BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12869
         (794 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AE005172_889846 Arabidopsis thaliana chromosome 1, top arm co...   187   1e-46   
gb:AF124737_1770286 Zea mays clone CDAPG77 unknown mRNA.              176   6e-43   
gb:AC145811_1744505 Oryza sativa chromosome 3 BAC OSJNBb0088L13 ...   163   3e-39   
pir|A84670|A84670 probable nucleotide-binding protein [imported]...   145   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AF124045_1770226 Sorghum bicolor BAC clone 110K5, partial seq...    89   7e-17   
pir|T50845|T50845 GTP-binding protein homolog [imported] - sorgh...    89   7e-17   Sorghum bicolor [broomcorn]
gb:AE014298_1123869 Drosophila melanogaster chromosome X, comple...    77   4e-13   
gb:BC080306_2107751 Mus musculus DNA segment, Chr 16, Brigham & ...    76   8e-13   
gb:BC043724_2098980 Mus musculus DNA segment, Chr 16, Brigham & ...    76   8e-13   
gb:AX878293_1477382 Sequence 13198 from Patent EP1074617.>gb:AK0...    73   7e-12   
gb:HSM801865_1186522 Homo sapiens mRNA; cDNA DKFZp434E248 (from ...    73   7e-12   
gb:AJ720501_2502688 Gallus gallus mRNA for hypothetical protein,...    72   9e-12   
gb:BC066695_2554534 Danio rerio zgc:76988, mRNA (cDNA clone MGC:...    72   1e-11   
gb:NCB7A16_1690124 Neurospora crassa DNA linkage group V BAC clo...    64   4e-09   
sp|Q10190|YAWG_SCHPO|YAWG_SCHPO Hypothetical GTP-binding protein C3F10.16c ...    63   7e-09   Schizosaccharomyces pombe
gb:AE016819_1748794 Ashbya gossypii (= Eremothecium gossypii) AT...    60   4e-08   
gb:CR382129_1662189 Yarrowia lipolytica chromosome C of strain C...    60   4e-08   
gb:CR382126_1658646 Kluyveromyces lactis strain NRRL Y-1140 chro...    58   2e-07   
gb:CR380956_1652217 Candida glabrata strain CBS138 chromosome J ...    56   7e-07   
gb:AF003143_1230857 Caenorhabditis elegans cosmid C53H9, complet...    56   9e-07   
pir|T15221|T15221 hypothetical protein C53H9.2 - Caenorhabditis ...    56   9e-07   Caenorhabditis elegans [roundworm]
sp|P53145|YGJ9_YEAST|YGJ9_YEAST Hypothetical GTP-binding protein in SEH1-PR...    55   1e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017343_1755384 Cryptococcus neoformans var. neoformans JEC2...    53   6e-06   
gb:CR382135_1667896 Debaryomyces hansenii chromosome C of strain...    50   6e-05   
gb:LMFL5213_1388152 Leishmania major Friedlin chromosome 5 cosmi...    47   3e-04   
gb:AE017344_1756521 Cryptococcus neoformans var. neoformans JEC2...    42   0.017   
gb:AE016815_1746355 Ashbya gossypii (= Eremothecium gossypii) AT...    41   0.029   
gb:AF542529_1810099 Cryptococcus neoformans var. grubii strain H...    40   0.066   
gb:AF542528_1810065 Cryptococcus neoformans var. grubii strain 1...    40   0.066   
sp|P53742|YN8U_YEAST|YN8U_YEAST Hypothetical GTP-binding protein in POP2-HO...    40   0.066   Saccharomyces cerevisiae [brewer's yeast]
gb:AY710430_1623954 Cryptococcus gattii strain WM276 MATalpha lo...    39   0.086   
gb:AY710429_1623919 Cryptococcus gattii strain E566 MATa locus, ...    39   0.086   
gb:AY421966_1605139 Cryptococcus gattii strain ATCC 32609 MAT-al...    39   0.086   
gb:CR380949_1649555 Candida glabrata strain CBS138 chromosome C ...    38   0.19    
gb:BC087521_2565357 Xenopus laevis hypothetical LOC496093, mRNA ...    38   0.25    
gb:BC078411_2560984 Danio rerio hypothetical protein FLJ10613-li...    38   0.25    
gb:AL844847_2504588 Zebrafish DNA sequence from clone DKEY-13A21...    38   0.25    
gb:AP003199_1825021 Oryza sativa (japonica cultivar-group) genom...    37   0.43    
gb:LMFL6071_1388248 Leishmania major Friedlin chromosome 5 cosmi...    37   0.43    
gb:CR382132_1666112 Yarrowia lipolytica chromosome F of strain C...    37   0.56    
gb:AY054687_1563341 Arabidopsis thaliana putative GTPase (At3g07...    37   0.56    
gb:ATAC016827_1543630 Arabidopsis thaliana chromosome III BAC F1...    37   0.56    
gb:AC019018_1538504 Arabidopsis thaliana chromosome 1 BAC F14G24...    36   0.95    
pir|T39037|T39037 hypothetical gtp-binding protein associated - ...    36   0.95    Schizosaccharomyces pombe
gb:CR382137_1669593 Debaryomyces hansenii chromosome E of strain...    35   1.6     
gb:CR382123_1656303 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   1.6     
sp|Q58859|YE64_METJA|YE64_METJA Hypothetical GTP-binding protein MJ1464.>pi...    35   2.1     Methanocaldococcus jannaschii
gb:BC010298_2090942 Mus musculus guanine nucleotide binding prot...    34   2.8     
gb:BC042350_2548158 Xenopus laevis nucleolar GTPase, mRNA (cDNA ...    34   3.6     
gb:BT008065_2150997 Synthetic construct Homo sapiens guanine nuc...    34   3.6     
gb:BC063657_1986315 Homo sapiens guanine nucleotide binding prot...    34   3.6     
gb:BA000041_1966278 Pan troglodytes DNA, major histocompatibilit...    34   3.6     
gb:BA000025_1966193 Homo sapiens genomic DNA, chromosome 6p21.3,...    34   3.6     
gb:AL662800_1931461 Human DNA sequence from clone XXbac-249D20 o...    34   3.6     
gb:AB128049_1873976 Macaca mulatta genes, MHC class I region, pa...    34   3.6     
gb:AB088095_1872106 Homo sapiens CAT56, HSR1 genes for proline r...    34   3.6     
gb:CR859219_1183348 Pongo pygmaeus mRNA; cDNA DKFZp459M2138 (fro...    34   3.6     
gb:AE017343_1755357 Cryptococcus neoformans var. neoformans JEC2...    33   6.1     
gb:AE014187_938687 Plasmodium falciparum 3D7 chromosome 14 compl...    33   6.1     
pir|G90204|G90204 GTP binding protein, hypothetical [imported] -...    33   6.1     Saccharolobus solfataricus
gb:AB158488_1410964 Sus scrofa TRIM39, FLJ22638, GNL1, CAT56 gen...    33   8.0     
gb:AE013599_1132447 Drosophila melanogaster chromosome 2R, compl...    33   8.0     
sp|P36915|GNL1_HUMAN|GNL1_HUMAN Guanine nucleotide-binding protein-like 1 (...    33   8.0     Homo sapiens [man]


>gb:AE005172_889846 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC006932_1534852 Genomic sequence
           for Arabidopsis thaliana BAC T27G7 from chromosome I,
           complete sequence.
          Length = 589

 Score =  187 bits (476), Expect = 1e-46
 Identities = 101/201 (50%), Positives = 124/201 (61%), Gaps = 1/201 (0%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ 614
           A++VPR+VI  VY ISLPKPK YE QSRPP A+ELL++YCASRGYVA+SGLPDET+AAR 
Sbjct: 397 ADKVPRRVIESVYNISLPKPKTYERQSRPPHAAELLKSYCASRGYVASSGLPDETKAARL 456

Query: 613 ILKDYVDGKLPHFEMPPGMPNXXXXXXXXXXXXXXXXXXAGPSLXXXXXXXXXXXXXXXX 434
           ILKDY+ GKLPH+ MPPGMP                       L                
Sbjct: 457 ILKDYIGGKLPHYAMPPGMPQADEPDIEDTQELEDI-------LEGSESDDSAVGDETEN 509

Query: 433 XDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAXXXXXXXXXXXKDRSWRVQN-DG 257
              P +D +L+DL++FD+ NGL +S K T KK+   A           KDR+WRVQN + 
Sbjct: 510 EQVPGIDDVLDDLSSFDLANGLKSSKKVTAKKQ--TASHKQHKKPQRKKDRTWRVQNTED 567

Query: 256 GDGMPAVRVLQKPVNTGPLNI 194
           GDGMP+V+V QKP NTGPL +
Sbjct: 568 GDGMPSVKVFQKPANTGPLTM 588



>gb:AF124737_1770286 Zea mays clone CDAPG77 unknown mRNA.
          Length = 444

 Score =  176 bits (445), Expect = 6e-43
 Identities = 96/192 (50%), Positives = 116/192 (60%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ 614
           A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct: 248 ADRVPRDILEQIYKIALPKPKPYEPQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ 307

Query: 613 ILKDYVDGKLPHFEMPPGMPNXXXXXXXXXXXXXXXXXXAGPSLXXXXXXXXXXXXXXXX 434
           ILKDY+DGK+PHFE+PPG+                    A  S+                
Sbjct: 308 ILKDYIDGKIPHFELPPGVTGPEVDFEQIAGSESPTTSAANESVTDDLDEEDDDAVDPAE 367

Query: 433 XDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAXXXXXXXXXXXKDRSWRVQNDGG 254
               ++  +L+DL +FD+ NG    SK T KKK   A           KDRSWRV NDGG
Sbjct: 368 S---NMRDVLDDLESFDLGNG---GSKTTAKKK--EASHKHHKKPQRKKDRSWRVGNDGG 419

Query: 253 DGMPAVRVLQKP 218
           DG   VRV QKP
Sbjct: 420 DGTAVVRVYQKP 431



>gb:AC145811_1744505 Oryza sativa chromosome 3 BAC OSJNBb0088L13
           genomic sequence, complete sequence.
          Length = 605

 Score =  163 bits (413), Expect = 3e-39
 Identities = 88/192 (45%), Positives = 109/192 (56%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ 614
           ANRVPR V+  +YKI+LPKPK YE  SRPP A+ELLRAYC SRG+V+ +GLPDETRAARQ
Sbjct: 413 ANRVPRNVLEQIYKITLPKPKAYEQLSRPPTAAELLRAYCTSRGHVSHAGLPDETRAARQ 472

Query: 613 ILKDYVDGKLPHFEMPPGMPNXXXXXXXXXXXXXXXXXXAGPSLXXXXXXXXXXXXXXXX 434
           ILKDY+DGK+PHFE+PPG  +                                       
Sbjct: 473 ILKDYLDGKIPHFELPPGDTDSETDPEETTDLEGSDTAVG----ATADHCASDEQDEEIS 528

Query: 433 XDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAXXXXXXXXXXXKDRSWRVQNDGG 254
              P++ H+L+DL +FD+ + ++ +S     KK   A           KDRSWRV NDG 
Sbjct: 529 QADPNISHVLSDLESFDLASEVSKNS----TKKKKEASYKHHKKPQRKKDRSWRVGNDGA 584

Query: 253 DGMPAVRVLQKP 218
           DG   VRV QKP
Sbjct: 585 DGSAVVRVFQKP 596



>pir|A84670|A84670 probable nucleotide-binding protein [imported] -
           Arabidopsis thaliana>gb:AC007290_1535770 Arabidopsis
           thaliana chromosome 2 clone T22O13 map B68, complete
           sequence.
          Length = 537

 Score =  145 bits (365), Expect = 1e-33
 Identities = 79/152 (51%), Positives = 91/152 (59%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ 614
           A  VPR  I DVY ISLPKPK YEPQSRPPLASELLR YC SRGYVA+SGLPDETRAARQ
Sbjct: 393 AELVPRHAIEDVYNISLPKPKSYEPQSRPPLASELLRTYCLSRGYVASSGLPDETRAARQ 452

Query: 613 ILKDYVDGKLPHFEMPPGMPNXXXXXXXXXXXXXXXXXXAGPSLXXXXXXXXXXXXXXXX 434
           ILKDY++GKLPHF MPP +                    A  +L                
Sbjct: 453 ILKDYIEGKLPHFAMPPEI------------TRDDENETADDTLGAETREGSQTEKKGEE 500

Query: 433 XDAPSLDHILNDLNTFDITNGLAASSKATVKK 338
             +  LD +L+DL++FD+ NGL +S     KK
Sbjct: 501 APSLGLDQVLDDLSSFDLANGLVSSKTKQHKK 532



>gb:AF124045_1770226 Sorghum bicolor BAC clone 110K5, partial
           sequence.
          Length = 142

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 43/59 (72%), Positives = 51/59 (86%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAAR 617
           A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAY ASRG+   +GLPDETRAAR
Sbjct: 87  ADRVPRDILEQIYKITLPKPKPYEPQSRPPTAAELLRAYYASRGH---AGLPDETRAAR 142



>pir|T50845|T50845 GTP-binding protein homolog [imported] - sorghum
           (fragment)
          Length = 142

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 43/59 (72%), Positives = 51/59 (86%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAAR 617
           A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAY ASRG+   +GLPDETRAAR
Sbjct: 87  ADRVPRDILEQIYKITLPKPKPYEPQSRPPTAAELLRAYYASRGH---AGLPDETRAAR 142



>gb:AE014298_1123869 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003421_1209051 Drosophila melanogaster
           chromosome X, section 5 of 74 of the complete
           sequence.>gb:AY047556_1289515 Drosophila melanogaster
           GH06695 full length cDNA.>gb:DMBN32G11_1378165
           Drosophila melanogaster BAC clone BACN32G11.
          Length = 606

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 36/78 (46%), Positives = 52/78 (66%)
 Frame = -2

Query: 787 RVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQIL 608
           R+PR V+ D Y I + KP   E   RPP + ELL AY  +RG++ ++G PD+ R+AR +L
Sbjct: 428 RIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNGQPDQARSARYVL 487

Query: 607 KDYVDGKLPHFEMPPGMP 554
           KDYV+G+L +   PP +P
Sbjct: 488 KDYVNGRLLYAMSPPSVP 505



>gb:BC080306_2107751 Mus musculus DNA segment, Chr 16, Brigham &
           Women's Genetics 1547 expressed, mRNA (cDNA clone
           IMAGE:5691106), partial cds.
          Length = 572

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 37/75 (49%), Positives = 49/75 (65%)
 Frame = -2

Query: 784 VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK 605
           +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct: 392 IPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILK 451

Query: 604 DYVDGKLPHFEMPPG 560
           DYV GKL +   PPG
Sbjct: 452 DYVGGKLLYCHPPPG 466



>gb:BC043724_2098980 Mus musculus DNA segment, Chr 16, Brigham &
           Women's Genetics 1547 expressed, mRNA (cDNA clone
           MGC:49517 IMAGE:5004563), complete cds.
          Length = 644

 Score = 75.9 bits (185), Expect = 8e-13
 Identities = 37/75 (49%), Positives = 49/75 (65%)
 Frame = -2

Query: 784 VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK 605
           +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct: 464 IPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILK 523

Query: 604 DYVDGKLPHFEMPPG 560
           DYV GKL +   PPG
Sbjct: 524 DYVGGKLLYCHPPPG 538



>gb:AX878293_1477382 Sequence 13198 from Patent
           EP1074617.>gb:AK002163_1908863 Homo sapiens cDNA
           FLJ11301 fis, clone PLACE1009908, weakly similar to
           HYPOTHETICAL GTP-BINDING PROTEIN IN SEH1-PRP20
           INTERGENIC REGION.
          Length = 642

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 36/75 (48%), Positives = 47/75 (62%)
 Frame = -2

Query: 784 VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK 605
           +PR V+   Y I++  P+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct: 478 IPRHVLEATYGINIITPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK 537

Query: 604 DYVDGKLPHFEMPPG 560
           DYV GKL +   PPG
Sbjct: 538 DYVSGKLLYCHPPPG 552



>gb:HSM801865_1186522 Homo sapiens mRNA; cDNA DKFZp434E248 (from
           clone DKFZp434E248).>gb:BC068500_1987648 Homo sapiens
           hypothetical protein FLJ11301, mRNA (cDNA clone
           MGC:87237 IMAGE:30343878), complete cds.
          Length = 658

 Score = 72.8 bits (177), Expect = 7e-12
 Identities = 36/75 (48%), Positives = 47/75 (62%)
 Frame = -2

Query: 784 VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK 605
           +PR V+   Y I++  P+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct: 478 IPRHVLEATYGINIITPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK 537

Query: 604 DYVDGKLPHFEMPPG 560
           DYV GKL +   PPG
Sbjct: 538 DYVSGKLLYCHPPPG 552



>gb:AJ720501_2502688 Gallus gallus mRNA for hypothetical protein,
           clone 19c19.
          Length = 653

 Score = 72.4 bits (176), Expect = 9e-12
 Identities = 34/76 (44%), Positives = 48/76 (63%)
 Frame = -2

Query: 784 VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK 605
           +PR ++   Y I++ +P+  E   R P A ELL AY   RG++ A G PD+ R+AR +LK
Sbjct: 473 IPRNILEATYGINIIRPREDEDPDRKPTAEELLTAYGYMRGFMTAHGQPDQPRSARYVLK 532

Query: 604 DYVDGKLPHFEMPPGM 557
           DYV GKL +   PPG+
Sbjct: 533 DYVSGKLLYCHPPPGI 548



>gb:BC066695_2554534 Danio rerio zgc:76988, mRNA (cDNA clone
           MGC:76988 IMAGE:6525951), complete cds.
          Length = 640

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 34/74 (45%), Positives = 47/74 (63%)
 Frame = -2

Query: 784 VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK 605
           +PR V+   Y I++ +P+  E   RPP   ELL AY   RG++ A G PD++R+AR +LK
Sbjct: 460 IPRNVLEGTYGINIIRPREDEDPDRPPTYEELLMAYGYMRGFMTAHGQPDQSRSARYVLK 519

Query: 604 DYVDGKLPHFEMPP 563
           DYV GKL +   PP
Sbjct: 520 DYVSGKLLYCHPPP 533



>gb:NCB7A16_1690124 Neurospora crassa DNA linkage group V BAC clone
           B7A16.
          Length = 653

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 36/79 (45%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAAS-GLPDETRAAR 617
           A R+P+  +  VY I +      E  +  P A ELL AY   RGY+    G PD++RA R
Sbjct: 426 ARRIPQPFLEAVYGIKIKTRPLEEGGTGIPTADELLDAYARHRGYMTQGLGQPDQSRAVR 485

Query: 616 QILKDYVDGKLPHFEMPPG 560
            ILKDYV+GKL + E PPG
Sbjct: 486 YILKDYVNGKLLYCEPPPG 504



>sp|Q10190|YAWG_SCHPO Hypothetical GTP-binding protein C3F10.16c in
           chromosome I.>pir|T38717|T38717 probable GTP-binding
           protein - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC3F10_1717831 S.pombe chromosome I cosmid
           c3F10.
          Length = 616

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 1/82 (1%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAAS-GLPDETRAAR 617
           A R+P++V+  +Y I +      E  +  P A E+L  +  SRG++ A  G PD++RAAR
Sbjct: 390 AERIPKEVLETLYTIRIRIKPIEEGGTGVPSAQEVLFPFARSRGFMRAHHGTPDDSRAAR 449

Query: 616 QILKDYVDGKLPHFEMPPGMPN 551
            +LKDYV+GKL +   PP  PN
Sbjct: 450 ILLKDYVNGKLLYVHPPPNYPN 471



>gb:AE016819_1748794 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 641

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 35/78 (44%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAAS-GLPDETRAAR 617
           A R+P+  +  VY I +      E     P A ELL AY  +RGY+    G  DE RAAR
Sbjct: 429 AERIPKYFLEAVYGIHIETRSEEEGGGEHPSAQELLVAYARARGYMTQGFGSADEPRAAR 488

Query: 616 QILKDYVDGKLPHFEMPP 563
            ILKDYV+GKL +   PP
Sbjct: 489 YILKDYVNGKLLYINPPP 506



>gb:CR382129_1662189 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 708

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 2/79 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYV--AASGLPDETRAA 620
           + RVP+  +  VY I +      E     P A+E L AY  +RGY+  A+ G PDE+RAA
Sbjct: 494 SRRVPKYFLESVYGIKIYTRPVDEGGLGYPTATEFLVAYAKARGYMRGASQGNPDESRAA 553

Query: 619 RQILKDYVDGKLPHFEMPP 563
           R +LKDYV+GKL +   PP
Sbjct: 554 RYVLKDYVNGKLLYCHPPP 572



>gb:CR382126_1658646 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 648

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 35/81 (43%), Positives = 45/81 (55%), Gaps = 2/81 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEP-QSRPPLASELLRAYCASRGYVAAS-GLPDETRAA 620
           A RVP+  +  +Y I +      E      P A ELL AY  +RGY+    G  DE+RA+
Sbjct: 434 AERVPKYFLEAIYGIHIQTKSVEEGGNGEVPTAQELLVAYARARGYMTQGFGAADESRAS 493

Query: 619 RQILKDYVDGKLPHFEMPPGM 557
           R ILKDYV+GKL +   PP M
Sbjct: 494 RYILKDYVNGKLLYINPPPHM 514



>gb:CR380956_1652217 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 639

 Score = 56.2 bits (134), Expect = 7e-07
 Identities = 36/83 (43%), Positives = 48/83 (57%), Gaps = 6/83 (7%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKI-----SLPKPKPYEPQSRPPLASELLRAYCASRGYVAAS-GLPDE 632
           A R+P+  +  VY I     S  +    EP++  P A ELL AY  +RGY+    G  DE
Sbjct: 426 AERIPKYYLEAVYGIHIQTRSREESGDIEPEN--PTAQELLVAYARARGYMTQGFGSADE 483

Query: 631 TRAARQILKDYVDGKLPHFEMPP 563
           +RA+R ILKDYV+GKL +   PP
Sbjct: 484 SRASRYILKDYVNGKLLYVNPPP 506



>gb:AF003143_1230857 Caenorhabditis elegans cosmid C53H9, complete
           sequence.
          Length = 506

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 33/78 (42%), Positives = 44/78 (56%)
 Frame = -2

Query: 790 NRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQI 611
           +RVP  VI   Y I LP       + + P A  LL +    RG++A+SG+PD +RAAR +
Sbjct: 340 SRVPVHVIEATYSIMLP-------EMQSPSAINLLNSLAFMRGFMASSGIPDCSRAARLM 392

Query: 610 LKDYVDGKLPHFEMPPGM 557
            KD V GKL     PPG+
Sbjct: 393 FKDVVSGKLIWAAAPPGV 410



>pir|T15221|T15221 hypothetical protein C53H9.2 - Caenorhabditis
           elegans>gb:AF003143_1230858 Caenorhabditis elegans
           cosmid C53H9, complete sequence.
          Length = 385

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 33/78 (42%), Positives = 44/78 (56%)
 Frame = -2

Query: 790 NRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQI 611
           +RVP  VI   Y I LP       + + P A  LL +    RG++A+SG+PD +RAAR +
Sbjct: 219 SRVPVHVIEATYSIMLP-------EMQSPSAINLLNSLAFMRGFMASSGIPDCSRAARLM 271

Query: 610 LKDYVDGKLPHFEMPPGM 557
            KD V GKL     PPG+
Sbjct: 272 FKDVVSGKLIWAAAPPGV 289



>sp|P53145|YGJ9_YEAST Hypothetical GTP-binding protein in SEH1-PRP20
           intergenic region.>pir|S64106|S64106 hypothetical
           protein YGL099w - yeast (Saccharomyces
           cerevisiae)>gb:SCYGL099W_1712021 S.cerevisiae chromosome
           VII reading frame ORF YGL099w.
          Length = 640

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 34/79 (43%), Positives = 44/79 (55%), Gaps = 2/79 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLP-KPKPYEPQSRPPLASELLRAYCASRGYVAAS-GLPDETRAA 620
           A R+P+  I  +Y I +  K +        P A ELL AY  +RGY+    G  DE RA+
Sbjct: 425 AERIPKYYIEAIYGIHIQTKSRDEGGNGDIPTAQELLVAYARARGYMTQGYGSADEPRAS 484

Query: 619 RQILKDYVDGKLPHFEMPP 563
           R ILKDYV+GKL +   PP
Sbjct: 485 RYILKDYVNGKLLYVNPPP 503



>gb:AE017343_1755384 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 743

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 1/78 (1%)
 Frame = -2

Query: 787 RVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAAS-GLPDETRAARQI 611
           R+PR+++   Y I +      E  +      E L AY  +RG   +S G+PD +RAAR +
Sbjct: 491 RIPREILEGTYGIRIDVKDEEEGGTGKVGWEEFLSAYAIARGMTRSSFGMPDTSRAARYV 550

Query: 610 LKDYVDGKLPHFEMPPGM 557
           LKDYV+ KL     PPG+
Sbjct: 551 LKDYVNAKLLFAHPPPGI 568



>gb:CR382135_1667896 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 664

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 33/82 (40%), Positives = 44/82 (53%), Gaps = 2/82 (2%)
 Frame = -2

Query: 790 NRVPRKVIGDVYKISLPKPKPYEPQSRP-PLASELLRAYCASRGYVAAS-GLPDETRAAR 617
           +RVP+  +   Y I +P  K  +  +     A ELL AY  +RG++    G  DE+RA+R
Sbjct: 434 HRVPKFYLEAFYGIHIPIQKVEDGGNGVYASARELLNAYARARGFMTQGFGSADESRASR 493

Query: 616 QILKDYVDGKLPHFEMPPGMPN 551
            ILKDYV GKL     PP   N
Sbjct: 494 YILKDYVSGKLLFVSPPPRKVN 515



>gb:LMFL5213_1388152 Leishmania major Friedlin chromosome 5 cosmid
           L5213.
          Length = 789

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 28/75 (37%), Positives = 39/75 (52%)
 Frame = -2

Query: 787 RVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQIL 608
           R+PR V+     ISL      +      LA  LL A    RGY+A+   P++ RA +++L
Sbjct: 502 RLPRPVLEGELNISLLAEDDIDESDS--LAERLLNALARRRGYMASHDRPNKARAGKELL 559

Query: 607 KDYVDGKLPHFEMPP 563
           K YVDG   + E PP
Sbjct: 560 KLYVDGYFVYVEPPP 574



>gb:AE017344_1756521 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.>gb:AF542530_1810133
           Cryptococcus neoformans var. neoformans strain JEC20
           mating type a locus, complete
           sequence.>gb:AF542531_1810166 Cryptococcus neoformans
           var. neoformans strain JEC21 mating type alpha locus,
           complete sequence.
          Length = 717

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPPGMP 554
           A+ +L A     G +   G PD+  AA+ +L D++ GK+P F  PP  P
Sbjct: 442 ATVILTAIAKKSGKLLKGGEPDQEAAAKMVLNDWIRGKIPFFVAPPSKP 490



>gb:AE016815_1746355 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 502

 Score = 40.8 bits (94), Expect = 0.029
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A+E +      +G +   G PDET  A+Q+L D+  GK+P F  PP
Sbjct: 423 ATEFIEMLARKQGRLLKGGEPDETGVAKQVLNDFNRGKIPWFVSPP 468



>gb:AF542529_1810099 Cryptococcus neoformans var. grubii strain H99
           mating type alpha locus, complete sequence.
          Length = 720

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPPGMP 554
           A+ +L A     G +   G PD+  AA+ +L D++ GK+P F  PP  P
Sbjct: 444 ATFVLTAIAKKSGKLLKGGEPDQEAAAKMVLNDWIRGKVPFFVAPPTKP 492



>gb:AF542528_1810065 Cryptococcus neoformans var. grubii strain
           125.91 mating type a locus, complete sequence.
          Length = 693

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPPGMP 554
           A+ +L A     G +   G PD+  AA+ +L D++ GK+P F  PP  P
Sbjct: 417 ATFVLTAIAKKSGKLLKGGEPDQEAAAKMVLNDWIRGKVPFFVAPPTKP 465



>sp|P53742|YN8U_YEAST Hypothetical GTP-binding protein in POP2-HOL1
           intergenic region.>pir|S63384|S63384 hypothetical
           protein YNR053c - yeast (Saccharomyces
           cerevisiae)>gb:SCYNR053C_1714014 S.cerevisiae chromosome
           XIV reading frame ORF YNR053c.
          Length = 486

 Score = 39.7 bits (91), Expect = 0.066
 Identities = 17/46 (36%), Positives = 27/46 (58%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A+E +      +G +   G PDE+  ++QIL D+  GK+P F +PP
Sbjct: 424 ATEFIEILARKQGRLLKGGEPDESGVSKQILNDFNRGKIPWFVLPP 469



>gb:AY710430_1623954 Cryptococcus gattii strain WM276 MATalpha
           locus, complete sequence.
          Length = 718

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A+ +L A     G +   G PD+  AA+ +L D++ GK+P F  PP
Sbjct: 442 ATVILTAIAKKSGKLLKGGEPDQEAAAKMVLNDWIRGKIPFFVAPP 487



>gb:AY710429_1623919 Cryptococcus gattii strain E566 MATa locus,
           complete sequence.
          Length = 718

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A+ +L A     G +   G PD+  AA+ +L D++ GK+P F  PP
Sbjct: 442 ATVILTAIAKKSGKLLKGGEPDQEAAAKMVLNDWIRGKIPFFVAPP 487



>gb:AY421966_1605139 Cryptococcus gattii strain ATCC 32609 MAT-alpha
           mating locus, fragment III.
          Length = 731

 Score = 39.3 bits (90), Expect = 0.086
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A+ +L A     G +   G PD+  AA+ +L D++ GK+P F  PP
Sbjct: 454 ATVILTAIAKKSGKLLKGGEPDQEAAAKMVLNDWIRGKIPFFVAPP 499



>gb:CR380949_1649555 Candida glabrata strain CBS138 chromosome C
           complete sequence.
          Length = 494

 Score = 38.1 bits (87), Expect = 0.19
 Identities = 16/46 (34%), Positives = 27/46 (58%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A++ +      +G +   G PDE+  ++QIL D+  GK+P F +PP
Sbjct: 424 ATDFIEMLARKQGRLLKGGEPDESGVSKQILNDFNRGKIPWFVIPP 469



>gb:BC087521_2565357 Xenopus laevis hypothetical LOC496093, mRNA
           (cDNA clone IMAGE:7205686), partial cds.
          Length = 569

 Score = 37.7 bits (86), Expect = 0.25
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = -2

Query: 694 ELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           E L      +G +   G PD  +AA+ +L D+V GK+ +F  PP
Sbjct: 361 EFLAMLAKRQGKLKKGGTPDHEKAAKSVLTDWVSGKISYFTHPP 404



>gb:BC078411_2560984 Danio rerio hypothetical protein FLJ10613-like
           (H. sapiens), mRNA (cDNA clone IMAGE:7045022), partial
           cds.
          Length = 571

 Score = 37.7 bits (86), Expect = 0.25
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A E L      +G +   GLPD  +AA+ +L D+  G++ +F  PP
Sbjct: 357 AHEFLALLARRQGKLRKGGLPDSDKAAKSVLMDWTGGRISYFTHPP 402



>gb:AL844847_2504588 Zebrafish DNA sequence from clone DKEY-13A21 in
           linkage group 11 Contains three novel genes, the opn1lw1
           gene for opsin 1 (cone pigments), long-wave-sensitive,
           1, a gene for novel protein similar to human and rodent
           member RAS oncogene family RAB7 (RAB7), a gene for novel
           protein remotely similar to human host cell factor 1
           (VP16-accessory protein) (HCFC1), the opn1sw2 gene for
           opsin 1 (cone pigments), short-wave-sensitive 1, a gene
           for novel protein similar to human and mouse CpG binding
           protein (CGBP), a gene for novel protein similar to
           vertebrate microphthalmia-associated transcription
           factor (MITF) and zebrafish transcription factor binding
           to IGHM enhancer 3a (tfe3a), a gene for novel protein
           similar to human and rodent catechol-O-methyltransferase
           (COMT), the flj10613l gene for hypothetical protein
           FLJ10613-like (H. sapiens), a gene for novel protein
           similar to human and mouse methyl-CpG binding domain
           protein 1 (MBD1), a gene for novel protein similar to
           zebrafish red-sensitive opsin (rdops), a gene for novel
           protein similar to mouse and human host cell factor C1
           (VP16-accessory protein) (HCFC1), a gene for novel
           protein similar to human and rodent metabotropic
           glutamate receptors (GRM) and two CpG islands, complete
           sequence.>gb:AY648737_2541565 Danio rerio FLJ10613-like
           mRNA, complete cds.
          Length = 565

 Score = 37.7 bits (86), Expect = 0.25
 Identities = 16/46 (34%), Positives = 25/46 (54%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A E L      +G +   GLPD  +AA+ +L D+  G++ +F  PP
Sbjct: 351 AHEFLALLARRQGKLRKGGLPDSDKAAKSVLMDWTGGRISYFTHPP 396



>gb:AP003199_1825021 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1045D11.>gb:AP003204_1825102 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1111C09.
          Length = 591

 Score = 37.0 bits (84), Expect = 0.43
 Identities = 16/44 (36%), Positives = 26/44 (59%)
 Frame = -2

Query: 694 ELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           + L+     RG +   G+ D   AAR +L D+ +GK+P+F +PP
Sbjct: 379 DFLQKVATLRGKLKKGGIVDVEAAARIVLHDWNEGKIPYFTVPP 422



>gb:LMFL6071_1388248 Leishmania major Friedlin chromosome 5 cosmid
           L6071, PREFINAL.
          Length = 627

 Score = 37.0 bits (84), Expect = 0.43
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = -2

Query: 694 ELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           + L      RG + A G PD   AAR +L D+  G+LP F  PP
Sbjct: 431 DFLEKLAKLRGKLVAGGEPDVEAAARMLLYDWQRGRLPWFNAPP 474



>gb:CR382132_1666112 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 509

 Score = 36.6 bits (83), Expect = 0.56
 Identities = 18/46 (39%), Positives = 24/46 (52%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           A+E L       G +   G PDE+  A+ IL D+  GK+P F  PP
Sbjct: 416 ATEFLEKIARKHGRLLKGGEPDESGIAKLILNDFNRGKIPWFVPPP 461



>gb:AY054687_1563341 Arabidopsis thaliana putative GTPase
           (At3g07050; F17A9.21) mRNA, partial cds.
          Length = 497

 Score = 36.6 bits (83), Expect = 0.56
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -2

Query: 667 RGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           RG +   GL D   AAR +L D+ +GK+P++ MPP
Sbjct: 339 RGKLKKGGLVDIDAAARIVLHDWNEGKIPYYTMPP 373



>gb:ATAC016827_1543630 Arabidopsis thaliana chromosome III BAC F17A9
           genomic sequence, complete sequence.
          Length = 582

 Score = 36.6 bits (83), Expect = 0.56
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = -2

Query: 667 RGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           RG +   GL D   AAR +L D+ +GK+P++ MPP
Sbjct: 373 RGKLKKGGLVDIDAAARIVLHDWNEGKIPYYTMPP 407



>gb:AC019018_1538504 Arabidopsis thaliana chromosome 1 BAC F14G24
           genomic sequence, complete sequence.
          Length = 576

 Score = 35.8 bits (81), Expect = 0.95
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = -2

Query: 694 ELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPPGMPN 551
           + L   C S G +   G PD    A+ IL D+  G++P F  PP + N
Sbjct: 419 DFLLQLCKSSGKLLKGGEPDLMTGAKMILHDWQRGRIPFFVPPPKLDN 466



>pir|T39037|T39037 hypothetical gtp-binding protein associated -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC6F6_1718275 S.pombe chromosome I cosmid
           c6F6.
          Length = 537

 Score = 35.8 bits (81), Expect = 0.95
 Identities = 16/48 (33%), Positives = 25/48 (52%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPPGM 557
           ++E L       G +   G PDE   A+ +L D++ GK+P F  P G+
Sbjct: 419 STEFLAKLAKKGGRLLKGGEPDEASVAKMVLNDFMRGKIPWFIGPKGL 466



>gb:CR382137_1669593 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 264

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 15/53 (28%), Positives = 27/53 (50%)
 Frame = -2

Query: 721 PQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           P+     +++ +       G +   G PDE+  ++Q+L D+  GK+P F  PP
Sbjct: 158 PELLETASTQFIELIARKGGRLLKGGEPDESGVSKQVLNDFNRGKIPWFVPPP 210



>gb:CR382123_1656303 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 513

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -2

Query: 694 ELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           + +      +G +   G PDE+  ++QIL D+  GK+P F  PP
Sbjct: 425 DFIEMIARKQGRLLKGGEPDESGVSKQILNDFNRGKIPWFVPPP 468



>sp|Q58859|YE64_METJA Hypothetical GTP-binding protein
           MJ1464.>pir|G64482|G64482 hypothetical GTP-binding
           protein homolog - Methanococcus
           jannaschii>gb:U67587_207579 Methanocaldococcus
           jannaschii DSM 2661 section 129 of 150 of the complete
           genome.>gb:L77117_1100337 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 373

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 16/42 (38%), Positives = 25/42 (59%)
 Frame = -2

Query: 694 ELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEM 569
           ELL+     R Y+   G  D  R A+ I+K+Y DGKL ++++
Sbjct: 221 ELLKKIGNKRSYLTKGGEVDLVRTAKTIIKEYQDGKLNYYKV 262



>gb:BC010298_2090942 Mus musculus guanine nucleotide binding
           protein, related sequence 1, mRNA (cDNA clone MGC:11530
           IMAGE:3155411), complete cds.
          Length = 607

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 448 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 502

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 503 NSLLRLAVDGRLSLCFYPPG 522



>gb:BC042350_2548158 Xenopus laevis nucleolar GTPase, mRNA (cDNA
           clone MGC:52791 IMAGE:4724672), complete cds.
          Length = 707

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = -2

Query: 664 GYVAASGLPDETRAARQILKDYVDGKLPHFEMPPGMPN 551
           G +   G PD    ++ +L D+  G++P F  PP  PN
Sbjct: 430 GKLLKGGEPDRQTVSKMVLNDWQRGRIPFFVKPPNAPN 467



>gb:BT008065_2150997 Synthetic construct Homo sapiens guanine
           nucleotide binding protein-like 1 mRNA, partial cds.
          Length = 608

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 448 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 502

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 503 NSLLRLAVDGRLSLCFHPPG 522



>gb:BC063657_1986315 Homo sapiens guanine nucleotide binding
           protein-like 1, mRNA (cDNA clone IMAGE:5115128), partial
           cds.
          Length = 481

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 322 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 376

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 377 NSLLRLAVDGRLSLCFHPPG 396



>gb:BA000041_1966278 Pan troglodytes DNA, major histocompatibility
           complex class I region.
          Length = 421

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 262 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 316

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 317 NSLLRLAVDGRLSLCFHPPG 336



>gb:BA000025_1966193 Homo sapiens genomic DNA, chromosome 6p21.3,
           HLA Class I region.
          Length = 421

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 262 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 316

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 317 NSLLRLAVDGRLSLCFHPPG 336



>gb:AL662800_1931461 Human DNA sequence from clone XXbac-249D20 on
           chromosome 6 contains the GNL1 gene for guanine
           nucleotide binding protein-like 1, the gene for CAT56
           protein, the ABCF1 gene for ATP-binding cassette,
           subfamily F, member 1, the PPP1R10 gene for protein
           phosphatase 1, regulatory subunit 10, the MRPS18B gene
           for mitochondrial ribosomal protein S18B, two novel
           proteins, a prothymosin alpha (PTMA) pseudogene and four
           CpG islands, complete sequence.>gb:AL662825_1931569
           Human DNA sequence from clone XXbac-98J21 on chromosome
           6 contains the GNL1 gene for guanine nucleotide binding
           protein-like 1, the gene for CAT56 protein, the ABCF1
           gene for ATP-binding cassette, subfamily F, member 1,
           the PPP1R10 gene for protein phosphatase 1, regulatory
           subunit 10, the 5' end of the MRPS18B gene for
           mitochondrial ribosomal protein S18B and three CpG
           islands, complete sequence.>gb:BC013959_1974283 Homo
           sapiens guanine nucleotide binding protein-like 1, mRNA
           (cDNA clone MGC:4131 IMAGE:2961417), complete
           cds.>gb:BC018366_1976496 Homo sapiens guanine nucleotide
           binding protein-like 1, mRNA (cDNA clone MGC:9650
           IMAGE:3924808), complete cds.>gb:BT006648_1990086 Homo
           sapiens guanine nucleotide binding protein-like 1 mRNA,
           complete cds.>gb:BX000357_1991431 Human DNA sequence
           from clone DAQB-256B5 on chromosome 6, complete
           sequence.
          Length = 607

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 448 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 502

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 503 NSLLRLAVDGRLSLCFHPPG 522



>gb:AB128049_1873976 Macaca mulatta genes, MHC class I region,
           partial and complete cds.
          Length = 607

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 448 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 502

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 503 NSLLRLAVDGRLSLCFHPPG 522



>gb:AB088095_1872106 Homo sapiens CAT56, HSR1 genes for proline rich
           protein, guanine nucleotide binding protein-like 1,
           complete cds.
          Length = 374

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 262 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 316

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 317 NSLLRLAVDGRLSLCFHPPG 336



>gb:CR859219_1183348 Pongo pygmaeus mRNA; cDNA DKFZp459M2138 (from
           clone DKFZp459M2138).
          Length = 607

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 448 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 502

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG+L     PPG
Sbjct: 503 NSLLRLAVDGRLSLCFHPPG 522



>gb:AE017343_1755357 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 669

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = -2

Query: 667 RGYVAASGLPDETRAARQILKDYVDGKLPHFEMPP 563
           RG +   G+PD   +A Q+L+D+  GK+ ++  PP
Sbjct: 354 RGRLGKGGVPDLEASAVQVLRDWNSGKISYYTTPP 388



>gb:AE014187_938687 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014819_1227763 Plasmodium falciparum 3D7
           chromosome 14 section 4 of 13 of the complete sequence.
          Length = 487

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 14/45 (31%), Positives = 23/45 (51%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMP 566
           + E L       G +   G PD T  ++ I+ D++ GK+P+F  P
Sbjct: 420 SEEFLEILAKKMGKLLKGGEPDITSVSKVIINDWIKGKIPYFVNP 464



>pir|G90204|G90204 GTP binding protein, hypothetical [imported] -
           Sulfolobus solfataricus>gb:SSU18930_191346 Sulfolobus
           solfataricus 281 kb genomic DNA fragment, strain
           P2.>gb:AE006688_221492 Sulfolobus solfataricus P2
           section 47 of 272 of the complete
           genome.>gb:AE006641_1107340 Sulfolobus solfataricus P2,
           complete genome.
          Length = 267

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = -2

Query: 694 ELLRAYCASRGYVAASGL-PDETRAARQILKDYVDGKLPHFEMPPGM 557
           ELL      RG+   S   P+   AAR +++DY +GK+ ++ +PP +
Sbjct: 212 ELLERIAIRRGWFYKSTKEPNIDMAARAVIRDYHEGKIAYYTLPPSL 258



>gb:AB158488_1410964 Sus scrofa TRIM39, FLJ22638, GNL1, CAT56 genes,
           SLA-11 pseudogene, complete cds.
          Length = 607

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 448 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 502

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  +DG+L     PPG
Sbjct: 503 NSLLRLALDGRLSLCFHPPG 522



>gb:AE013599_1132447 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003802_1225193 Drosophila melanogaster
           chromosome 2R, section 48 of 74 of the complete
           sequence.>gb:AF315579_1261786 Drosophila melanogaster
           nuclear GTP binding protein mRNA, complete
           cds.>gb:AY089700_1297356 Drosophila melanogaster SD10213
           full insert cDNA.
          Length = 674

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = -2

Query: 700 ASELLRAYCASRGYVAASGLPDETRAARQILKDYVDGKLPHFEMPPG 560
           ++  L       G +   G PD T  AR +L D+  GKLP +  P G
Sbjct: 423 STHFLEQLAQKTGKLLKGGEPDVTVTARMVLNDWQRGKLPFYVPPEG 469



>sp|P36915|GNL1_HUMAN Guanine nucleotide-binding protein-like 1
           (GTP-binding protein HSR1).>pir|I57013|I57013 guanine
           nucleotide binding protein-like 1 -
           human>gb:HUMHSPR_2032218 Human GTP-binding protein
           (HSR1) mRNA, complete cds.
          Length = 430

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 2/80 (2%)
 Frame = -2

Query: 793 ANRVPRKVIGDVYKISLPKPKPYEPQSRPP-LASELLRAYCASRGYVAASGLPDET-RAA 620
           A+R+P + +     + L  P+  +P +  P  A ++  A+   RGY  A    ++  RAA
Sbjct: 271 ASRIPVQAL-----LHLRHPEAEDPSAEHPWCAWDICEAWAEKRGYKTAKAARNDVYRAA 325

Query: 619 RQILKDYVDGKLPHFEMPPG 560
             +L+  VDG++     PPG
Sbjct: 326 NSLLRLAVDGRVSLCFHPPG 345


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 744,007,145
Number of Sequences: 1806583
Number of extensions: 13642248
Number of successful extensions: 32098
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 30910
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32062
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51335108558
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)