score =  122 bits (305), Expect = 1e-26
 Identities = 64/142 (45%), Positives = 78/142 (54%), Gaps = 18/142 (12%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKH--------NEKSVITNHGGXXXXXXXXSRP----- 389
           RK LF MIN+LPT+FE+V+G +K          N KS  +N            +P     
Sbjct: 118 RKRLFGMINDLPTIFEVVSGKSKAKPPSANNHSNSKSKSSNKTKSSEPRAKQPKPQPQPP 177

Query: 388 AESHGRAMNVNPHXXXXXXXXXXE-----HGNTLCGACGKHGGLDEFWIGCDKCERWFHG 224
            ++ GR     P                 HG TLCGACG+  G DEFWI CD CE+WFHG
Sbjct: 178 VKNEGREEEGGPDDEEGGGGGGGGGREEEHGETLCGACGESYGADEFWICCDICEKWFHG 237

Query: 223 RCVKVTPAKAEHMKHYKCPSCS 158
           +CVK+TPAKAEH+K YKCPSCS
Sbjct: 238 KCVKITPAKAEHIKQYKCPSCS 259



>gb:AC079038_1541804 Oryza sativa chromosome 7 clone OSJNBb0024A20,
           complete sequence.
          Length = 369

 Score =  122 bits (305), Expect = 1e-26
 Identities = 64/142 (45%), Positives = 78/142 (54%), Gaps = 18/142 (12%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKH--------NEKSVITNHGGXXXXXXXXSRP----- 389
           RK LF MIN+LPT+FE+V+G +K          N KS  +N            +P     
Sbjct: 118 RKRLFGMINDLPTIFEVVSGKSKAKPPSANNHSNSKSKSSNKTKSSEPRAKQPKPQPQPP 177

Query: 388 AESHGRAMNVNPHXXXXXXXXXXE-----HGNTLCGACGKHGGLDEFWIGCDKCERWFHG 224
            ++ GR     P                 HG TLCGACG+  G DEFWI CD CE+WFHG
Sbjct: 178 VKNEGREEEGGPDDEEGGGGGGGGGREEEHGETLCGACGESYGADEFWICCDICEKWFHG 237

Query: 223 RCVKVTPAKAEHMKHYKCPSCS 158
           +CVK+TPAKAEH+K YKCPSCS
Sbjct: 238 KCVKITPAKAEHIKQYKCPSCS 259



>gb:AC124144_1740444 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0099P06, complete sequence.
          Length = 258

 Score =  120 bits (302), Expect = 3e-26
 Identities = 61/130 (46%), Positives = 77/130 (59%), Gaps = 1/130 (0%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAK-KHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP 353
           RK LF M+N+LPTV+E+V+G+ + K  ++S + N           S+      R  N   
Sbjct: 132 RKRLFGMMNDLPTVYEVVSGSRQSKERDRSGMDN----SSRNKISSKHTSDVARVENNIK 187

Query: 352 HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYK 173
                      +H  TLCG CG     DEFWIGCD CERW+HG+CVK+TPAKAE +K YK
Sbjct: 188 EEDEGYDEDDGDHSETLCGTCGGIYSADEFWIGCDVCERWYHGKCVKITPAKAESIKQYK 247

Query: 172 CPSCSSKRIR 143
           CPSCSSKR R
Sbjct: 248 CPSCSSKRPR 257



>gb:AY553842_1613501 Lycopersicon esculentum nucleic acid-binding
           protein mRNA, complete cds.
          Length = 245

 Score =  116 bits (291), Expect = 6e-25
 Identities = 56/129 (43%), Positives = 78/129 (60%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNPH 350
           R  +F +IN+LPTVFE VTG     ++ SV  + G          +  +++ R   +   
Sbjct: 119 RSRVFTLINDLPTVFEAVTGRKPLKDKPSV--DSGKKSKNNAKREKQMKANQR---LQEE 173

Query: 349 XXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKC 170
                     EH  TLCG+CG +G  DEFWIGCD CE+W+HG+CVK+TPAKA+ +K Y+C
Sbjct: 174 SDDEDEGNEDEHEETLCGSCGTNGNEDEFWIGCDMCEKWYHGKCVKITPAKAQSIKEYRC 233

Query: 169 PSCSSKRIR 143
           PSCS+KR +
Sbjct: 234 PSCSNKRAK 242



>gb:AC133007_1741283 Oryza sativa chromosome 3 BAC OSJNBa0094J08
           genomic sequence, complete sequence.
          Length = 247

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/126 (45%), Positives = 71/126 (56%), Gaps = 1/126 (0%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKH-NEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP 353
           RK LFNMIN+LPTV+E +    +KH  ++S + + G                 R +    
Sbjct: 122 RKRLFNMINDLPTVYEALVD--RKHVRDRSGVDSSGKSKHSTKRTGEGQVKRSRVV---- 175

Query: 352 HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYK 173
                      EH  T CG CG     +EFWIGCD CERWFHG+CV++TPAKAEH+KHYK
Sbjct: 176 --AEEYEDDDEEHNETFCGTCGGLYNANEFWIGCDICERWFHGKCVRITPAKAEHIKHYK 233

Query: 172 CPSCSS 155
           CP CSS
Sbjct: 234 CPDCSS 239



>gb:AC104433_1737619 Oryza sativa chromosome 3 BAC OJ1754_E06
           genomic sequence, complete sequence.
          Length = 245

 Score =  114 bits (284), Expect = 4e-24
 Identities = 57/126 (45%), Positives = 71/126 (56%), Gaps = 1/126 (0%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKH-NEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP 353
           RK LFNMIN+LPTV+E +    +KH  ++S + + G                 R +    
Sbjct: 120 RKRLFNMINDLPTVYEALVD--RKHVRDRSGVDSSGKSKHSTKRTGEGQVKRSRVV---- 173

Query: 352 HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYK 173
                      EH  T CG CG     +EFWIGCD CERWFHG+CV++TPAKAEH+KHYK
Sbjct: 174 --AEEYEDDDEEHNETFCGTCGGLYNANEFWIGCDICERWFHGKCVRITPAKAEHIKHYK 231

Query: 172 CPSCSS 155
           CP CSS
Sbjct: 232 CPDCSS 237



>gb:AP004144_1838205 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1712_E04.>gb:AP004865_1846219 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0020C11.
          Length = 267

 Score =  113 bits (283), Expect = 5e-24
 Identities = 60/135 (44%), Positives = 76/135 (56%), Gaps = 6/135 (4%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPA-ESHGRAMNVNP 353
           R+ LF MIN LPTV+E+VTG AKK  + S      G         +P+ +S+  +    P
Sbjct: 137 RRRLFTMINGLPTVYEVVTGIAKKQTKVS-----NGSSKSNKSNPKPSKQSNSNSKPAKP 191

Query: 352 -----HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEH 188
                           E    +CGACG+     EFWI CD CE+WFHG+CV++TPAKAEH
Sbjct: 192 PQPKDEEDSGPEGTEDEDQAYMCGACGETYANGEFWICCDVCEKWFHGKCVRITPAKAEH 251

Query: 187 MKHYKCPSCSSKRIR 143
           +K YKCP CSSKR R
Sbjct: 252 IKQYKCPGCSSKRSR 266



>gb:AC073395_1541025 Arabidopsis thaliana chromosome 3 BAC F11B9
           genomic sequence, complete
           sequence.>gb:ATAC009991_1543105 Arabidopsis thaliana
           chromosome III BAC F9F8 genomic sequence, complete
           sequence.>gb:AY058833_1564370 Arabidopsis thaliana
           At3g11200/F11B9.12 mRNA, complete
           cds.>gb:AY085138_1570219 Arabidopsis thaliana clone
           13297 mRNA, complete sequence.>gb:AY143832_1583289
           Arabidopsis thaliana At3g11200/F11B9.12 mRNA, complete
           cds.
          Length = 246

 Score =  112 bits (279), Expect = 1e-23
 Identities = 57/130 (43%), Positives = 78/130 (60%), Gaps = 1/130 (0%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGA-AKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP 353
           RK LF++IN+LPT+F++VTG  A K N+ S  ++ G         S   ++      +  
Sbjct: 119 RKRLFSLINDLPTLFDVVTGRKAMKDNKPS--SDSGSKSRNGTKRSIDGQTKSSTPKLME 176

Query: 352 HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYK 173
                       HG+TLCG+CG H   +EFWI CD CERW+HG+CVK+TPAKAE +K YK
Sbjct: 177 ESYEEEEEEDE-HGDTLCGSCGGHYTNEEFWICCDVCERWYHGKCVKITPAKAESIKQYK 235

Query: 172 CPSCSSKRIR 143
           CP C +K+ R
Sbjct: 236 CPPCCAKKGR 245



>gb:AB005241_1509494 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MOP10.>gb:AY084560_1569649 Arabidopsis thaliana
           clone 111750 mRNA, complete
           sequence.>gb:AK176462_1818450 Arabidopsis thaliana mRNA
           for nucleic acid binding protein-like, complete cds,
           clone: RAFL24-25-C05.>gb:AK176806_1818794 Arabidopsis
           thaliana mRNA for nucleic acid binding protein-like,
           complete cds, clone: RAFL25-35-H08.
          Length = 241

 Score =  111 bits (278), Expect = 2e-23
 Identities = 58/130 (44%), Positives = 77/130 (59%), Gaps = 1/130 (0%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAK-KHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNP 353
           RK LF++IN+LPT+FE+VTG    K  + S+                  +S  + M  + 
Sbjct: 117 RKRLFSLINDLPTLFEVVTGRKPIKDGKPSMDLGSKSRNGVKRSIEGQTKSTPKLMEES- 175

Query: 352 HXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYK 173
                      EHG+TLCG+CG +   DEFWI CD CERW+HG+CVK+TPAKAE +K YK
Sbjct: 176 -----YEDEDDEHGDTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYK 230

Query: 172 CPSCSSKRIR 143
           CPSC +K+ R
Sbjct: 231 CPSCCTKKGR 240



>gb:AP005246_1849464 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0061L20.
          Length = 244

 Score =  110 bits (275), Expect = 4e-23
 Identities = 57/131 (43%), Positives = 71/131 (54%), Gaps = 4/131 (3%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMNVNPH 350
           RK LF++IN+ PTV E ++      + KS   N           S+   S  RA +V   
Sbjct: 120 RKRLFSLINDHPTVLEALSDRKHGRDNKSGADN----------GSKSRHSGKRANDVQTK 169

Query: 349 XXXXXXXXXXE----HGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMK 182
                          H  TLCG CG     +EFWIGCD CERWFHG+CV++TPAKAEH+K
Sbjct: 170 TSRPAVVDDGYDEEEHSETLCGTCGGRYNANEFWIGCDICERWFHGKCVRITPAKAEHIK 229

Query: 181 HYKCPSCSSKR 149
           HYKCP CSS +
Sbjct: 230 HYKCPDCSSSK 240



>gb:OSJN00235_1697148 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0027P08, complete sequence.
          Length = 256

 Score =  105 bits (263), Expect = 1e-21
 Identities = 54/134 (40%), Positives = 69/134 (51%), Gaps = 5/134 (3%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMN---- 362
           R+ LF M + LPTVFE+V+G     N +S   N            +   S  +       
Sbjct: 125 RERLFMMTSSLPTVFEVVSGGV---NTQSKTANGSSKNKSGSKPPKRPNSDSKPQKQVQA 181

Query: 361 -VNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM 185
                          +   T+CGACG+     EFWI CD CE WFHG+CV++TPAKAEH+
Sbjct: 182 KYEEENGGRGNGGDEDQAETICGACGEAYANGEFWICCDICETWFHGKCVRITPAKAEHI 241

Query: 184 KHYKCPSCSSKRIR 143
           KHYKCP CS+KR R
Sbjct: 242 KHYKCPGCSNKRTR 255



>gb:BC067234_1987264 Homo sapiens fetal Alzheimer antigen, mRNA
           (cDNA clone IMAGE:4557629), partial cds.
          Length = 171

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 20/42 (47%), Positives = 29/42 (69%)
 Frame = -2

Query: 280 GGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           G   +F+IGCD+C+ W+HGRCV +  ++AE +  Y CP C S
Sbjct: 1   GDESQFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQS 42



>gb:BC050566_1984403 Homo sapiens fetal Alzheimer antigen, mRNA
           (cDNA clone IMAGE:3870623), partial cds.
          Length = 240

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           +F+IGCD+C+ W+HGRCV +  ++AE +  Y CP C S
Sbjct: 74  QFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQS 111



 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 17/36 (47%), Positives = 23/36 (63%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           +F+IGCD C  W+HG CV +T  +A+ M  Y C  C
Sbjct: 16  KFYIGCDLCTNWYHGECVGITEKEAKKMDVYICNDC 51



>gb:AY282495_1941893 Homo sapiens bromodomain PHD finger transcription
            factor mRNA, complete cds.
          Length = 2764

 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
            +F+IGCD+C+ W+HGRCV +  ++AE +  Y CP C S
Sbjct: 2598 KFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQS 2635



>gb:AB032251_1866046 Homo sapiens BPTF mRNA for bromodomain PHD finger
            transcription factor, complete cds.
          Length = 2781

 Score = 56.2 bits (134), Expect = 9e-07
 Identities = 19/38 (50%), Positives = 28/38 (73%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
            +F+IGCD+C+ W+HGRCV +  ++AE +  Y CP C S
Sbjct: 2615 KFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQS 2652



>gb:AF417921_1269439 Drosophila melanogaster nucleosome remodeling
            factor large subunit NURF301 (Nurf301) mRNA, complete
            cds.
          Length = 2669

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +F+I CDKC+ WFHGRCV +  ++AE +  Y CP C  K
Sbjct: 2508 QFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRK 2546



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
            +F++GCD C  WFHG CV +T   ++ +  + C  C   R
Sbjct: 2452 KFYVGCDLCSNWFHGDCVSITEEASKKLSEFICIDCKRAR 2491



>gb:AE014296_1133983 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003467_1211282 Drosophila melanogaster
            chromosome 3L, section 1 of 83 of the complete sequence.
          Length = 2669

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +F+I CDKC+ WFHGRCV +  ++AE +  Y CP C  K
Sbjct: 2508 QFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRK 2546



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
            +F++GCD C  WFHG CV +T   ++ +  + C  C   R
Sbjct: 2452 KFYVGCDLCSNWFHGDCVSITEEASKKLSEFICIDCKRAR 2491



>gb:AE014296_1133982 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003467_1211281 Drosophila melanogaster
            chromosome 3L, section 1 of 83 of the complete sequence.
          Length = 2649

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 20/39 (51%), Positives = 27/39 (69%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +F+I CDKC+ WFHGRCV +  ++AE +  Y CP C  K
Sbjct: 2488 QFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRK 2526



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 15/40 (37%), Positives = 23/40 (57%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
            +F++GCD C  WFHG CV +T   ++ +  + C  C   R
Sbjct: 2432 KFYVGCDLCSNWFHGDCVSITEEASKKLSEFICIDCKRAR 2471



>gb:BC060715_2104161 Mus musculus fetal Alzheimer antigen, mRNA (cDNA
            clone MGC:67573 IMAGE:6405350), complete cds.
          Length = 1114

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 18/38 (47%), Positives = 28/38 (73%)
 Frame = -2

Query: 268  EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
            +F+IGCD+C+ W+HGRCV +  ++A+ +  Y CP C S
Sbjct: 948  KFYIGCDRCQNWYHGRCVGILQSEADLIDEYVCPQCQS 985



>gb:BC021489_2093498 Mus musculus fetal Alzheimer antigen, mRNA
           (cDNA clone IMAGE:5345342), partial cds.
          Length = 645

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 18/38 (47%), Positives = 28/38 (73%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           +F+IGCD+C+ W+HGRCV +  ++A+ +  Y CP C S
Sbjct: 479 KFYIGCDRCQNWYHGRCVGILQSEADLIDEYVCPQCQS 516



>gb:AE014298_1124943 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003446_1210125 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete
           sequence.>gb:AY089443_1297099 Drosophila melanogaster
           AT26187 full insert cDNA.
          Length = 366

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 19/38 (50%), Positives = 26/38 (68%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD CE W+HG C+++T   AEH+K+Y C  C  +
Sbjct: 51  FMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKE 88



>gb:CR382130_1663380 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 487

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 22/45 (48%), Positives = 31/45 (68%), Gaps = 2/45 (4%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK--RIRP 140
           ++ IGCD CE W HG CV +TPA+A+ M  + CP C+ K  ++RP
Sbjct: 183 KWMIGCDYCEEWIHGSCVGITPARAKLMHKFCCPYCTHKAEKMRP 227



>gb:CEF26H11_1363033 Caenorhabditis elegans cosmid F26H11, complete
           sequence.
          Length = 413

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           C K     +F++GCD C+ WFH  CV  T A+AE    Y CP+C+
Sbjct: 183 CQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACT 227



 Score = 41.2 bits (95), Expect = 0.032
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
           C K     + +I C+ C RW+HG CV V       ++H+ C  C  ++ R
Sbjct: 123 CQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQER 172



>gb:CEF26H11_1363030 Caenorhabditis elegans cosmid F26H11, complete
           sequence.
          Length = 692

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           C K     +F++GCD C+ WFH  CV  T A+AE    Y CP+C+
Sbjct: 462 CQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACT 506



 Score = 41.2 bits (95), Expect = 0.032
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
           C K     + +I C+ C RW+HG CV V       ++H+ C  C  ++ R
Sbjct: 402 CQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQER 451



>gb:CEF26H11_1363027 Caenorhabditis elegans cosmid F26H11, complete
            sequence.
          Length = 2266

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = -2

Query: 292  CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
            C K     +F++GCD C+ WFH  CV  T A+AE    Y CP+C+
Sbjct: 2036 CQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACT 2080



 Score = 41.2 bits (95), Expect = 0.032
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = -2

Query: 292  CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
            C K     + +I C+ C RW+HG CV V       ++H+ C  C  ++ R
Sbjct: 1976 CQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQER 2025



>gb:AE014298_1124944 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003446_1210126 Drosophila melanogaster
           chromosome X, section 30 of 74 of the complete sequence.
          Length = 663

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 18/38 (47%), Positives = 25/38 (65%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD CE W+HG C+ +T  +A+H+K Y C  C  +
Sbjct: 73  FMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCKKE 110



>pir|T21435|T21435 hypothetical protein F26H11.3c - Caenorhabditis
           elegans
          Length = 452

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           C K     +F++GCD C+ WFH  CV  T A+AE    Y CP+C+
Sbjct: 222 CQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACT 266



 Score = 41.2 bits (95), Expect = 0.032
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
           C K     + +I C+ C RW+HG CV V       ++H+ C  C  ++ R
Sbjct: 162 CQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQER 211



>pir|T21430|T21430 hypothetical protein F26H11.3b - Caenorhabditis
           elegans>gb:CEF26H11_1363032 Caenorhabditis elegans
           cosmid F26H11, complete sequence.
          Length = 510

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           C K     +F++GCD C+ WFH  CV  T A+AE    Y CP+C+
Sbjct: 280 CQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACT 324



 Score = 41.2 bits (95), Expect = 0.032
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
           C K     + +I C+ C RW+HG CV V       ++H+ C  C  ++ R
Sbjct: 220 CQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQER 269



>pir|T21433|T21433 hypothetical protein F26H11.3a - Caenorhabditis
           elegans>gb:CEF26H11_1363031 Caenorhabditis elegans
           cosmid F26H11, complete sequence.
          Length = 405

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 20/45 (44%), Positives = 27/45 (60%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           C K     +F++GCD C+ WFH  CV  T A+AE    Y CP+C+
Sbjct: 175 CQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACT 219



 Score = 41.2 bits (95), Expect = 0.032
 Identities = 16/50 (32%), Positives = 25/50 (50%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
           C K     + +I C+ C RW+HG CV V       ++H+ C  C  ++ R
Sbjct: 115 CQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQER 164



>gb:BC056775_2551962 Danio rerio zgc:63512, mRNA (cDNA clone
           MGC:63512 IMAGE:2643181), complete cds.
          Length = 570

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 17/38 (44%), Positives = 24/38 (63%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+K++   A+ ++ + C  C SK
Sbjct: 37  FMIGCDSCSEWFHGDCIKISEKTAKTIRVWYCEKCRSK 74



>gb:BC052918_2550500 Danio rerio CXXC finger 1 (PHD domain), mRNA
           (cDNA clone MGC:55527 IMAGE:2642064), complete cds.
          Length = 563

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+ VT   A+ ++ + C  C ++
Sbjct: 38  FMIGCDNCNEWFHGHCINVTEKMAKAIREWYCQQCRAR 75



>gb:AL844847_2504591 Zebrafish DNA sequence from clone DKEY-13A21 in
           linkage group 11 Contains three novel genes, the opn1lw1
           gene for opsin 1 (cone pigments), long-wave-sensitive,
           1, a gene for novel protein similar to human and rodent
           member RAS oncogene family RAB7 (RAB7), a gene for novel
           protein remotely similar to human host cell factor 1
           (VP16-accessory protein) (HCFC1), the opn1sw2 gene for
           opsin 1 (cone pigments), short-wave-sensitive 1, a gene
           for novel protein similar to human and mouse CpG binding
           protein (CGBP), a gene for novel protein similar to
           vertebrate microphthalmia-associated transcription
           factor (MITF) and zebrafish transcription factor binding
           to IGHM enhancer 3a (tfe3a), a gene for novel protein
           similar to human and rodent catechol-O-methyltransferase
           (COMT), the flj10613l gene for hypothetical protein
           FLJ10613-like (H. sapiens), a gene for novel protein
           similar to human and mouse methyl-CpG binding domain
           protein 1 (MBD1), a gene for novel protein similar to
           zebrafish red-sensitive opsin (rdops), a gene for novel
           protein similar to mouse and human host cell factor C1
           (VP16-accessory protein) (HCFC1), a gene for novel
           protein similar to human and rodent metabotropic
           glutamate receptors (GRM) and two CpG islands, complete
           sequence.
          Length = 563

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+ VT   A+ ++ + C  C ++
Sbjct: 38  FMIGCDNCNEWFHGHCINVTEKMAKAIREWYCQQCRAR 75



>gb:HSDJ22I17_2011983 Human DNA sequence from clone RP1-22I17 on
           chromosome 6q11.1-12. Contains the 3' end of the gene
           KIAA0244, the 3' end of the gene for a novel protein
           with EGF-like and laminin G domains, ESTs, STSs and
           GSSs, complete sequence.
          Length = 1957

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM----KHYKCPSCSSK 152
           CG C K  G + F +GC +C+ WFHG CV ++ ++A+ M    K Y C  C ++
Sbjct: 638 CGFCKKPHG-NRFMVGCGRCDDWFHGDCVGLSLSQAQQMGEEDKEYVCVKCCAE 690



>gb:D87685_1995367 Human mRNA for KIAA0244 gene, partial cds.
          Length = 2044

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM----KHYKCPSCSSK 152
           CG C K  G + F +GC +C+ WFHG CV ++ ++A+ M    K Y C  C ++
Sbjct: 725 CGFCKKPHG-NRFMVGCGRCDDWFHGDCVGLSLSQAQQMGEEDKEYVCVKCCAE 777



>gb:BC015733_1975270 Homo sapiens CXXC finger 1 (PHD domain), mRNA
           (cDNA clone MGC:22977 IMAGE:4857493), complete cds.
          Length = 660

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+++T   A+ ++ + C  C  K
Sbjct: 39  FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76



>gb:AF149758_1886213 Homo sapiens CpG binding protein (CGBP) mRNA,
           complete cds.
          Length = 656

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+++T   A+ ++ + C  C  K
Sbjct: 39  FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76



>gb:BT020741_1436099 Bos taurus CXXC finger 1 (PHD domain) (CXXC1),
           mRNA, complete cds.
          Length = 658

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+++T   A+ ++ + C  C  K
Sbjct: 39  FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76



>gb:CR860060_1184153 Pongo pygmaeus mRNA; cDNA DKFZp469O086 (from
           clone DKFZp469O086).
          Length = 172

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+++T   A+ ++ + C  C  K
Sbjct: 39  FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76



>sp|Q92576|PHF3_HUMAN PHD finger protein 3.>gb:AF091622_1882605 Homo
           sapiens PHD finger protein 3 (PHF3) mRNA, complete
           cds.>gb:AL445676_1927716 Human DNA sequence from clone
           RP11-59D5 on chromosome 6 Contains part of the PHF3 gene
           for PHD finger protein 3, complete sequence.
          Length = 2039

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM----KHYKCPSCSSK 152
           CG C K  G + F +GC +C+ WFHG CV ++ ++A+ M    K Y C  C ++
Sbjct: 720 CGFCKKPHG-NRFMVGCGRCDDWFHGDCVGLSLSQAQQMGEEDKEYVCVKCCAE 772



>sp|Q9CWW7|CGBP_MOUSE CpG binding protein (Protein containing PHD
           finger and CXXC domain 1).>gb:AK010337_1155687 Mus
           musculus ES cells cDNA, RIKEN full-length enriched
           library, clone:2410002I16 product:CpG binding protein
           (containing PHD and CXXC, zinc finger domains), full
           insert sequence.>gb:AK083655_1174037 Mus musculus 9 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:D030060C24 product:CpG binding protein
           (containing PHD and CXXC, zinc finger domains), full
           insert sequence.>gb:AY099096_2076182 Mus musculus CpG
           binding protein mRNA, complete cds.>gb:AY099351_2076191
           Mus musculus CpG binding protein (Cgbp) gene, complete
           cds.>gb:BC030938_2096933 Mus musculus CXXC finger 1 (PHD
           domain), mRNA (cDNA clone MGC:32130 IMAGE:3980339),
           complete cds.
          Length = 660

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+++T   A+ ++ + C  C  K
Sbjct: 39  FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76



>sp|Q9P0U4|CGBP_HUMAN CpG binding protein (Protein containing PHD
           finger and CXXC domain 1).>gb:HSM801830_1186490 Homo
           sapiens mRNA; cDNA DKFZp434F174 (from clone
           DKFZp434F174).>gb:AB031069_1865996 Homo sapiens PCCX1
           mRNA for protein containing CXXC domain 1, complete
           cds.>gb:BC014940_1974843 Homo sapiens CXXC finger 1 (PHD
           domain), mRNA (cDNA clone MGC:18007 IMAGE:3922983),
           complete cds.
          Length = 656

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 23/38 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+++T   A+ ++ + C  C  K
Sbjct: 39  FMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREK 76



>gb:BC072285_2556537 Xenopus laevis MGC82437 protein, mRNA (cDNA
           clone MGC:82437 IMAGE:4680834), complete cds.
          Length = 576

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           F IGCD C  WFHG C+ +T   A+ ++ + C  C  K
Sbjct: 36  FMIGCDHCNEWFHGHCINITEKMAKAIREWYCMQCREK 73



>pir|T47966|T47966 hypothetical protein F15G16.130 - Arabidopsis
           thaliana>gb:ATF15G16_1548700 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F15G16.
          Length = 902

 Score = 47.0 bits (110), Expect = 6e-04
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 4/81 (4%)
 Frame = -2

Query: 391 PAESHGRAMNVNPHXXXXXXXXXXEHGNTLCGACGK--HGGLDEFWIGCDKCERWFHGRC 218
           P +S  R  +  P              N  CG C +  H   D  W+ CD C+ W H  C
Sbjct: 321 PLKSLKRTKDSQPEELLCKHCSKLRKSNQYCGICKRIWHPSDDGDWVCCDGCDVWVHAEC 380

Query: 217 VKVTPAKAEHMKH--YKCPSC 161
             +T  + + ++H  Y CP C
Sbjct: 381 DNITNERFKELEHNNYYCPDC 401



>gb:BC056031_2551614 Xenopus laevis hypothetical protein LOC398683,
           mRNA (cDNA clone IMAGE:4959946), partial cds.
          Length = 495

 Score = 46.6 bits (109), Expect = 8e-04
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDVCQDWFHGSCVGVEEEKASEIDLYHCPNC 53



>gb:AK122447_2069112 Mus musculus mRNA for mKIAA1111 protein.
          Length = 1005

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 1   FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 35



>gb:BC053861_1985077 Homo sapiens PHD finger protein 8, mRNA (cDNA
           clone MGC:61779 IMAGE:5138930), complete cds.
          Length = 1024

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:AL732374_1932713 Human DNA sequence from clone RP13-444K19 on
           chromosome X Contains a mitochondrial ribosomal protein
           S18C (MRPS18C) pseudogene, the 3' end of the gene for a
           novel protein similar to PHD finger protein 2 PHF2 and a
           CpG island, complete sequence.>gb:HS501A4_1998890 Human
           DNA sequence from clone RP3-501A4 on chromosome
           Xp11.1-11.22 Contains part of the gene for a novel
           protein similar to PHD finger protein 2 PHF2, complete
           sequence.
          Length = 114

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:AL732374_1932712 Human DNA sequence from clone RP13-444K19 on
           chromosome X Contains a mitochondrial ribosomal protein
           S18C (MRPS18C) pseudogene, the 3' end of the gene for a
           novel protein similar to PHD finger protein 2 PHF2 and a
           CpG island, complete sequence.>gb:HS501A4_1998889 Human
           DNA sequence from clone RP3-501A4 on chromosome
           Xp11.1-11.22 Contains part of the gene for a novel
           protein similar to PHD finger protein 2 PHF2, complete
           sequence.
          Length = 170

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:AL732374_1932710 Human DNA sequence from clone RP13-444K19 on
           chromosome X Contains a mitochondrial ribosomal protein
           S18C (MRPS18C) pseudogene, the 3' end of the gene for a
           novel protein similar to PHD finger protein 2 PHF2 and a
           CpG island, complete sequence.>gb:HS501A4_1998888 Human
           DNA sequence from clone RP3-501A4 on chromosome
           Xp11.1-11.22 Contains part of the gene for a novel
           protein similar to PHD finger protein 2 PHF2, complete
           sequence.
          Length = 878

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:AL589872_1929214 Human DNA sequence from clone RP11-161N3 on
           chromosome X Contains the 5' end of the gene for a novel
           protein similar to PHD finger protein 2 PHF2, the 3' end
           of a novel gene, a ribosomal protein L37 (RPL37)
           pseudogene and three CpG islands, complete
           sequence.>gb:AL732374_1932709 Human DNA sequence from
           clone RP13-444K19 on chromosome X Contains a
           mitochondrial ribosomal protein S18C (MRPS18C)
           pseudogene, the 3' end of the gene for a novel protein
           similar to PHD finger protein 2 PHF2 and a CpG island,
           complete sequence.>gb:HS501A4_1998887 Human DNA sequence
           from clone RP3-501A4 on chromosome Xp11.1-11.22 Contains
           part of the gene for a novel protein similar to PHD
           finger protein 2 PHF2, complete sequence.
          Length = 1060

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 55  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 89



>gb:AB029034_1865890 Homo sapiens mRNA for KIAA1111 protein, partial
           cds.
          Length = 1084

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 79  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 113



>gb:AX878605_1477493 Sequence 13510 from Patent
           EP1074617.>gb:AK021696_1908944 Homo sapiens cDNA
           FLJ11634 fis, clone HEMBA1004275, moderately similar to
           Homo sapiens PHD-finger protein (GRC5) mRNA.
          Length = 790

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:CR933612_1185657 Homo sapiens mRNA; cDNA DKFZp686E0868 (from
           clone DKFZp686E0868).
          Length = 382

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:AK040969_1165808 Mus musculus adult male aorta and vein cDNA,
           RIKEN full-length enriched library, clone:A530052I19
           product:hypothetical Serine-rich
           region/PHD-finger/EGF-like domain/jmjC domain containing
           protein, full insert sequence.
          Length = 464

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:AK040943_1165800 Mus musculus adult male aorta and vein cDNA,
           RIKEN full-length enriched library, clone:A530048O04
           product:hypothetical Serine-rich
           region/PHD-finger/EGF-like domain/jmjC domain containing
           protein, full insert sequence.
          Length = 489

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:AK036609_1164550 Mus musculus adult male bone cDNA, RIKEN
           full-length enriched library, clone:9830141C09
           product:hypothetical Serine-rich
           region/PHD-finger/EGF-like domain/jmjC domain containing
           protein, full insert sequence.
          Length = 795

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   KA  +  Y CP+C
Sbjct: 19  FMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNC 53



>gb:BX842636_1644113 Neurospora crassa DNA linkage group I cosmid
           contig 7C14.
          Length = 528

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM-KHYKCPSC 161
           +CG    H     F I CD+CE WFHG C+ +     E++ + Y CP C
Sbjct: 141 ICGGPDNH----RFMIACDRCEDWFHGECIDMDKYTGENLVQRYICPRC 185



>gb:AE014297_1139213 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003695_1221206 Drosophila melanogaster
            chromosome 3R, section 33 of 118 of the complete
            sequence.
          Length = 2016

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 4/45 (8%)
 Frame = -2

Query: 271  DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKR 149
            + F I CD CE WFHG CV VT A    M++    +KCP C  ++
Sbjct: 921  NRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGIDWKCPKCVKRQ 965



>gb:BX537168_2567605 Zebrafish DNA sequence from clone DKEY-105O6 in
           linkage group 4 Contains the 5' end of the gene for a
           novel protein (zgc:64223), the gene for a novel protein
           (zgc:73329), the 5' end of the gene for a novel protein
           similar to vertebrate semaphorin 3C (SEMA3C), the gene
           for a novel protein (sb:cb414) and a CpG island,
           complete sequence.
          Length = 188

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           C +   ++ F I CD C+ WFHG CV+V    A  +  Y CP+C
Sbjct: 10  CRQPYDVNRFMIECDICKDWFHGSCVQVVEHHAADIDVYHCPNC 53



>gb:BX537168_2567604 Zebrafish DNA sequence from clone DKEY-105O6 in
           linkage group 4 Contains the 5' end of the gene for a
           novel protein (zgc:64223), the gene for a novel protein
           (zgc:73329), the 5' end of the gene for a novel protein
           similar to vertebrate semaphorin 3C (SEMA3C), the gene
           for a novel protein (sb:cb414) and a CpG island,
           complete sequence.
          Length = 613

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           C +   ++ F I CD C+ WFHG CV+V    A  +  Y CP+C
Sbjct: 10  CRQPYDVNRFMIECDICKDWFHGSCVQVVEHHAADIDVYHCPNC 53



>gb:BC085577_2564477 Danio rerio cDNA clone IMAGE:7256204, partial
           cds.
          Length = 598

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKR 149
           F I CD+CE WFHG CV +  A+   M+     Y CP+C +++
Sbjct: 333 FMICCDRCEEWFHGDCVGIPEARGRLMERNGEDYVCPNCYTQK 375



>gb:BC072971_2556888 Xenopus laevis MGC82519 protein, mRNA (cDNA
           clone MGC:82519 IMAGE:4963852), complete cds.
          Length = 419

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           C +   +  F I CD C+ WFH  CVKV   +A  +  Y CP+C
Sbjct: 11  CRQPYDVSRFMIECDICKDWFHSSCVKVEEHQAADIDLYHCPNC 54



>gb:BC060927_2553020 Danio rerio cDNA clone IMAGE:4200679, partial
           cds.
          Length = 903

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           +F I CD C+ WFHG CV V   +A  +  Y CP+C
Sbjct: 18  QFMIECDACKDWFHGSCVGVDEDEAPDIDIYHCPNC 53



>gb:MMU238332_2119378 Mus musculus mRNA for death
           inducer-obliterator-1 (Dio-1).
          Length = 614

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 276 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 322



>gb:AK129117_2069348 Mus musculus mRNA for mKIAA0333 protein.
          Length = 1201

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 294 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 340



>gb:HS885L7_1999682 Human DNA sequence from clone RP5-885L7 on
           chromosome 20q13.2-13.33 Contains ESTs, STSs, GSSs and
           eight CpG islands. Contains the 3' end of the NTSR1 gene
           for high affinity neurotensin receptor 1, a putative
           novel gene, a novel gene similar to a fly gene, the gene
           for opioid growth factor receptor (7-60 protein), the
           COL9A3 gene for collagen IX alpha 3, a putative novel
           gene similar to a fly gene, the TCFL5 gene for basic
           helix-loop-helix transcription factor-like 5, an ARF4
           (ADP-ribosylation factor 4) pseudogene, a novel gene and
           the 3' end of the DATF1 gene encoding death associated
           transcription factor 1, complete sequence.
          Length = 379

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 96  NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 142



>gb:HS885L7_1999681 Human DNA sequence from clone RP5-885L7 on
           chromosome 20q13.2-13.33 Contains ESTs, STSs, GSSs and
           eight CpG islands. Contains the 3' end of the NTSR1 gene
           for high affinity neurotensin receptor 1, a putative
           novel gene, a novel gene similar to a fly gene, the gene
           for opioid growth factor receptor (7-60 protein), the
           COL9A3 gene for collagen IX alpha 3, a putative novel
           gene similar to a fly gene, the TCFL5 gene for basic
           helix-loop-helix transcription factor-like 5, an ARF4
           (ADP-ribosylation factor 4) pseudogene, a novel gene and
           the 3' end of the DATF1 gene encoding death associated
           transcription factor 1, complete sequence.
          Length = 1042

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 96  NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 142



>gb:BC004237_1969099 Homo sapiens death associated transcription
           factor 1, transcript variant 1, mRNA (cDNA clone MGC:896
           IMAGE:2959493), complete cds.>gb:BC014489_1974644 Homo
           sapiens death associated transcription factor 1,
           transcript variant 2, mRNA (cDNA clone MGC:23216
           IMAGE:4901057), complete cds.
          Length = 562

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 279 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 325



>gb:BC000770_1967016 Homo sapiens death associated transcription
           factor 1, transcript variant 3, mRNA (cDNA clone
           MGC:3257 IMAGE:3506207), complete cds.
          Length = 544

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 279 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 325



>gb:AB002331_1863638 Homo sapiens KIAA0333 mRNA, partial cds.
          Length = 1223

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 313 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 359



>gb:AX878224_1477351 Sequence 13129 from Patent
           EP1074617.>gb:AK002127_1908841 Homo sapiens cDNA
           FLJ11265 fis, clone PLACE1009158.
          Length = 562

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 279 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 325



>gb:CR857698_1181915 Pongo pygmaeus mRNA; cDNA DKFZp469J1523 (from
           clone DKFZp469J1523).
          Length = 562

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 279 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 325



>sp|Q8C9B9|DAT1_MOUSE Death associated transcription factor 1 (Death
           inducer-obliterator-1) (DIO-1).>gb:AK042474_1166316 Mus
           musculus 3 days neonate thymus cDNA, RIKEN full-length
           enriched library, clone:A630095A07 product:death
           inducer-obliterator-1, full insert sequence.
          Length = 614

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 276 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 322



>sp|Q9BTC0|DAT1_HUMAN Death associated transcription factor 1.
          Length = 1225

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 4/47 (8%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIR 143
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+  +++
Sbjct: 279 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQ 325



>gb:AJ719708_2501895 Gallus gallus mRNA for hypothetical protein,
           clone 5h22.
          Length = 660

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 4/42 (9%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCS 158
           + F I CD+CE WFHG CV ++ A+   ++     Y CP+C+
Sbjct: 372 NRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCT 413



>gb:AF043726_2052189 Mus musculus PHD-finger protein (Grc5) mRNA,
           complete cds.
          Length = 1096

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   +A  +  Y CP+C
Sbjct: 19  FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNC 53



>gb:BC064613_1986589 Homo sapiens PHD finger protein 2, mRNA (cDNA
           clone IMAGE:5579260), complete cds.
          Length = 332

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   +A  +  Y CP+C
Sbjct: 19  FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNC 53



>gb:AF043725_1878592 Homo sapiens PHD-finger protein (GRC5) mRNA,
           complete cds.
          Length = 1099

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   +A  +  Y CP+C
Sbjct: 19  FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNC 53



>gb:HSM805295_1187433 Homo sapiens mRNA; cDNA DKFZp761K187 (from
           clone DKFZp761K187).
          Length = 1100

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   +A  +  Y CP+C
Sbjct: 18  FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNC 52



>gb:AK042834_1166423 Mus musculus 7 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:A730028J10
           product:hypothetical protein, full insert sequence.
          Length = 443

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           C +   ++ F I CD C+ WFHG CV V    A  +  Y CP C++
Sbjct: 42  CRQPYDVNRFMIECDVCKDWFHGSCVGVEEHHAVDIDLYHCPDCAA 87



>gb:AK042327_1166272 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630082K20
           product:hypothetical protein, full insert sequence.
          Length = 473

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 18/46 (39%), Positives = 25/46 (54%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           C +   ++ F I CD C+ WFHG CV V    A  +  Y CP C++
Sbjct: 42  CRQPYDVNRFMIECDVCKDWFHGSCVGVEEHHAVDIDLYHCPDCAA 87



>sp|Q9WTU0|PHF2_MOUSE PHD finger protein 2
           (GRC5).>gb:BC051633_2100795 Mus musculus PHD finger
           protein 2, mRNA (cDNA clone MGC:59330 IMAGE:6518591),
           complete cds.
          Length = 1096

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   +A  +  Y CP+C
Sbjct: 19  FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNC 53



>sp|O75151|PHF2_HUMAN PHD finger protein 2 (GRC5).
          Length = 1101

 Score = 44.3 bits (103), Expect = 0.004
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = -2

Query: 265 FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           F I CD C+ WFHG CV V   +A  +  Y CP+C
Sbjct: 19  FMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNC 53



>gb:BC082851_2562927 Xenopus laevis hypothetical LOC494751, mRNA
           (cDNA clone MGC:81632 IMAGE:6864111), complete cds.
          Length = 2234

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 4/43 (9%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSS 155
           + F I CD+CE WFHG CV +  A+   ++     Y CP+C++
Sbjct: 214 NRFMICCDRCEEWFHGDCVGIPEARGRLLERNGEDYICPNCTA 256



>gb:AK131497_1918030 Homo sapiens cDNA FLJ16696 fis, clone
           TRACH3003832, weakly similar to Mus musculus PHD finger
           protein 2 (Phf2).
          Length = 930

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           C +   ++ F I CD C+ WFHG CV V    A  +  Y CP+C+
Sbjct: 42  CRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCA 86



>gb:AC104321_1737547 Oryza sativa chromosome 3 BAC OSJNBa0052F07
           genomic sequence, complete sequence.
          Length = 218

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           D   I C+ C  WFH  CV++T  +A+ ++H+ C SC
Sbjct: 153 DNLMIQCEDCSDWFHPSCVEITIKEAKKLEHFYCKSC 189



>pir|T41449|T41449 probable phd finger transcription regulator -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPCC594_1721452 S.pombe chromosome III cosmid
           c594.
          Length = 424

 Score = 43.9 bits (102), Expect = 0.005
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 1/41 (2%)
 Frame = -2

Query: 271 DEFW-IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           D  W +GCD CE WFHG CV +  +  +    Y CP C+ +
Sbjct: 128 DGSWMLGCDGCEDWFHGTCVNIPESYNDLTVQYFCPKCTEE 168



>gb:BC071280_2556026 Danio rerio zgc:85741, mRNA (cDNA clone MGC:85741
            IMAGE:6523916), complete cds.
          Length = 1503

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)
 Frame = -2

Query: 307  TLCGA--CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRI 146
            TLC A  C +  G +  W+ CD C RWFH  CV V+ A+    + Y C SCS+  +
Sbjct: 1445 TLCPAESCLQPEGEEVDWVQCDCCNRWFHMICVGVS-AELAAEEDYMCVSCSTSHM 1499



>gb:BC060442_2552909 Xenopus laevis hypothetical protein MGC68807,
           mRNA (cDNA clone MGC:68807 IMAGE:4203823), complete cds.
          Length = 492

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 4/42 (9%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCS 158
           + F I CD+CE WFHG CV +  A+   ++     Y CP+C+
Sbjct: 214 NRFMICCDRCEEWFHGDCVGIPEARGRLLERNGEDYICPNCT 255



>gb:AL159172_1921626 Human DNA sequence from clone RP11-554F11 on
            chromosome 10 Contains part of the TAF3 gene for TAF3 RNA
            polymerase II, TATA box binding protein (TBP)-associated
            factor, 140kDa (TAF140,TAFII140), complete
            sequence.>gb:AL353754_1923068 Human DNA sequence from
            clone RP11-401E9 on chromosome 10 Contains the 3' end of
            the ATP5C1 gene for ATP synthase H+ transporting
            mitochondrial F1 complex gamma polypeptide 1, the 5' end
            of the TAF3 gene for TAF3 RNA polymerase II, TATA box
            binding protein (TBP)-associated factor, 140kDa
            (TAF140,TAFII140), a mitochondrial ribosomal protein L13
            (MRPL13) pseudogene and a CpG island, complete
            sequence.>gb:AL390294_1926585 Human DNA sequence from
            clone RP11-379F12 on chromosome 10 Contains the 3' end of
            the TAF3 gene for TAF3 RNA polymerase II, TATA box
            binding protein (TBP)-associated factor, 140kDa
            (TAF140,TAFII140), the GATA3 gene for GATA binding
            protein 3 (HDR,MGC5445), two novel genes and 3 CpG
            islands, complete sequence.
          Length = 929

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 19/52 (36%), Positives = 28/52 (53%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
            +C  C K        IGCD C+ W+H  CV +  A  E M+ + CP C++K+
Sbjct: 867  ICPGCNKPDDGSPM-IGCDDCDDWYHWPCVGIMTAPPEEMQWF-CPKCANKK 916



>gb:CR382134_1667053 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 514

 Score = 43.5 bits (101), Expect = 0.006
 Identities = 13/35 (37%), Positives = 20/35 (57%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           W+ CD C +WFH  C+K+   +  ++  Y C  CS
Sbjct: 26  WLQCDICNQWFHASCLKIPKIEVNNLHSYHCEGCS 60



>gb:AP003753_1832910 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1339_B08.>gb:AP004384_1841096 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0506C07.
          Length = 218

 Score = 43.1 bits (100), Expect = 0.008
 Identities = 14/40 (35%), Positives = 26/40 (65%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           D+  I C++C  WFH  C+ +T   A+ ++H+ C SC+++
Sbjct: 152 DDLMIQCEECSDWFHPSCIGMTIKDAKKLEHFFCQSCTAE 191



>gb:MMU292189_2120333 Mus musculus partial mRNA for TAFII140 protein,
            RNA polymerase II transcription factor TFIID subunit
            (TAF140 gene).
          Length = 932

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C  C K        IGCD C+ W+H  CV +  A  E M+ + CP C++K
Sbjct: 869  ICPGCNKPDDGSPM-IGCDDCDDWYHWPCVGIMAAPPEEMQWF-CPKCANK 917



>gb:BC089030_2110686 Mus musculus TAF3 RNA polymerase II, TATA box
            binding protein (TBP)-associated factor, mRNA (cDNA clone
            IMAGE:30660628), partial cds.
          Length = 948

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C  C K        IGCD C+ W+H  CV +  A  E M+ + CP C++K
Sbjct: 885  ICPGCNKPDDGSPM-IGCDDCDDWYHWPCVGIMAAPPEEMQWF-CPKCANK 933



>gb:NC3H10_1688525 Neurospora crassa DNA linkage group V Cosmid contig
            3H10.
          Length = 1736

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = -2

Query: 259  IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            I C++C  W+HG+C+K+   K +    Y CP C
Sbjct: 1349 IECEQCHEWYHGKCLKIARGKVKEDDKYTCPIC 1381



 Score = 35.4 bits (80), Expect = 1.7
 Identities = 14/47 (29%), Positives = 21/47 (44%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           C  CGK        + C+ C+  +HG C+   P K +    + CP C
Sbjct: 454 CEQCGKGSEEGSCMLVCESCDNHYHGSCLD-PPLKTKPENEWNCPRC 499



>gb:AK084574_1174269 Mus musculus 13 days embryo heart cDNA, RIKEN
           full-length enriched library, clone:D330016H05
           product:TAFII140 PROTEIN (FRAGMENT) homolog [Mus
           musculus], full insert sequence.
          Length = 191

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 19/51 (37%), Positives = 27/51 (52%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           +C  C K        IGCD C+ W+H  CV +  A  E M+ + CP C++K
Sbjct: 128 ICPGCNKPDDGSPM-IGCDDCDDWYHWPCVGIMAAPPEEMQWF-CPKCANK 176



>gb:AF528164_1188187 Mus musculus strain 129/Sv chromosome 17 clone
           9k21, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces.
          Length = 908

 Score = 42.4 bits (98), Expect = 0.014
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           C +   ++ F I C  C+ WFHG CV +    A  +  Y CP C +
Sbjct: 10  CRQPYNVNHFMIECGLCQDWFHGSCVGIEEENAVDIDIYHCPDCEA 55



>gb:AE017347_1757796 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 1242

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = -2

Query: 259 IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           I CD C  WFH +C+ +    AE +  Y CPSC+
Sbjct: 65  IECDVCSDWFHFKCINLAEDDAEKIHKYVCPSCT 98



>gb:AY142507_1582936 Arabidopsis thaliana putative receptor protein
           (At4g22140) mRNA, complete cds.
          Length = 196

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           D+  + C+ C+ W+H  CV +T  +A+ + H+ C  CSS
Sbjct: 120 DDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSS 158



>gb:AC010657_1536977 Genomic sequence for Arabidopsis thaliana BAC
           T5E21 from chromosome I, complete sequence.
          Length = 165

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 19/33 (57%), Positives = 25/33 (75%)
 Frame = -2

Query: 529 RKVLFNMINELPTVFEIVTGAAKKHNEKSVITN 431
           RK LF MIN+LPT+FE+VTG AK+  ++S   N
Sbjct: 120 RKRLFQMINDLPTIFEVVTGNAKQSKDQSANHN 152



>pir|C85253|C85253 receptor like protein (partial) [imported] -
           Arabidopsis thaliana>gb:ATCHRIV56_1546051 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           56.>gb:ATF1N20_1549415 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F1N20 (ESSA project).
          Length = 201

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           D+  + C+ C+ W+H  CV +T  +A+ + H+ C  CSS
Sbjct: 125 DDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSS 163



>pir|T49121|T49121 receptor like protein - Arabidopsis thaliana
           (fragment)
          Length = 201

 Score = 42.0 bits (97), Expect = 0.019
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           D+  + C+ C+ W+H  CV +T  +A+ + H+ C  CSS
Sbjct: 125 DDLMVQCEGCKDWYHPACVGMTIEEAKKLDHFVCAECSS 163



>gb:AP005301_1850178 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OSJNBa0077M12.
          Length = 216

 Score = 41.6 bits (96), Expect = 0.024
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           D+  + CD C+ WFH  C+ +T  +A+ + H+ C  C
Sbjct: 150 DDLMVQCDDCKDWFHPSCMSMTIEQAKKLDHFVCSDC 186



>gb:AY231397_1591585 Arabidopsis thaliana hypothetical protein
           (At2g04680/F28I8.28) mRNA, complete cds.
          Length = 657

 Score = 41.6 bits (96), Expect = 0.024
 Identities = 20/62 (32%), Positives = 28/62 (45%)
 Frame = -2

Query: 364 NVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM 185
           N++ H            G+  C ACG  G     W GC +C+  FHG C +  P +A+H 
Sbjct: 121 NLHEHLLEFFVGWHSWKGHRECKACGGAGFRGYRWYGCYQCDTLFHGECAEFFP-EAKHT 179

Query: 184 KH 179
            H
Sbjct: 180 SH 181



>pir|B84460|B84460 hypothetical protein At2g04680 [imported] -
           Arabidopsis thaliana>gb:AC006955_1534938 Arabidopsis
           thaliana chromosome 2 clone F28I8 map RNS1, complete
           sequence.>gb:AY773838_1628214 Arabidopsis thaliana clone
           pENTR221-At2g04680 hypothetical protein (At2g04680)
           mRNA, complete cds.
          Length = 657

 Score = 41.6 bits (96), Expect = 0.024
 Identities = 20/62 (32%), Positives = 28/62 (45%)
 Frame = -2

Query: 364 NVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM 185
           N++ H            G+  C ACG  G     W GC +C+  FHG C +  P +A+H 
Sbjct: 121 NLHEHLLEFFVGWHSWKGHRECKACGGAGFRGYRWYGCYQCDTLFHGECAEFFP-EAKHT 179

Query: 184 KH 179
            H
Sbjct: 180 SH 181



>gb:AP002745_1822737 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0489G09.
          Length = 405

 Score = 41.2 bits (95), Expect = 0.032
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%)
 Frame = -2

Query: 301 CGACGK--HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH--YKCPSCSSKR 149
           CG C K  H      W+ CD+C+ W H  C + T  K E +++  Y CP C SKR
Sbjct: 347 CGICKKIWHHTDGGNWVCCDECQIWVHVECDQ-TCIKMEDLENADYFCPDCKSKR 400



>gb:CR382129_1661976 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1524

 Score = 40.8 bits (94), Expect = 0.041
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = -2

Query: 259  IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
            +GCDKC  W+H +C+K    K    + + C  C S
Sbjct: 1348 VGCDKCAEWYHSKCLKNAGVKTRSQEEFICHICDS 1382



>gb:AP002031_1821474 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K3D20.
          Length = 1515

 Score = 40.4 bits (93), Expect = 0.054
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
            +CG C         +I C KCE+WFH   VK+  ++   +  +KC  C  +RIR
Sbjct: 1213 VCGICLLPYNPGLTYIHCTKCEKWFHTEAVKLKDSQIPEVVGFKC--CKCRRIR 1264



>gb:AP002745_1822736 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0489G09.
          Length = 991

 Score = 40.0 bits (92), Expect = 0.070
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 4/55 (7%)
 Frame = -2

Query: 301 CGACGK--HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH--YKCPSCSSKR 149
           CG C K  H      W+ CD+C+ W H  C  +T    E +++  Y CP C SKR
Sbjct: 379 CGICKKIWHHTDGGNWVCCDECQIWVHVEC-DLTCINMEDLENADYFCPDCKSKR 432



>gb:AF512557S2_1807296 Arabidopsis thaliana HAC5 mRNA, partial cds.
          Length = 1012

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = -2

Query: 274 LDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           ++E W+ CDKC+ W H  C      +      Y CP+C
Sbjct: 478 VEESWVQCDKCQAWQHQICALFNGRRNHGQAEYTCPNC 515



>gb:CR380959_1653761 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 360

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           E  +GCD C+ WFH  C+K+       ++ + CP C
Sbjct: 36  ELMVGCDGCDDWFHFECMKIPETYRNLVESFICPYC 71



>gb:AY064131_1566013 Arabidopsis thaliana AT5g09790/F17I14_20 mRNA,
           complete cds.>gb:AY120701_1579583 Arabidopsis thaliana
           AT5g09790/F17I14_20 mRNA, complete cds.
          Length = 352

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = -2

Query: 316 HGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           + N  C  CG   G DE  + CDKC+R FH +C++    +   +  + C  CS +R
Sbjct: 62  YSNVTCEKCGSGEGDDELLL-CDKCDRGFHMKCLRPIVVRVP-IGTWLCVDCSDQR 115



>gb:AB026645_1517170 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MGH6.
          Length = 1670

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = -2

Query: 274  LDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            ++E W+ CDKC+ W H  C      +      Y CP+C
Sbjct: 1006 VEESWVQCDKCQAWQHQICALFNGRRNHGQAEYTCPNC 1043



>gb:AB020752_1514691 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MTH16.
          Length = 378

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = -2

Query: 316 HGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           + N  C  CG   G DE  + CDKC+R FH +C++    +   +  + C  CS +R
Sbjct: 62  YSNVTCEKCGSGEGDDELLL-CDKCDRGFHMKCLRPIVVRVP-IGTWLCVDCSDQR 115



>gb:DME292191_1379182 Drosophila melanogaster partial mRNA for
            TAFII155 protein, RNA polymerase II transcription factor
            TFIID subunit (BIP2 gene).>gb:DMY14999_1381200 Drosophila
            melanogaster mRNA for BIP2 protein.
          Length = 1408

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
 Frame = -2

Query: 388  AESHGRAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDE--FWIGCDKCERWFHGRCV 215
            +E +  AM +              +   +C ACGK   +DE    IGCD C+ W+H  CV
Sbjct: 1316 SEENANAMQIAESSRPSSYVDTEGNRIWICPACGK---VDEGSAMIGCDGCDAWYHWICV 1372

Query: 214  KVTPAKAEHMKHYKCPSCSSKR 149
             +T A  ++   + C  C +K+
Sbjct: 1373 GITFAPKDN-DDWFCRVCVTKK 1393



>gb:DME251945_1379065 Drosophila melanogaster bip2 gene for BIP2
            protein, exons 1-7.
          Length = 1406

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 2/82 (2%)
 Frame = -2

Query: 388  AESHGRAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDE--FWIGCDKCERWFHGRCV 215
            +E +  AM +              +   +C ACGK   +DE    IGCD C+ W+H  CV
Sbjct: 1314 SEENANAMQIAESSRPSSYVDAEGNRIWICPACGK---VDEGSAMIGCDGCDAWYHWICV 1370

Query: 214  KVTPAKAEHMKHYKCPSCSSKR 149
             +T A  ++   + C  C +K+
Sbjct: 1371 GITFAPKDN-DDWFCRVCVTKK 1391



>gb:AE014185_937656 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014830_1228390 Plasmodium falciparum 3D7
            chromosome 10 section 2 of 7 of the complete sequence.
          Length = 3853

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = -2

Query: 262  WIGCDKCERWFHGRCVKVTPAKAEHMKH-YKCPSC 161
            WIGCDKCE+W+H  C K +      +++ + C SC
Sbjct: 3816 WIGCDKCEKWYHWICCKYSVDNPPDIENDWYCNSC 3850



>pir|T49919|T49919 hypothetical protein F17I14.20 - Arabidopsis
           thaliana>gb:ATF17I14_1548907 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F17I14 (ESSA project).
          Length = 379

 Score = 39.7 bits (91), Expect = 0.092
 Identities = 19/56 (33%), Positives = 29/56 (51%)
 Frame = -2

Query: 316 HGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           + N  C  CG   G DE  + CDKC+R FH +C++    +   +  + C  CS +R
Sbjct: 62  YSNVTCEKCGSGEGDDELLL-CDKCDRGFHMKCLRPIVVRVP-IGTWLCVDCSDQR 115



>gb:BC090215_2566432 Xenopus laevis cDNA clone MGC:85078
           IMAGE:6867173, complete cds.
          Length = 845

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           +C  C K        IGCD+C+ W+H  CV +  A  E  + + C  C SK+
Sbjct: 783 ICPGCNKPDDGSPM-IGCDQCDDWYHWPCVGINAAPPED-EQWFCTKCESKK 832



>sp|P29375|RBB2_HUMAN Retinoblastoma-binding protein 2
            (RBBP-2).>pir|I78879|I78879 retinoblastoma binding
            protein 2 - human>gb:S66431_2040830 RBP2=retinoblastoma
            binding protein 2 [human, Nalm-6 pre-B cell leukemia,
            mRNA, 6455 nt].
          Length = 1722

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = -2

Query: 262  WIGCDK-CERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
            W+ CD  C+ WFH  CV V+P  AE+ + Y C +C+ K+
Sbjct: 1657 WVQCDGGCDEWFHRVCVGVSPEMAEN-EDYICINCAKKQ 1694



>gb:BC048180_2099574 Mus musculus jumonji, AT rich interactive domain
            1B (Rbp2 like), mRNA (cDNA clone MGC:61207
            IMAGE:6826125), complete cds.>gb:BC057318_2102699 Mus
            musculus jumonji, AT rich interactive domain 1B (Rbp2
            like), mRNA (cDNA clone MGC:66676 IMAGE:6826125),
            complete cds.
          Length = 1544

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 1491 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTGK 1538



>gb:BC019446_2092924 Mus musculus jumonji, AT rich interactive
           domain 1B (Rbp2 like), mRNA (cDNA clone IMAGE:4023951),
           partial cds.
          Length = 437

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295 ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 384 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTGK 431



>gb:AY082429_2075966 Mus musculus PLU1 (Plu1) mRNA, complete
            cds.>gb:AY082430_2075967 Mus musculus PLU1 short form
            (Plu1) mRNA, complete cds.
          Length = 1544

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 1491 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTGK 1538



>gb:AE017347_1757812 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 571

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           D   +GC+ C+ WFH  CV +     E +  Y C SC
Sbjct: 292 DGLMVGCESCDGWFHASCVGLDEEMVELLDVYICKSC 328



>gb:AE017347_1757811 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 587

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           D   +GC+ C+ WFH  CV +     E +  Y C SC
Sbjct: 292 DGLMVGCESCDGWFHASCVGLDEEMVELLDVYICKSC 328



>pir|T24864|T24864 hypothetical protein T12D8.1 - Caenorhabditis
           elegans>gb:CET12D8_1367658 Caenorhabditis elegans cosmid
           T12D8, complete sequence.>gb:CEZK525_1371651
           Caenorhabditis elegans cosmid ZK525, complete sequence.
          Length = 2561

 Score = 38.9 bits (89), Expect = 0.16
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKV-TPAKAEH--MKHYKCPSCSSKRIRP*G 134
           C  C ++  L+E  I C +C +W HG C  + T  + E   +   +C +C  KR++P G
Sbjct: 641 CPRCERNYQLNEKLIRCSQCSKWQHGACEGLYTDEQLEQAAIDRMRCSACRPKRVQPSG 699



>gb:AP003074_1824582 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0004G10.
          Length = 936

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           E+W+ CDKC+ W H  C    P   +    Y C  C  K
Sbjct: 435 EWWVQCDKCKAWQHQICALFNPKIVDPEAEYTCAKCFLK 473



>gb:CR382139_1672747 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 474

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = -2

Query: 283 HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRI 146
           +GG  E  I CD C+ WFH +C+K+    ++ +  + C  C  K I
Sbjct: 134 YGG--ELMISCDNCDEWFHFKCMKLNEDHSKLIAKFYCKFCRWKGI 177



>gb:CR382131_1664711 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 510

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%)
 Frame = -2

Query: 301 CGACGKHGGLD-EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           C  C      D + W  CD C+RW H  CV +T   +     Y CP+C+  +
Sbjct: 5   CDFCTSSSTKDKQQWTQCDGCDRWVHDVCVSITDPVS--YAKYHCPTCTKTK 54



>gb:BT005934_1638856 Arabidopsis thaliana At2g19260 gene, complete
           cds.>gb:AK118428_1816406 Arabidopsis thaliana At2g19260
           mRNA for unknown protein, complete cds, clone:
           RAFL19-67-M06.
          Length = 631

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           C  C K G +++  I CD+CE  +H RC  V       +  + CPSC
Sbjct: 412 CKHCDKPGTVEKMLI-CDECEEAYHTRCCGVQMKDVAEIDEWLCPSC 457



>gb:AY088603_1573619 Arabidopsis thaliana clone 8278 mRNA, complete
           sequence.
          Length = 228

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           D+  + C++C  WFH  C+  T  +A+   ++ C  CS ++
Sbjct: 151 DDLMVQCEECSEWFHPSCIGTTIEEAKKPDNFYCEECSPQQ 191



>gb:AY050934_1562421 Arabidopsis thaliana putative ES43 protein
           (At4g39100) mRNA, complete cds.>gb:AY079396_1568285
           Arabidopsis thaliana putative ES43 protein (At4g39100)
           mRNA, complete cds.>gb:AF277453_1782769 Arabidopsis
           thaliana putative PHD finger transcription factor (SHL1)
           mRNA, complete cds.
          Length = 228

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           D+  + C++C  WFH  C+  T  +A+   ++ C  CS ++
Sbjct: 151 DDLMVQCEECSEWFHPSCIGTTIEEAKKPDNFYCEECSPQQ 191



>gb:AC007789_1536193 Oryza sativa BAC OSJNBa0049B20 genomic
           sequence, complete sequence.
          Length = 994

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 14/39 (35%), Positives = 18/39 (46%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           E+W+ CDKC+ W H  C    P   +    Y C  C  K
Sbjct: 493 EWWVQCDKCKAWQHQICALFNPKIVDPEAEYTCAKCFLK 531



>gb:AY069276_1294006 Drosophila melanogaster GM10839 full length
           cDNA.
          Length = 363

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 22/80 (27%), Positives = 35/80 (43%)
 Frame = -2

Query: 388 AESHGRAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKV 209
           +E +  AM +              +   +C ACGK        IGCD C+ W+H  CV +
Sbjct: 271 SEENANAMQIAESSRPSSYVDAEGNRIWICPACGKVDD-GSAMIGCDGCDAWYHWICVGI 329

Query: 208 TPAKAEHMKHYKCPSCSSKR 149
           T A  ++   + C  C +K+
Sbjct: 330 TFAPKDN-DDWFCRVCVTKK 348



>gb:AK045780_1167537 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230310N24 product:hypothetical Domain in central
           region of transcription elongation factor S-II (and
           elsewhere)/PHD-finger containing protein, full insert
           sequence.
          Length = 371

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 4/40 (10%)
 Frame = -2

Query: 259 IGCDKCERWFHGRCVKVTPAKAEHM----KHYKCPSCSSK 152
           +GC  C+ WFHG CV ++ ++A+ M    K Y C  C ++
Sbjct: 2   VGCGTCDDWFHGDCVGLSLSQAQQMGEEDKEYVCVRCCAE 41



>gb:AE014135_1137651 Drosophila melanogaster chromosome 4, complete
            sequence.>gb:AE003844_1227457 Drosophila melanogaster
            chromosome 4, section 2 of 5 of the complete sequence.
          Length = 1406

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 22/80 (27%), Positives = 35/80 (43%)
 Frame = -2

Query: 388  AESHGRAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKV 209
            +E +  AM +              +   +C ACGK        IGCD C+ W+H  CV +
Sbjct: 1314 SEENANAMQIAESSRPSSYVDAEGNRIWICPACGKVDD-GSAMIGCDGCDAWYHWICVGI 1372

Query: 208  TPAKAEHMKHYKCPSCSSKR 149
            T A  ++   + C  C +K+
Sbjct: 1373 TFAPKDN-DDWFCRVCVTKK 1391



>pir|H85462|H85462 ES43 like protein [imported] - Arabidopsis
           thaliana>gb:ATCHRIV90_1547894 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           90.>gb:ATF19H22_1549332 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19H22 (ESSA project).
          Length = 258

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           D+  + C++C  WFH  C+  T  +A+   ++ C  CS ++
Sbjct: 151 DDLMVQCEECSEWFHPSCIGTTIEEAKKPDNFYCEECSPQQ 191



>pir|T06070|T06070 ES43 protein homolog F19H22.200 - Arabidopsis
           thaliana  (fragment)
          Length = 258

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 12/41 (29%), Positives = 23/41 (56%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           D+  + C++C  WFH  C+  T  +A+   ++ C  CS ++
Sbjct: 151 DDLMVQCEECSEWFHPSCIGTTIEEAKKPDNFYCEECSPQQ 191



>pir|T01274|T01274 hypothetical protein At2g19260 [imported] -
           Arabidopsis thaliana>gb:AC003058_1531048 Arabidopsis
           thaliana chromosome 2 clone F27F23 map CIC06E08,
           complete sequence.
          Length = 653

 Score = 38.5 bits (88), Expect = 0.20
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           C  C K G +++  I CD+CE  +H RC  V       +  + CPSC
Sbjct: 412 CKHCDKPGTVEKMLI-CDECEEAYHTRCCGVQMKDVAEIDEWLCPSC 457



>gb:HSM802382_2017479 Homo sapiens mRNA; cDNA DKFZp434I2412 (from
           clone DKFZp434I2412); partial cds.
          Length = 626

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295 ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 573 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 620



>gb:HSM801343_2017298 Homo sapiens mRNA; cDNA DKFZp434I0617 (from
            clone DKFZp434I0617); partial cds.
          Length = 916

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 863  SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 910



>gb:HSM801319_2017286 Homo sapiens mRNA; cDNA DKFZp434D0815 (from
            clone DKFZp434D0815); partial cds.
          Length = 1028

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 975  SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 1022



>gb:HSM801308_2017283 Homo sapiens mRNA; cDNA DKFZp434N0335 (from
            clone DKFZp434N0335); partial cds.
          Length = 1350

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 1297 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 1344



>gb:HSA243706_2001055 Homo sapiens mRNA for RB-binding protein
            (rbbp2h1a gene).
          Length = 1681

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 1628 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 1675



>gb:HSA132440_2000289 Homo sapiens mRNA for PLU-1 protein.
          Length = 1544

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 1491 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 1538



>gb:AF087481_1881845 Homo sapiens retinoblastoma binding protein 2
            homolog 1 (RBBP2H1) mRNA, complete cds.
          Length = 1580

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 1527 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 1574



>gb:AP005452_1852036 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0453E03.
          Length = 1696

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRI 146
            +C  C K    +  +I C+ C  WFHG    +T     ++  +KC  C  K +
Sbjct: 1340 VCRLCQKCYSGESIYIACEDCGDWFHGDIYSITLENVNNLIGFKCHRCRLKDV 1392



>gb:AX879260_1477740 Sequence 14165 from Patent EP1074617.
          Length = 403

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295 ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 350 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 397



>pir|S44281|S44281 ES43 protein - barley>gb:HVES43_1682352 H.vulgare
           (Dbg576) ES43 mRNA.
          Length = 227

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 12/37 (32%), Positives = 22/37 (59%)
 Frame = -2

Query: 271 DEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           D+  I C++C  WFH  C+  T  +A+ ++++ C  C
Sbjct: 157 DDLMIQCEECSDWFHPACIGKTIKEAKKLENFTCEGC 193



>pir|T42697|T42697 hypothetical protein DKFZp434N0335.1 - human
            (fragment)
          Length = 1350

 Score = 38.1 bits (87), Expect = 0.27
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            +C +  G +  W+ CD  C +WFH  CV V+P  AE  + Y C  C+ K
Sbjct: 1297 SCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAE-KEDYICVRCTVK 1344



>gb:AP005474_1852539 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OSJNBa0081C13.>gb:AP005647_1855403 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0026E05.
          Length = 1623

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = -2

Query: 271  DEFWIGCDKCERWFHGRCVKVTPAKAE-HMKHYKCPSCSSKRIR 143
            +E+W+ CDKCE W H  C      + +     Y CP+C  + ++
Sbjct: 994  EEWWVQCDKCECWQHQICALFNGRRNDGGQAEYTCPNCYVEEVK 1037



>pir|T38660|T38660 probable transcription regulator protein - fission
            yeast  (Schizosaccharomyces pombe)>gb:SPAC343_1717759
            S.pombe chromosome I cosmid c343.
          Length = 1588

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = -2

Query: 292  CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            C +   + +  + C  C  WFH  CV ++      + +Y CP C SK
Sbjct: 1459 CRQPFAISDGTVQCHNCLEWFHYECVGLSSDIVSTLSNYACPDCCSK 1505



 Score = 35.8 bits (81), Expect = 1.3
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -2

Query: 259  IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            I C+ C  W+H +C+K++  K    + + CP C
Sbjct: 1185 IECELCHEWYHAKCMKMSKKKLRADEKFICPIC 1217



>pir|T52301|T52301 GYMNOS/PICKLE protein [imported] - Arabidopsis
           thaliana>gb:AF185577_1775125 Arabidopsis thaliana
           chromatin remodeling factor CHD3 (PKL) mRNA, complete
           cds.>gb:AF185578_1775126 Arabidopsis thaliana
           GYMNOS/PICKLE mRNA, complete cds.
          Length = 1384

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           C ACG+   L    + C+ C   FH +C+ V P K   +++++CP C S
Sbjct: 52  CQACGESTNL----VSCNTCTYAFHAKCL-VPPLKDASVENWRCPECVS 95



>pir|B84645|B84645 hypothetical protein At2g25170 [imported] -
           Arabidopsis thaliana
          Length = 1359

 Score = 37.7 bits (86), Expect = 0.35
 Identities = 17/49 (34%), Positives = 27/49 (55%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           C ACG+   L    + C+ C   FH +C+ V P K   +++++CP C S
Sbjct: 52  CQACGESTNL----VSCNTCTYAFHAKCL-VPPLKDASVENWRCPECVS 95



>gb:CR382124_1656648 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 342

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           E  +GCD C+ WFH  C+K+     + +  + C  CS+
Sbjct: 34  ELMVGCDGCDDWFHFSCLKIPEKYRDLVFSFYCSYCSA 71



>gb:CEZK593_1371664 Caenorhabditis elegans cosmid ZK593, complete
            sequence.
          Length = 1477

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCDK-CERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            AC K  G    W+ C+  C+ WFH  C+  T  +   M  Y+C SC
Sbjct: 1418 ACLKPYGDSVNWVMCEAGCKNWFHVICLGFTLREINDMHEYRCSSC 1463



>pir|T27924|T27924 hypothetical protein ZK593.4 - Caenorhabditis
            elegans
          Length = 1430

 Score = 37.4 bits (85), Expect = 0.46
 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = -2

Query: 295  ACGKHGGLDEFWIGCDK-CERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            AC K  G    W+ C+  C+ WFH  C+  T  +   M  Y+C SC
Sbjct: 1371 ACLKPYGDSVNWVMCEAGCKNWFHVICLGFTLREINDMHEYRCSSC 1416



>gb:SPBP4H10_1720628 S.pombe chromosome II P1 clone p4H10.
          Length = 467

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -2

Query: 259 IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           I C+ C  W+H +C+K++  K    + + CP C
Sbjct: 64  IECEICHEWYHAKCLKMSKKKLRQDEKFTCPIC 96



 Score = 35.0 bits (79), Expect = 2.3
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = -2

Query: 310 NTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           N+ C  CG+     + +I C  CER FH  CV +    A+ +  + CP C
Sbjct: 306 NSSC-LCGEEFSPRDSFIDCTICERRFHYDCVGLNNEIADSVSKFTCPIC 354



>gb:SPBP19A11_1720579 S.pombe chromosome II cosmid p19A11.
          Length = 1513

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -2

Query: 259  IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            I C+ C  W+H +C+K++  K    + + CP C
Sbjct: 1110 IECEICHEWYHAKCLKMSKKKLRQDEKFTCPIC 1142



 Score = 35.0 bits (79), Expect = 2.3
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = -2

Query: 310  NTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            N+ C  CG+     + +I C  CER FH  CV +    A+ +  + CP C
Sbjct: 1352 NSSC-LCGEEFSPRDSFIDCTICERRFHYDCVGLNNEIADSVSKFTCPIC 1400



>gb:CR382136_1668690 Debaryomyces hansenii chromosome D of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1752

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 13/35 (37%), Positives = 22/35 (62%), Gaps = 2/35 (5%)
 Frame = -2

Query: 259  IGCDKCERWFHGRCVKVTPAKAEHMK--HYKCPSC 161
            I CDKC+ W+H +CV  +  ++++    +Y CP C
Sbjct: 1478 IECDKCKEWYHTQCVNESALESDNNNDDNYSCPIC 1512



>gb:BT005981_1638903 Arabidopsis thaliana At5g53430 gene, complete
           cds.>gb:AK117221_1815266 Arabidopsis thaliana At5g53430
           mRNA for putative trithorax 5 (TX5), complete cds,
           clone: RAFL16-77-F07.
          Length = 1043

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 4/55 (7%)
 Frame = -2

Query: 304 LCGACGK-HGGLD-EFWIGCDKCERWFHGRCVKVTPAKAEHM--KHYKCPSCSSK 152
           +CG C +    LD + W+ CD C+ W H  C +++    + +    Y CP+C +K
Sbjct: 415 VCGICKRIWNHLDSQSWVRCDGCKVWIHSACDQISHKHFKDLGETDYYCPTCRTK 469



>gb:U70849_1405986 Caenorhabditis elegans cosmid F29B9, complete
           sequence.
          Length = 897

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = -2

Query: 283 HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           H   D  WIGCD C+ W+H  C  +   +    + + CP C
Sbjct: 234 HKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKC 274



>gb:CR382401_1375118 Plasmodium falciparum chromosome 6, complete
            sequence; segment 4/5.
          Length = 6761

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 5/63 (7%)
 Frame = -2

Query: 262  WIGCDKCERWFHGRCVKVTPAKAEHMKH----YKCPSCSSKRIRP*GRNMLCYLTLAEK- 98
            W+ CD C+ W H  C K      E + +    YKCP+CS          +L  L L +K 
Sbjct: 1779 WVQCDVCKFWIHLSCDKNESRNIETLSNKNIDYKCPTCSIGTFHDKIERILYLLFLLDKY 1838

Query: 97   QNF 89
            +NF
Sbjct: 1839 KNF 1841



>pir|T29935|T29935 hypothetical protein F29B9.2 - Caenorhabditis
           elegans>gb:U70849_1405985 Caenorhabditis elegans cosmid
           F29B9, complete sequence.
          Length = 910

 Score = 37.0 bits (84), Expect = 0.60
 Identities = 14/41 (34%), Positives = 20/41 (48%)
 Frame = -2

Query: 283 HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           H   D  WIGCD C+ W+H  C  +   +    + + CP C
Sbjct: 247 HKKNDFQWIGCDSCQTWYHFLCSGLEQFEYYLYEKFFCPKC 287



>gb:AF323954_1786316 Arabidopsis thaliana p300/CBP
            acetyltransferase-related protein 2 mRNA, complete cds.
          Length = 1654

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = -2

Query: 271  DEFWIGCDKCERWFHGRCVKVTPAKAE-HMKHYKCPSC 161
            +E+W+ CDKCE W H  C      + +     Y CP C
Sbjct: 1020 EEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPYC 1057



>gb:AY692957_1623004 Saccharomyces cerevisiae clone FLH006802.01X
           YPL181W gene, complete cds.
          Length = 506

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = -2

Query: 313 GNTLCGACGKHGGLDE--FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           G T C  CG+    D+  F+I C++C  W HG CV +T   A     Y C  C
Sbjct: 71  GETRC-ICGELDTPDDSGFFIQCEQCSSWQHGYCVSITQDNAP--DKYWCEQC 120



>pir|S65193|S65193 hypothetical protein YPL181w - yeast
           (Saccharomyces cerevisiae)>gb:SCYPL182C_1714696
           S.cerevisiae chromosome XVI reading frame ORF YPL182c.
          Length = 506

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%)
 Frame = -2

Query: 313 GNTLCGACGKHGGLDE--FWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           G T C  CG+    D+  F+I C++C  W HG CV +T   A     Y C  C
Sbjct: 71  GETRC-ICGELDTPDDSGFFIQCEQCSSWQHGYCVSITQDNAP--DKYWCEQC 120



>pir|T01055|T01055 hypothetical protein YUP8H12R.38 - Arabidopsis
            thaliana>gb:AE005173_895421 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:YUP8H12R_1731331 Arabidopsis thaliana
            chromosome 1 YAC YUP8H12R sequence, complete sequence.
          Length = 1516

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)
 Frame = -2

Query: 271  DEFWIGCDKCERWFHGRCVKVTPAKAE-HMKHYKCPSC 161
            +E+W+ CDKCE W H  C      + +     Y CP C
Sbjct: 906  EEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPYC 943



>sp|Q9TSV4|TF19_PIG Transcription factor 19 (Transcription factor
           SC1).>gb:SSC251914_1445105 Sus scrofa MHC class I SLA
           genes, haplotype H01, clone BAC 493A6.
          Length = 346

 Score = 36.6 bits (83), Expect = 0.78
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 308 WVQCDGCDTWFHVACVGCS-IQAAKEADFRCPGC 340



>gb:BT008209_2151141 Synthetic construct Homo sapiens transcription
           factor 19 (SC1) mRNA, partial cds.
          Length = 346

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGC 339



>gb:BC002493_1968159 Homo sapiens transcription factor 19 (SC1),
           mRNA (cDNA clone MGC:2575 IMAGE:3051226), complete
           cds.>gb:BC033086_1980789 Homo sapiens transcription
           factor 19 (SC1), mRNA (cDNA clone MGC:45652
           IMAGE:3160434), complete cds.>gb:BT007247_1990685 Homo
           sapiens transcription factor 19 (SC1) mRNA, complete
           cds.
          Length = 345

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGC 339



>gb:AL662833_1931667 Human DNA sequence from clone XXbac-101P6 on
           chromosome 6 contains the gene for HCR, the TCF19 gene
           for transcription factor 19, the POU5F1 gene for POU
           domain, class 5, transcription factor 1, a putative
           novel transcript, the HLA-C gene for major
           histocompatibility complex, class I, C, a ubiquitin
           specific protease 8 (USP8) pseudogene, a ribosomal
           protein L3 (RPL3) pseudogene, a WAS protein family,
           member 3 (WASF3) pseudogene and three CpG islands,
           complete sequence.
          Length = 345

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGC 339



>gb:AB128049_1873955 Macaca mulatta genes, MHC class I region,
           partial and complete cds.
          Length = 345

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGC 339



>gb:AB029517_1865920 Homo sapiens SCI(TCF19)-4 gene, complete
           cds.>gb:AB029518_1865921 Homo sapiens SC1(TCF19)-6 gene,
           complete cds.>gb:AL662844_1931715 Human DNA sequence
           from clone XXbac-299F13 on chromosome 6 contains the
           gene for STG protein, the CDSN gene for corneodesmosin,
           the gene for SEEK1 protein, the gene for SPR1 protein,
           the gene for HCR, the TCF19 gene for transcription
           factor 19, the POU5F1 gene for POU domain, class 5,
           transcription factor 1, a putative novel transcript and
           four CpG islands, complete sequence.
          Length = 345

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGC 339



>gb:CR382132_1665938 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 822

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 16/51 (31%), Positives = 22/51 (43%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKR 149
           CGA        +  I C+ C  W H +CV  T    +   HY C  C+ K+
Sbjct: 83  CGATEDDPSDGKIMIECEDCLEWQHSQCVLQTNDLEQVPDHYVCNECTEKK 133



>gb:AF411835_1268884 Aedes albopictus cell fusing agent virus
           polyprotein-like protein and agCP8252-like protein
           genes, complete cds.
          Length = 225

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 2/49 (4%)
 Frame = -2

Query: 310 NTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKV--TPAKAEHMKHYKC 170
           N  C  C      D + + C +C+RWFH  C K+   P   E     KC
Sbjct: 9   NGHCRLCSDPDDKDSYMVECSECDRWFHPSCAKLIKKPTPEEIFLCVKC 57



>pir|S69047|S69047 hypothetical protein YPL138c - yeast
           (Saccharomyces cerevisiae)>gb:SCU43703_1710376
           Saccharomyces cerevisiae chromosome XVI cosmid 9545.
          Length = 353

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           E  +GCD C+ WFH  C+ +     + +  + CP C +
Sbjct: 34  ELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYCQA 71



>sp|Q7YR48|TF19_PANTR Transcription factor 19 (Transcription factor
           SC1).>gb:BA000041_1966263 Pan troglodytes DNA, major
           histocompatibility complex class I region.
          Length = 345

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGC 339



>sp|Q9Y242|TF19_HUMAN Transcription factor 19 (Transcription factor
           SC1).>gb:AB029516_1865919 Homo sapiens SC1-1 gene,
           complete cds.>gb:AB029519_1865922 Homo sapiens
           SC1(TCF19)-7 gene, complete cds.>gb:AB088113_1872124
           Homo sapiens SC1, OTF3 genes for transcription factor
           19, POU domain class 5 transcription factor 1, complete
           cds.>gb:AL773544_1932887 Human DNA sequence from clone
           DAQB-185I1 on chromosome 6, complete
           sequence.>gb:BA000025_1966176 Homo sapiens genomic DNA,
           chromosome 6p21.3, HLA Class I
           region.>gb:BC044632_1983505 Homo sapiens transcription
           factor 19 (SC1), mRNA (cDNA clone MGC:52412
           IMAGE:4841638), complete cds.>gb:BX088580_1991551 Human
           DNA sequence from clone DASS-209N9 on chromosome 6,
           complete sequence.
          Length = 345

 Score = 36.2 bits (82), Expect = 1.0
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           W+ CD C+ WFH  CV  +  +A     ++CP C
Sbjct: 307 WVQCDGCDVWFHVACVGCS-IQAAREADFRCPGC 339



>gb:AE016816_1746805 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 348

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 15/46 (32%), Positives = 22/46 (47%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           C K  G  E  + CD C  WFH  C+++  A    +  + CP C +
Sbjct: 48  CKKPDG-GELMVQCDGCGDWFHFTCIRIPSAYKSLVFSFYCPYCQA 92



>gb:CR548612_1375276 Paramecium tetraurelia macronuclear largest
            chromosome, complete sequence.
          Length = 1654

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = -2

Query: 292  CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
            C K     ++ I CD CE W+H  C+ +   K +    Y C  C  K
Sbjct: 1232 CLKQQQQVKYMIFCDICEEWYHYECMGIKKLKEQSQDKYICRICLMK 1278



>gb:AY069824_1294554 Drosophila melanogaster SD07276 full length
           cDNA.
          Length = 907

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 5/58 (8%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC-----SSKRIR 143
           C  CGK        + C KC R FH  CV+  PA  +    +KCP C     + KR+R
Sbjct: 135 CRGCGK-------LMPCSKCLRSFHSYCVR--PATTKFDSSWKCPECQVIEAAPKRLR 183



>gb:AE014297_1142361 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003779_1224354 Drosophila melanogaster
           chromosome 3R, section 117 of 118 of the complete
           sequence.
          Length = 1121

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 5/58 (8%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC-----SSKRIR 143
           C  CGK        + C KC R FH  CV+  PA  +    +KCP C     + KR+R
Sbjct: 349 CRGCGK-------LMPCSKCLRSFHSYCVR--PATTKFDSSWKCPECQVIEAAPKRLR 397



>gb:AE014297_1142360 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003779_1224353 Drosophila melanogaster
           chromosome 3R, section 117 of 118 of the complete
           sequence.>gb:BT010115_1357481 Drosophila melanogaster
           GH01331 full insert cDNA.
          Length = 1664

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 5/58 (8%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC-----SSKRIR 143
           C  CGK        + C KC R FH  CV+  PA  +    +KCP C     + KR+R
Sbjct: 349 CRGCGK-------LMPCSKCLRSFHSYCVR--PATTKFDSSWKCPECQVIEAAPKRLR 397



>gb:AE014297_1142359 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003779_1224352 Drosophila melanogaster
           chromosome 3R, section 117 of 118 of the complete
           sequence.
          Length = 1674

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 21/58 (36%), Positives = 27/58 (46%), Gaps = 5/58 (8%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC-----SSKRIR 143
           C  CGK        + C KC R FH  CV+  PA  +    +KCP C     + KR+R
Sbjct: 359 CRGCGK-------LMPCSKCLRSFHSYCVR--PATTKFDSSWKCPECQVIEAAPKRLR 407



>gb:AE014134_1127322 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003580_1216282 Drosophila melanogaster
           chromosome 2L, section 11 of 83 of the complete
           sequence.
          Length = 528

 Score = 35.8 bits (81), Expect = 1.3
 Identities = 13/34 (38%), Positives = 15/34 (44%)
 Frame = -2

Query: 253 CDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           CD C  WFHG C+ +     E    Y C  C  K
Sbjct: 55  CDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRK 88



>gb:AF286030_1783184 Ustilago maydis regulator Ustilago maydis 1
            protein (rum1) gene, complete cds.
          Length = 2289

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 15/39 (38%), Positives = 19/39 (48%)
 Frame = -2

Query: 259  IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
            I CDKC  WFH  CV++        + + CP C  K  R
Sbjct: 1683 IACDKCMLWFHTNCVRLDDPPNLGNEPWICPMCCIKAER 1721



>gb:BT011675_1641197 Arabidopsis thaliana At2g19660 gene, complete
           cds.
          Length = 662

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 3/55 (5%)
 Frame = -2

Query: 373 RAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIG--CDKCERW-FHGRC 218
           R +N+N H           HG   CG C K   +D F+ G  C KC  +  H RC
Sbjct: 284 RVININRHDHRISYTRRLGHGQNTCGVCRKK--VDGFYGGYSCSKCSNYVVHSRC 336



 Score = 33.5 bits (75), Expect = 6.6
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCP 167
           LC  C K G  D     C+KC+  FH  C K+ P +A H+ H + P
Sbjct: 139 LCKTC-KWGVFDAVHYKCNKCDLRFHVECTKLFP-QASHVLHPQHP 182



>gb:ATAC010870_1543187 Arabidopsis thaliana chromosome III BAC
           T13O15 genomic sequence, complete sequence.
          Length = 2176

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 18/47 (38%), Positives = 23/47 (48%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           CGACG+   + E  + CD CER FH  CV     +A     + C  C
Sbjct: 86  CGACGRPESI-ELVVVCDACERGFHMSCVN-DGVEAAPSADWMCSDC 130



>gb:AC009894_1536885 Arabidopsis thaliana chromosome I BAC T6H22
           genomic sequence, complete sequence.
          Length = 1209

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAE-HMKHYKCPSC 161
           E W+ CDKCE W H  C      +       Y CPSC
Sbjct: 802 EGWVQCDKCEAWQHIICALFNSRRNHGESTKYTCPSC 838



>gb:AC005917_1533210 Arabidopsis thaliana chromosome 2 clone F3P11
           map CIC06E08, complete sequence.
          Length = 453

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 3/55 (5%)
 Frame = -2

Query: 373 RAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIG--CDKCERW-FHGRC 218
           R +N+N H           HG   CG C K   +D F+ G  C KC  +  H RC
Sbjct: 75  RVININRHDHRISYTRRLGHGQNTCGVCRKK--VDGFYGGYSCSKCSNYVVHSRC 127



>gb:AC005169_1532281 Arabidopsis thaliana chromosome 2 clone F6F22
           map mi148, complete sequence.
          Length = 566

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 3/55 (5%)
 Frame = -2

Query: 373 RAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIG--CDKCERW-FHGRC 218
           R +N+N H           HG   CG C K   +D F+ G  C KC  +  H RC
Sbjct: 284 RVININRHDHRISYTRRLGHGQNTCGVCRKK--VDGFYGGYSCSKCSNYVVHSRC 336



 Score = 33.5 bits (75), Expect = 6.6
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCP 167
           LC  C K G  D     C+KC+  FH  C K+ P +A H+ H + P
Sbjct: 139 LCKTC-KWGVFDAVHYKCNKCDLRFHVECTKLFP-QASHVLHPQHP 182



>pir|T19201|T19201 hypothetical protein C11G6.3 - Caenorhabditis
           elegans>gb:CEC11G6_1360352 Caenorhabditis elegans cosmid
           C11G6, complete sequence.
          Length = 385

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS 158
           +C  C     +    IGCD+C+ WFH  CV +T    +    + C  C+
Sbjct: 309 ICPVCSVAYTVGANMIGCDQCQDWFHWHCVGLTAEPTD--SKWFCTRCT 355



>pir|T12968|T12968 hypothetical protein T6H20.170 - Arabidopsis
           thaliana>gb:ATT6H20_1556351 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6H20.
          Length = 682

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 3/55 (5%)
 Frame = -2

Query: 373 RAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFW--IGCDKCERW-FHGRC 218
           R +N+N H           HGN  CG C K   +D F+    C KC  +  H RC
Sbjct: 304 RVININRHNHRISYTSLLGHGNWTCGVCRKK--VDGFYGAYSCSKCPSYAVHARC 356



>pir|E84579|E84579 hypothetical protein At2g19660 [imported] -
           Arabidopsis thaliana
          Length = 438

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 3/55 (5%)
 Frame = -2

Query: 373 RAMNVNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIG--CDKCERW-FHGRC 218
           R +N+N H           HG   CG C K   +D F+ G  C KC  +  H RC
Sbjct: 60  RVININRHDHRISYTRRLGHGQNTCGVCRKK--VDGFYGGYSCSKCSNYVVHSRC 112



>sp|P40034|YEO1_YEAST Hypothetical 56.5 kDa protein in CAJ1-HOM3
           intergenic region.>pir|S50554|S50554 hypothetical
           protein YER051w - yeast (Saccharomyces
           cerevisiae)>gb:SCE9379_1708100 Saccharomyces cerevisiae
           chromosome V cosmids 9379, 9581, and lambda clone 4678.
          Length = 492

 Score = 35.4 bits (80), Expect = 1.7
 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 15/48 (31%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVT---------------PAKAEHMKHYKCPS 164
           W+ CD C +W H +CV +                P  A+ +K Y+CP+
Sbjct: 21  WVKCDSCPQWVHVKCVPLKRIHYSNLTSSEVLSYPNSAKQIKSYRCPN 68



>gb:DROPLYCMB_1382548 Drosophila melanogaster polycomblike nuclear
           protein (pcl) gene, complete cds.
          Length = 857

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVK 212
           CGK G  D   + C KC  WFH +C++
Sbjct: 517 CGKPGKFDHNMLQCCKCRNWFHTQCMQ 543



>pir|E86302|E86302 hypothetical protein F17F16.8 [imported] -
           Arabidopsis thaliana>gb:AE005172_890649 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC026237_1539619 Arabidopsis thaliana
           chromosome I BAC F17F16 genomic sequence, complete
           sequence.
          Length = 1498

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 13/39 (33%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = -2

Query: 274 LDEFWIGCDKCERWFHGRCVKVTPAKAE-HMKHYKCPSC 161
           ++E W+ CDKC+ W H  C      + +     Y CP C
Sbjct: 826 IEESWVQCDKCQAWQHQICALFNGRRNDGGQAEYTCPYC 864



>pir|T50313|T50313 hypothetical phd finger protein [imported] -
           fission yeast  (Schizosaccharomyces pombe) (fragment)
          Length = 173

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 17/50 (34%), Positives = 25/50 (50%)
 Frame = -2

Query: 310 NTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           N+ C  CG+     + +I C  CER FH  CV +    A+ +  + CP C
Sbjct: 12  NSSC-LCGEEFSPRDSFIDCTICERRFHYDCVGLNNEIADSVSKFTCPIC 60



>sp|Q24459|PCL_DROME Polycomb protein Pcl (Polycomblike
           protein).>gb:AE013599_1132556 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003800_1225107
           Drosophila melanogaster chromosome 2R, section 50 of 74
           of the complete sequence.>gb:AY075585_1296373 Drosophila
           melanogaster SD09488 full length cDNA.
          Length = 1043

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVK 212
           CGK G  D   + C KC  WFH +C++
Sbjct: 517 CGKPGKFDHNMLQCCKCRNWFHTQCMQ 543



>gb:AB111948_2465634 Tetraodon nigroviridis retrotransposon KenoTn1
           DNA, partial sequence.
          Length = 250

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 19/50 (38%), Positives = 24/50 (48%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSS 155
           LCG CG+HG LDE       CE+   G+C  V  +    M   KC  C +
Sbjct: 6   LCGRCGEHGHLDE------ACEKIVCGKCRAVGHSFDGGMNGRKCNLCGA 49



>gb:AY138582_2076730 Mus musculus mixed-lineage leukemia 3 protein
            (Mll3) mRNA, partial cds.
          Length = 3396

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = -2

Query: 304  LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS-----SKRIR 143
            +C  CG  G G +   + C +C + +H  CV +   K    K ++C  C+      K   
Sbjct: 845  MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATD 904

Query: 142  P*GRNMLC 119
            P GR +LC
Sbjct: 905  P-GRLLLC 911



 Score = 34.7 bits (78), Expect = 3.0
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%)
 Frame = -2

Query: 310 NTLCGACGK--HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM--KHYKCPSC 161
           + LC  CGK  H  L +  + C+ C+RW H  C K T  + +    + Y C  C
Sbjct: 395 DNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDQELDSQLKEDYICMYC 448



>gb:AY024361_1934335 Homo sapiens MLL3 mRNA, complete cds.
          Length = 4911

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = -2

Query: 304  LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS-----SKRIR 143
            +C  CG  G G +   + C +C + +H  CV +   K    K ++C  C+      K   
Sbjct: 959  MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATD 1018

Query: 142  P*GRNMLC 119
            P GR +LC
Sbjct: 1019 P-GRLLLC 1025



 Score = 34.3 bits (77), Expect = 3.9
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%)
 Frame = -2

Query: 310 NTLCGACGK--HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM--KHYKCPSC 161
           + LC  CGK  H  L +  + C+ C+RW H  C K T  + +    + Y C  C
Sbjct: 464 DNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDHELDTQLKEEYICMYC 517



>gb:AF264750_1893756 Homo sapiens ALR-like protein mRNA, complete
           cds.
          Length = 4025

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = -2

Query: 304 LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS-----SKRIR 143
           +C  CG  G G +   + C +C + +H  CV +   K    K ++C  C+      K   
Sbjct: 20  MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATD 79

Query: 142 P*GRNMLC 119
           P GR +LC
Sbjct: 80  P-GRLLLC 86



>gb:AC006474_1875155 Homo sapiens PAC clone RP4-669I17 from 7,
           complete sequence.
          Length = 2185

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = -2

Query: 304 LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS-----SKRIR 143
           +C  CG  G G +   + C +C + +H  CV +   K    K ++C  C+      K   
Sbjct: 20  MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATD 79

Query: 142 P*GRNMLC 119
           P GR +LC
Sbjct: 80  P-GRLLLC 86



>gb:AB040939_1866868 Homo sapiens mRNA for KIAA1506 protein, partial
           cds.
          Length = 3310

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = -2

Query: 304 LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS-----SKRIR 143
           +C  CG  G G +   + C +C + +H  CV +   K    K ++C  C+      K   
Sbjct: 404 MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATD 463

Query: 142 P*GRNMLC 119
           P GR +LC
Sbjct: 464 P-GRLLLC 470



>gb:AY442258_1606336 Populus alba x Populus tremula clone
           cET-1-pop1-465 predicted protein mRNA, complete cds.
          Length = 868

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%)
 Frame = -2

Query: 313 GNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKV--TPAKAEHMKHYKCPSCS 158
           G+ +C  CG  G L    + C  C R FH  C+ +  TP  A H     CP+C+
Sbjct: 522 GDDMCAECGDGGDL----MFCQSCPRAFHAACLDLHDTPEGAWH-----CPNCN 566



>gb:AK054270_1170760 Mus musculus 2 days pregnant adult female ovary
           cDNA, RIKEN full-length enriched library,
           clone:E330008K23 product:hypothetical HMG-I and HMG-Y
           DNA-binding domain (A+T-hook)/PHD-finger/DHHC-type
           Zn-finger/RING finger containing protein, full insert
           sequence.
          Length = 813

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%)
 Frame = -2

Query: 310 NTLCGACGK--HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM--KHYKCPSC 161
           + LC  CGK  H  L +  + C+ C+RW H  C K T  + +    + Y C  C
Sbjct: 463 DNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDQELDSQLKEDYICMYC 516



>gb:AE005173_893481 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC002304_1530205 Genomic sequence
           for Arabidopsis thaliana BAC F14J16 from chromosome I,
           complete sequence.
          Length = 1550

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 1/35 (2%)
 Frame = -2

Query: 262 WIGCDKCERWFHGRCVKVTPAKAE-HMKHYKCPSC 161
           W+ CDKCE W H  C      +       Y CPSC
Sbjct: 839 WVQCDKCEAWQHIICALFNSRRNHGESTKYTCPSC 873



>pir|F84833|F84833 probable SNF2/SWI2 family transcription factor
           [imported] - Arabidopsis thaliana>gb:AC007660_1536086
           Arabidopsis thaliana chromosome II section 220 of 255 of
           the complete sequence. Sequence from clones T2P4, T7D17,
           T20B5.
          Length = 1648

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTP 203
           +CGA  +       W+ CD C+ W H  CV  +P
Sbjct: 398 ICGAVSESHKYKGVWVQCDLCDAWQHADCVGYSP 431



>sp|Q8BRH4|MLL3_MOUSE Myeloid/lymphoid or mixed-lineage leukemia
            protein 3 homolog (Histone- lysine N-methyltransferase,
            H3 lysine-4 specific MLL3) (EC 2.1.1.43).
          Length = 4903

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = -2

Query: 304  LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS-----SKRIR 143
            +C  CG  G G +   + C +C + +H  CV +   K    K ++C  C+      K   
Sbjct: 952  MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATD 1011

Query: 142  P*GRNMLC 119
            P GR +LC
Sbjct: 1012 P-GRLLLC 1018



 Score = 34.7 bits (78), Expect = 3.0
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%)
 Frame = -2

Query: 310 NTLCGACGK--HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM--KHYKCPSC 161
           + LC  CGK  H  L +  + C+ C+RW H  C K T  + +    + Y C  C
Sbjct: 463 DNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDQELDSQLKEDYICMYC 516



>sp|Q8NEZ4|MLL3_HUMAN Myeloid/lymphoid or mixed-lineage leukemia
            protein 3 homolog (Histone- lysine N-methyltransferase,
            H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to
            ALR protein).
          Length = 4911

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 6/68 (8%)
 Frame = -2

Query: 304  LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCS-----SKRIR 143
            +C  CG  G G +   + C +C + +H  CV +   K    K ++C  C+      K   
Sbjct: 959  MCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGKATD 1018

Query: 142  P*GRNMLC 119
            P GR +LC
Sbjct: 1019 P-GRLLLC 1025



 Score = 34.3 bits (77), Expect = 3.9
 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%)
 Frame = -2

Query: 310 NTLCGACGK--HGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHM--KHYKCPSC 161
           + LC  CGK  H  L +  + C+ C+RW H  C K T  + +    + Y C  C
Sbjct: 464 DNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDHELDTQLKEEYICMYC 517



>gb:AY260488_2081112 Mus pahari SmcY protein gene, partial cds.
          Length = 229

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 22/71 (30%), Positives = 30/71 (42%), Gaps = 15/71 (21%)
 Frame = -2

Query: 253 CDKCERWFHGRCVKV----TPAKAEHMK-----------HYKCPSCSSKRIRP*GRNMLC 119
           CD C  WFHG+CV V    +  +A H              + CP C   R RP   N+L 
Sbjct: 55  CDLCHDWFHGQCVTVPHLLSSVRASHTSSQLLAWWEWDTKFLCPLCMRSR-RPRLENILS 113

Query: 118 YLTLAEKQNFR 86
            L   ++ + R
Sbjct: 114 LLVGLQRLSVR 124



>gb:CR382126_1659574 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 478

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 16/64 (25%)
 Frame = -2

Query: 313 GNTLCGACGKHGGLDE---FWIGCDKCERWFHGRCVKV--------TPA-----KAEHMK 182
           G   C  C K    D+    W+GC+ C+ W H  CV +         P+     K +H++
Sbjct: 4   GTVKCHFCKKDDSEDKGQPIWVGCEFCDGWCHLTCVPIQFVVPKLENPSQLLAFKEKHVE 63

Query: 181 HYKC 170
            +KC
Sbjct: 64  SFKC 67



>gb:AY093116_1575070 Arabidopsis thaliana putative PHD-type zinc
           finger protein (At2g36720) mRNA, complete
           cds.>gb:BT008812_1640008 Arabidopsis thaliana At2g36720
           gene, complete cds.
          Length = 1007

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 33/130 (25%), Positives = 45/130 (34%)
 Frame = -2

Query: 541 YCMCRKVLFNMINELPTVFEIVTGAAKKHNEKSVITNHGGXXXXXXXXSRPAESHGRAMN 362
           YC C K   +     P++FE   G A +      I    G        +    SHGR  +
Sbjct: 559 YCYCCKCEVS-----PSLFEAHAGWASRRKPYFYIYTSNGVSLHEWATTF---SHGRKYS 610

Query: 361 VNPHXXXXXXXXXXEHGNTLCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMK 182
            N +             N LC  C   G L    + CD C R FH  CV +         
Sbjct: 611 ANDN-------------NDLCVICADGGNL----LLCDSCPRAFHIECVSLPSIP---RG 650

Query: 181 HYKCPSCSSK 152
           ++ C  C +K
Sbjct: 651 NWHCKYCENK 660



>gb:AX876548_1476582 Sequence 11453 from Patent
           EP1074617.>gb:AK001345_1908385 Homo sapiens cDNA
           FLJ10483 fis, clone NT2RP2000157.
          Length = 274

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = -2

Query: 259 IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           I C  CE WFHGR +  TP ++   +   C +C  +
Sbjct: 2   IQCVVCEDWFHGRHLGATPPESGDFQEMVCQACMKR 37



>gb:AK008164_1154422 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010009J12
           product:PLU-1 PROTEIN homolog [Homo sapiens], full
           insert sequence.
          Length = 204

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = -2

Query: 298 GACGKHGGLDEFWIGCD-KCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           G+C +  G +  W+ CD  C +WFH     V+P  AE  + Y C  C+ K
Sbjct: 140 GSCLQPEGDEVDWVQCDGSCNQWFHQVWGGVSPEMAE-KEDYICVRCTGK 188



>pir|T03455|T03455 ALR protein - human>gb:AF010404_1876230 Homo
           sapiens ALR mRNA, complete cds.
          Length = 4957

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -2

Query: 304 LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           +C  CG  G G +   + C +C + +H  CV     K   +K ++C  C
Sbjct: 799 MCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVEC 847



>sp|O14686|MLL2_HUMAN Myeloid/lymphoid or mixed-lineage leukemia
            protein 2 (ALL1-related protein).>pir|T03454|T03454 ALR
            protein - human>gb:AF010403_1876229 Homo sapiens ALR
            mRNA, complete cds.
          Length = 5262

 Score = 34.3 bits (77), Expect = 3.9
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%)
 Frame = -2

Query: 304  LCGACGKHG-GLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
            +C  CG  G G +   + C +C + +H  CV     K   +K ++C  C
Sbjct: 1104 MCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVEC 1152



>gb:S78570_2041761 MLL=trx zinc-finger domain homolog {alternatively
           spliced, clone 14p-18B} [human, mRNA Partial, 1098 nt].
          Length = 366

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
           LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 283 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPECVAYTCVNCTER 339



>gb:HUMTRXLP_2037918 Human trithorax-like protein (TRX1) mRNA,
           partial cds.
          Length = 1012

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
           LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 255 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 311



>gb:HUMMLL_2034848 Human mRNA for MLL.
          Length = 1909

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
            LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 1571 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 1627



>gb:HUMHRX_2032183 Human germline HRX mRNA, complete cds.
          Length = 3969

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
            LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 1571 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 1627



>gb:AY373585_1948315 Homo sapiens myeloid/lymphoid or mixed-lineage
            leukemia (trithorax homolog, Drosophila) (MLL) gene,
            complete cds.
          Length = 3969

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
            LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 1571 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 1627



>gb:AF492830_1905096 Homo sapiens CDK6/MLL fusion protein mRNA,
           partial cds.
          Length = 182

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
           LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 126 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 182



>gb:AP006616_1862490 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1206D04.
          Length = 411

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 12/33 (36%), Positives = 19/33 (57%)
 Frame = -2

Query: 259 IGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSC 161
           I CD+C+ W+H  C+K+        K + CP+C
Sbjct: 287 IACDQCDEWYHFDCIKL---HGPPPKTFYCPAC 316



>gb:AE017347_1757691 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 870

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = -2

Query: 274 LDEFWIGCDKCERWFHGRCV 215
           +D  W+ C+KC+ W+H  C+
Sbjct: 50  IDFIWVACNKCDEWYHSACL 69



>gb:AB006699_1509893 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MDJ22.
          Length = 1516

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = -2

Query: 262  WIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIR 143
            +I C  C+ W+H   VK+  +K   +  +KC  C  +RIR
Sbjct: 1208 YIHCTSCDMWYHIEAVKLEESKIPEVVGFKC--CRCRRIR 1245



 Score = 33.9 bits (76), Expect = 5.0
 Identities = 18/54 (33%), Positives = 24/54 (44%)
 Frame = -2

Query: 301 CGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSKRIRP 140
           C  CG  G L    + CD C   +H RC+ V          Y CP C+ K++ P
Sbjct: 416 CRLCGMDGTL----LCCDGCPLAYHSRCIGVVKMYIPDGPWY-CPECTIKKMGP 464



>pir|T18543|T18543 probable cell-adhesion protein MFB1 - shiitake
           mushroom>gb:D14487_1674469 Lentinus edodes Le.MFB1 mRNA,
           complete cds.
          Length = 2140

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = -2

Query: 274 LDEFW-IGCDKCERWFHGRCVKVTPAKAEHM-KHYKCPSC 161
           +D+ W +GCD C RW HG C        E++  H+ C  C
Sbjct: 136 VDDGWSVGCDGCGRWVHGVCFGFEAKDKENLPDHWWCWEC 175



>pir|T41530|T41530 hypothetical protein SPCC645.13 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC645_1721533 S.pombe
           chromosome III cosmid c645.
          Length = 721

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = -2

Query: 292 CGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKHYKCPSCSSK 152
           C     + + W+ CD C+ W H  CV +  A  +  + Y C  C S+
Sbjct: 25  CKSQEDIGDTWVQCDGCDCWQHASCVGL--ADKDIPESYYCEVCHSR 69



>pir|B96696|B96696 protein F1N21.4 [imported] - Arabidopsis
           thaliana>gb:AE005173_894344 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC002130_1530090 Genomic sequence for
           Arabidopsis thaliana BAC F1N21 from chromosome I,
           complete sequence.
          Length = 1357

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
 Frame = -2

Query: 268 EFWIGCDKCERWFHGRCVKVTPAKAE-HMKHYKCPSC 161
           E W+ C+ CE+W H  C      K E     Y CP+C
Sbjct: 726 EEWVQCESCEKWQHQICGLYNKLKDEDKTAEYICPTC 762



>pir|I53035|I53035 trithorax homolog HTX - human (fragment)
          Length = 366

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304 LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
           LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 283 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPECVAYTCVNCTER 339



>pir|A44265|A44265 trithorax homolog HTX, version 2 - human
          Length = 3968

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
            LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 1571 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 1627



>sp|Q03164|HRX_HUMAN Zinc finger protein HRX (ALL-1) (Trithorax-like
            protein).
          Length = 3969

 Score = 33.9 bits (76), Expect = 5.0
 Identities = 14/57 (24%), Positives = 25/57 (43%), Gaps = 6/57 (10%)
 Frame = -2

Query: 304  LCGACGKHGGLDEFWIGCDKCERWFHGRCVKVTPAKAEHMKH------YKCPSCSSK 152
            LC  C      +   + C KC+RW H +C  ++    E + +      Y C +C+ +
Sbjct: 1571 LCDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTER 1627



>gb:BC054499_1985182 Homo sapiens Smcy homolog, X-linked (mouse), mRNA
            (cDNA clone MGC:57577 IMAGE:5492114), complete cds.
          Length = 1559

 Score = 33.5 bits (75), Expect = 6.6
 Identities = 11/15 (73%), Positives = 12/15 (80%)
 Frame = -2

Query: 253  CDKCERWFHGRCVKV 209
            CD C+ WFHGRCV V
Sbjct: 1201 CDLCQDWFHGRCVSV 1215


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 899,510,717
Number of Sequences: 1806583
Number of extensions: 17205529
Number of successful extensions: 40705
Number of sequences better than 10.0: 279
Number of HSP's better than 10.0 without gapping: 39160
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 40659
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 71931210200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)