BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12723
         (1141 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP001313_1821174 Arabidopsis thaliana genomic DNA, chromosome...   203   5e-51   
gb:BT002833_1636426 Arabidopsis thaliana clone RAFL14-83-O12 (R2...   203   5e-51   
gb:AB006708_1510054 Arabidopsis thaliana genomic DNA, chromosome...   201   2e-50   
gb:AP004161_1838407 Oryza sativa (japonica cultivar-group) genom...   201   2e-50   
gb:AP003725_1832472 Oryza sativa (japonica cultivar-group) genom...   201   3e-50   
gb:AP005967_1860391 Oryza sativa (japonica cultivar-group) genom...   195   1e-48   
pir|T00822|T00822 hypothetical protein At2g41660 [imported] - Ar...   177   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AY087440_1572471 Arabidopsis thaliana clone 35456 mRNA, compl...   174   2e-42   
gb:AY088867_1573875 Arabidopsis thaliana clone 97747 mRNA, compl...   163   5e-39   
pir|T09377|T09377 hypothetical protein F23K16.240 - Arabidopsis ...   163   5e-39   Arabidopsis thaliana [mouse-ear cress]
pir|F84607|F84607 hypothetical protein At2g21990 [imported] - Ar...   158   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AB010697_1511201 Arabidopsis thaliana genomic DNA, chromosome...   153   5e-36   
gb:AP004154_1838286 Oryza sativa (japonica cultivar-group) genom...   144   3e-33   
gb:AB007647_1510177 Arabidopsis thaliana genomic DNA, chromosome...   143   6e-33   
gb:AP003073_1824544 Oryza sativa (japonica cultivar-group) genom...   143   7e-33   
gb:AC137507_1743425 Oryza sativa chromosome 3 BAC OSJNBb0033J23 ...   139   1e-31   
gb:AP005755_1857278 Oryza sativa (japonica cultivar-group) genom...   138   2e-31   
gb:AP005606_1854795 Oryza sativa (japonica cultivar-group) genom...   132   1e-29   
gb:OSJN00094_1694794 Oryza sativa genomic DNA, chromosome 4, BAC...   129   8e-29   
gb:AY087127_1572162 Arabidopsis thaliana clone 3200 mRNA, comple...   126   7e-28   
pir|D86343|D86343 protein T22I11.13 [imported] - Arabidopsis tha...   126   7e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AY648319_1619997 Arabidopsis thaliana hypothetical protein (A...   123   6e-27   
pir|C96794|C96794 hypothetical protein F14G6.21 [imported] - Ara...   123   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AP000969_1820698 Oryza sativa (japonica cultivar-group) genom...   122   1e-26   
gb:AY087400_1572431 Arabidopsis thaliana clone 34976 mRNA, compl...   122   2e-26   
pir|C84798|C84798 hypothetical protein At2g37880 [imported] - Ar...   122   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AB011479_1511437 Arabidopsis thaliana genomic DNA, chromosome...   121   3e-26   
gb:AY231426_1591614 Arabidopsis thaliana hypothetical protein (A...   118   3e-25   
pir|H84612|H84612 hypothetical protein At2g22460 [imported] - Ar...   118   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AC130609_1740861 Oryza sativa (japonica cultivar-group) chrom...   113   6e-24   
gb:AC096689_1736288 Oryza sativa chromosome 3 BAC OSJNBa0027J18 ...    81   3e-14   
gb:AP004161_1838408 Oryza sativa (japonica cultivar-group) genom...    47   0.001   
gb:AP006840_568586 Symbiobacterium thermophilum DNA, complete ge...    38   0.081   
gb:AE009843_256401 Pyrobaculum aerophilum strain IM2 section 98 ...    33   8.2     


>gb:AP001313_1821174 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone:T5M7.
          Length = 293

 Score =  203 bits (517), Expect = 5e-51
 Identities = 113/193 (58%), Positives = 134/193 (69%), Gaps = 9/193 (4%)
 Frame = -3

Query: 893 RRKTAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTG 714
           ++K  + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT 
Sbjct: 101 KKKKTLEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTS 159

Query: 713 VLVREMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGP 534
           VLVREMASG VRIALE                 KLLEE  WRTYCNG+KCG+AAR+ECG 
Sbjct: 160 VLVREMASGLVRIALETAA-------YKTDSKKKLLEESTWRTYCNGKKCGYAARKECGE 212

Query: 533 DDWRVLNSIGPITMGAGVLPGK----EDDGIG----PDGELMYMRAKYERVVGSRDSEAF 378
            +W+VL ++GPITMGAGVLP      +++G G      GELMYMRA++ERVVGSRDSEAF
Sbjct: 213 AEWKVLKAVGPITMGAGVLPATTTTVDEEGNGAVGSEKGELMYMRARFERVVGSRDSEAF 272

Query: 377 YMMSPD-GHGGPE 342
           YMM+PD   GGPE
Sbjct: 273 YMMNPDVSSGGPE 285



>gb:BT002833_1636426 Arabidopsis thaliana clone RAFL14-83-O12
           (R20241) unknown protein (At3g25640) mRNA, complete
           cds.>gb:BT015122_1642092 Arabidopsis thaliana At3g25640
           gene, complete cds.
          Length = 267

 Score =  203 bits (517), Expect = 5e-51
 Identities = 113/193 (58%), Positives = 134/193 (69%), Gaps = 9/193 (4%)
 Frame = -3

Query: 893 RRKTAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTG 714
           ++K  + K+R AL F   S LG RVVGTLFG RRG V+FA Q+DP   PA L++L  PT 
Sbjct: 75  KKKKTLEKIRYALGFS-NSGLGFRVVGTLFGNRRGHVYFAVQDDPTRLPAVLIQLPTPTS 133

Query: 713 VLVREMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGP 534
           VLVREMASG VRIALE                 KLLEE  WRTYCNG+KCG+AAR+ECG 
Sbjct: 134 VLVREMASGLVRIALETAA-------YKTDSKKKLLEESTWRTYCNGKKCGYAARKECGE 186

Query: 533 DDWRVLNSIGPITMGAGVLPGK----EDDGIG----PDGELMYMRAKYERVVGSRDSEAF 378
            +W+VL ++GPITMGAGVLP      +++G G      GELMYMRA++ERVVGSRDSEAF
Sbjct: 187 AEWKVLKAVGPITMGAGVLPATTTTVDEEGNGAVGSEKGELMYMRARFERVVGSRDSEAF 246

Query: 377 YMMSPD-GHGGPE 342
           YMM+PD   GGPE
Sbjct: 247 YMMNPDVSSGGPE 259



>gb:AB006708_1510054 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MYJ24.>gb:BT010427_1640373 Arabidopsis thaliana
           At5g23100 mRNA, complete cds.
          Length = 277

 Score =  201 bits (512), Expect = 2e-50
 Identities = 109/207 (52%), Positives = 133/207 (64%), Gaps = 27/207 (13%)
 Frame = -3

Query: 881 AVSKLRSALTF-------GIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM 723
           AVS+LRS +            S LG+RVVGTLFG RRG VHF+ Q+DP   PAFL+ELA 
Sbjct: 63  AVSRLRSVIATLSRARPGNQNSGLGSRVVGTLFGSRRGHVHFSIQKDPNSPPAFLIELAT 122

Query: 722 PTGVLVREMASGPVRIALECE------------------GNTNTWEXXXXXXXXKLLEEP 597
           P   LV+EMASG VRIALEC+                  G   T          +L+EEP
Sbjct: 123 PISGLVKEMASGLVRIALECDKGKEEEEGEEKNGTLRHGGGDKTKTTTTAAVSRRLVEEP 182

Query: 596 AWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKED--DGIGPDGELMYMR 423
            WRTYCNG+KCGFA RRECG  + +VL ++  ++MGAGVLP  E+   G G  G++MYMR
Sbjct: 183 MWRTYCNGKKCGFATRRECGEKEKKVLKALEMVSMGAGVLPETEEIGGGGGGGGDIMYMR 242

Query: 422 AKYERVVGSRDSEAFYMMSPDGHGGPE 342
           AK+ER+VGSRDSEAFYMM+PD +G PE
Sbjct: 243 AKFERIVGSRDSEAFYMMNPDSNGAPE 269



>gb:AP004161_1838407 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1311_H06.
          Length = 290

 Score =  201 bits (511), Expect = 2e-50
 Identities = 110/195 (56%), Positives = 133/195 (68%), Gaps = 11/195 (5%)
 Frame = -3

Query: 893 RRKTAVSKLRSALTFGI-----KSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVEL 729
           +R  A+++LR+A    I     +  LG+ + GT+FG RRGRVH A Q D R  P  LVE+
Sbjct: 96  KRADALARLRAAFLAAITHRRRRRQLGSSLTGTIFGRRRGRVHVALQTDTRSPPVLLVEM 155

Query: 728 AM-PTGVLVREMASGPVRIALECEGNT-NTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFA 555
           A   TG LVREM+SG VR+ALECE    N  E         LLEEP WR YCNGRKCGFA
Sbjct: 156 AAYSTGALVREMSSGLVRLALECEKQPINPGEKRRA-----LLEEPTWRAYCNGRKCGFA 210

Query: 554 ARRECGPDDWRVLNSIGPITMGAGVLPGKEDD----GIGPDGELMYMRAKYERVVGSRDS 387
            RRECG D+WRVL ++ P+++GAGVLP   DD        +G+LMYMRA++ERVVGSRDS
Sbjct: 211 VRRECGADEWRVLGAVEPVSVGAGVLP---DDAAAAAAAEEGDLMYMRARFERVVGSRDS 267

Query: 386 EAFYMMSPDGHGGPE 342
           EAFYMM+PDG GGPE
Sbjct: 268 EAFYMMNPDGSGGPE 282



>gb:AP003725_1832472 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0510C12.>gb:AP003855_1834358 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0039G05.
          Length = 307

 Score =  201 bits (510), Expect = 3e-50
 Identities = 110/211 (52%), Positives = 135/211 (63%), Gaps = 29/211 (13%)
 Frame = -3

Query: 887 KTAVSKLRSALTFGIKSP-----LGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAM 723
           +TAVS+LR+AL   +        LGAR+ GTL+G RRG VH AFQ DPR  PA L+ELA 
Sbjct: 92  RTAVSRLRTALAAALAGRHRQVGLGARLTGTLYGHRRGHVHLAFQVDPRACPALLLELAA 151

Query: 722 PTGVLVREMASGPVRIALECE-----------------GNTNTWEXXXXXXXXKLLEEPA 594
           PT  LVREMASG VRIALECE                  ++++          KL+EE  
Sbjct: 152 PTASLVREMASGLVRIALECERAKGGGACAFPTAAAAPSSSSSSSSSSSAGGRKLVEETV 211

Query: 593 WRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAKY 414
           WR YCNGR CG+A RRECG  DWRVL ++ P++MGAGV+P     G   +G++MYMRA++
Sbjct: 212 WRAYCNGRSCGYAVRRECGAADWRVLRALEPVSMGAGVIPAACGGG---EGDVMYMRARF 268

Query: 413 ERVVGSRDSEAFYMMSPD-------GHGGPE 342
           ERVVGSRDSEAFYMM+PD        +GGPE
Sbjct: 269 ERVVGSRDSEAFYMMNPDCGGSGSNNNGGPE 299



>gb:AP005967_1860391 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:B1089G05.
          Length = 305

 Score =  195 bits (496), Expect = 1e-48
 Identities = 100/169 (59%), Positives = 122/169 (72%), Gaps = 3/169 (1%)
 Frame = -3

Query: 839 SPLGARVV-GTLFGFRRGRVHFAFQEDPRLGPAFLVELA-MPTGVLVREMASGPVRIALE 666
           S   ARV+ GT+FG  RGRVH A Q DPR  PA ++ELA   TG LVREMASG VR+ALE
Sbjct: 131 SSASARVLTGTVFGRLRGRVHLALQTDPRAAPAMMLELAGYSTGALVREMASGLVRLALE 190

Query: 665 CEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGA 486
           CE                L+EE  WR YCNGRKCG+A RRECG ++WRVL ++ P+T+GA
Sbjct: 191 CEKAAPPTNPGEKRRRAALMEETTWRAYCNGRKCGYAVRRECGAEEWRVLRAVEPVTVGA 250

Query: 485 GVLPGKEDDGI-GPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
           GVLP  +  G+ G +G++MYMRA++ERVVGSRDSEAFYM+SPDG+ GPE
Sbjct: 251 GVLP--DGGGVAGGEGDMMYMRARFERVVGSRDSEAFYMVSPDGNAGPE 297



>pir|T00822|T00822 hypothetical protein At2g41660 [imported] -
           Arabidopsis thaliana>gb:AC002510_1530790 Arabidopsis
           thaliana chromosome 2 clone T32G6 map CIC11C08, complete
           sequence.>gb:AF345340_1789919 Arabidopsis thaliana
           T32G6.18/At2g41660 mRNA, complete cds.
          Length = 297

 Score =  177 bits (448), Expect = 5e-43
 Identities = 99/190 (52%), Positives = 124/190 (65%), Gaps = 9/190 (4%)
 Frame = -3

Query: 884 TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV 705
           ++VS    +L  G  S LG RV GTL+G +RG V F+ Q + R  P  L++LAM T  LV
Sbjct: 108 SSVSNQLISLVTGGSSSLGRRVTGTLYGHKRGHVTFSVQYNQRSDPVLLLDLAMSTATLV 167

Query: 704 REMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARR--ECGPD 531
           +EM+SG VRIALECE    +          KL +EP W  YCNGRKCG+A  R   C   
Sbjct: 168 KEMSSGLVRIALECEKRHRS--------GTKLFQEPKWTMYCNGRKCGYAVSRGGACTDT 219

Query: 530 DWRVLNSIGPITMGAGVLPGKE--DD--GIGPD---GELMYMRAKYERVVGSRDSEAFYM 372
           DWRVLN++  +T+GAGV+P  +  DD  G+G     GEL+YMR K+ERVVGSRDSEAFYM
Sbjct: 220 DWRVLNTVSRVTVGAGVIPTPKTIDDVSGVGSGTELGELLYMRGKFERVVGSRDSEAFYM 279

Query: 371 MSPDGHGGPE 342
           M+PD +GGPE
Sbjct: 280 MNPDKNGGPE 289



>gb:AY087440_1572471 Arabidopsis thaliana clone 35456 mRNA, complete
           sequence.
          Length = 297

 Score =  174 bits (442), Expect = 2e-42
 Identities = 98/190 (51%), Positives = 123/190 (64%), Gaps = 9/190 (4%)
 Frame = -3

Query: 884 TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLV 705
           ++VS    +L  G  S LG RV GTL+G +RG V F+ Q +    P  L++LAM T  LV
Sbjct: 108 SSVSNQLISLVTGGSSSLGRRVTGTLYGHKRGHVTFSVQYNQSSDPVLLLDLAMSTATLV 167

Query: 704 REMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARR--ECGPD 531
           +EM+SG VRIALECE    +          KL +EP W  YCNGRKCG+A  R   C   
Sbjct: 168 KEMSSGLVRIALECEKRHRS--------GTKLFQEPKWTMYCNGRKCGYAVSRGGACTDT 219

Query: 530 DWRVLNSIGPITMGAGVLPGKE--DD--GIGPD---GELMYMRAKYERVVGSRDSEAFYM 372
           DWRVLN++  +T+GAGV+P  +  DD  G+G     GEL+YMR K+ERVVGSRDSEAFYM
Sbjct: 220 DWRVLNTVSRVTVGAGVIPTPKTIDDVSGVGSGTELGELLYMRGKFERVVGSRDSEAFYM 279

Query: 371 MSPDGHGGPE 342
           M+PD +GGPE
Sbjct: 280 MNPDKNGGPE 289



>gb:AY088867_1573875 Arabidopsis thaliana clone 97747 mRNA, complete
           sequence.
          Length = 257

 Score =  163 bits (413), Expect = 5e-39
 Identities = 81/167 (48%), Positives = 111/167 (66%), Gaps = 5/167 (2%)
 Frame = -3

Query: 827 ARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE---- 660
           +R+ GTLFG+R+GRV  + QE+P+  P+ +VELAM T  L +E+++G VRIALE E    
Sbjct: 88  SRITGTLFGYRKGRVSLSIQENPKCLPSLVVELAMQTTTLQKELSTGMVRIALETEKQPR 147

Query: 659 -GNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAG 483
             N N+           +LEEP W  YC G K G+  +RE   +D  V+  + P++MGAG
Sbjct: 148 ADNNNS----KTEKKTDILEEPLWTMYCKGEKTGYGVKREATEEDLNVMELLRPVSMGAG 203

Query: 482 VLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
           VLPG  +   GPDGE+ YMRA +ERV+GS+DSE FYM+SP+G+ GPE
Sbjct: 204 VLPGNSESE-GPDGEMAYMRAYFERVIGSKDSETFYMLSPEGNNGPE 249



>pir|T09377|T09377 hypothetical protein F23K16.240 - Arabidopsis
           thaliana>gb:ATCHRIV91_1547945 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           91.>gb:ATF23K16_1549786 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23K16 (ESSA
           project).>gb:BT005270_1638210 Arabidopsis thaliana
           At4g39610 mRNA, complete cds.>gb:AK118419_1816397
           Arabidopsis thaliana At4g39610 mRNA for unknown protein,
           complete cds, clone: RAFL19-67-C18.
          Length = 264

 Score =  163 bits (413), Expect = 5e-39
 Identities = 81/167 (48%), Positives = 111/167 (66%), Gaps = 5/167 (2%)
 Frame = -3

Query: 827 ARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECE---- 660
           +R+ GTLFG+R+GRV  + QE+P+  P+ +VELAM T  L +E+++G VRIALE E    
Sbjct: 95  SRITGTLFGYRKGRVSLSIQENPKCLPSLVVELAMQTTTLQKELSTGMVRIALETEKQPR 154

Query: 659 -GNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAG 483
             N N+           +LEEP W  YC G K G+  +RE   +D  V+  + P++MGAG
Sbjct: 155 ADNNNS----KTEKKTDILEEPLWTMYCKGEKTGYGVKREATEEDLNVMELLRPVSMGAG 210

Query: 482 VLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
           VLPG  +   GPDGE+ YMRA +ERV+GS+DSE FYM+SP+G+ GPE
Sbjct: 211 VLPGNSESE-GPDGEMAYMRAYFERVIGSKDSETFYMLSPEGNNGPE 256



>pir|F84607|F84607 hypothetical protein At2g21990 [imported] -
           Arabidopsis thaliana>gb:AC007019_1535022 Arabidopsis
           thaliana chromosome 2 clone F7D8 map mi238, complete
           sequence.>gb:AY219047_1590257 Arabidopsis thaliana
           hypothetical protein (At2g21990/F7D8.31) mRNA, complete
           cds.>gb:AY649268_1620068 Arabidopsis thaliana
           hypothetical protein (At2g21990) gene, complete cds.
          Length = 252

 Score =  158 bits (399), Expect = 2e-37
 Identities = 80/163 (49%), Positives = 110/163 (67%)
 Frame = -3

Query: 830 GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT 651
           G+RV GTLFG+R+GRV  + QE PR  P+ +VELAM T VL +E++ G VRIALE E   
Sbjct: 90  GSRVTGTLFGYRKGRVSLSIQESPRCLPSLVVELAMQTMVLQKELSGGMVRIALETEKRG 149

Query: 650 NTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG 471
           +           K+++EP W  + NG+K G+  +R+   +D  V+  + P++MGAGVLPG
Sbjct: 150 D-------KEKIKIMDEPLWTMFSNGKKTGYGVKRDATEEDLNVMELLRPVSMGAGVLPG 202

Query: 470 KEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
             +   GPD E+ YMRA +ERVVGS+DSE FYM+SP+G+ GPE
Sbjct: 203 NTEFE-GPDSEMAYMRAYFERVVGSKDSETFYMLSPEGNNGPE 244



>gb:AB010697_1511201 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MOJ9.
          Length = 261

 Score =  153 bits (387), Expect = 5e-36
 Identities = 81/172 (47%), Positives = 111/172 (64%), Gaps = 9/172 (5%)
 Frame = -3

Query: 830 GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNT 651
           G RV GTLFG+R+ RV+ A QE+PR  P  L+ELA+PTG L++++  G VRIALECE   
Sbjct: 90  GTRVTGTLFGYRKTRVNLAVQENPRSLPILLLELAIPTGKLLQDLGVGLVRIALECEKKP 149

Query: 650 NTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPG 471
           +           K+++EP W  YCNG+K G+  +R+   +D  V+  +  ++MGAGVLP 
Sbjct: 150 S--------EKTKIIDEPIWALYCNGKKSGYGVKRQPTEEDLVVMQMLHAVSMGAGVLPV 201

Query: 470 K-----EDDGIG----PDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
                 E  G G     +G+L YMRA +ERV+GSRDSE +YMM+PDG+ GPE
Sbjct: 202 SSGAITEQSGGGGGGQQEGDLTYMRAHFERVIGSRDSETYYMMNPDGNSGPE 253



>gb:AP004154_1838286 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1111_E05.
          Length = 254

 Score =  144 bits (364), Expect = 3e-33
 Identities = 81/155 (52%), Positives = 100/155 (64%), Gaps = 4/155 (2%)
 Frame = -3

Query: 812 TLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNTNTWEXX 633
           TLFG RRGR+  A  ED R  PAFL+EL M    + REMA+G V++ALE +  +      
Sbjct: 82  TLFGHRRGRLSLAIHEDTRAPPAFLIELPMLASAMHREMATGTVKLALESDTRS------ 135

Query: 632 XXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWR-VLNSIGPITMGAGVLPGKEDD- 459
                 +LLEE  W  +CNGRK G+A RR+   DD R VL  +  ++MGAGVLP    D 
Sbjct: 136 ---ARRRLLEEYVWAVFCNGRKAGYAIRRKDASDDDRHVLRLLRGVSMGAGVLPPPPADR 192

Query: 458 --GIGPDGELMYMRAKYERVVGSRDSEAFYMMSPD 360
             G GPDGEL YMRA+ ERVVGS+DSEAFYM++PD
Sbjct: 193 RGGAGPDGELTYMRARVERVVGSKDSEAFYMINPD 227



>gb:AB007647_1510177 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJB21.>gb:BT014788_1641778 Arabidopsis thaliana
           At5g42680 gene, complete cds.>gb:BT015690_1642308
           Arabidopsis thaliana At5g42680 mRNA, complete cds.
          Length = 238

 Score =  143 bits (361), Expect = 6e-33
 Identities = 79/177 (44%), Positives = 112/177 (63%), Gaps = 3/177 (1%)
 Frame = -3

Query: 872 KLRSALTFGIKSPL--GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE 699
           K+ + L+ G + PL       GT+FGFR+GRV  A QEDP   P F++EL M T  L +E
Sbjct: 58  KMVNLLSRGHRRPLLKDYATTGTIFGFRKGRVFLAIQEDPHCLPIFIIELPMLTSALQKE 117

Query: 698 MASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRE-CGPDDWR 522
           MAS  VRIALE E  T+  +         +LEE  W  YCNGRK G++ RR+    ++  
Sbjct: 118 MASETVRIALESETKTSRKK---------VLEEYVWGIYCNGRKIGYSIRRKNMSEEEMY 168

Query: 521 VLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHG 351
           V++++  ++MGAGVLP K       +GE+ YMRA+++RV+GS+DSEA YM++P+G G
Sbjct: 169 VIDALRGVSMGAGVLPCKNQYDQETEGEMTYMRARFDRVIGSKDSEALYMINPEGSG 225



>gb:AP003073_1824544 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0702B09.
          Length = 294

 Score =  143 bits (360), Expect = 7e-33
 Identities = 77/167 (46%), Positives = 103/167 (61%), Gaps = 5/167 (2%)
 Frame = -3

Query: 827 ARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNTN 648
           +R  GTLFG+R+ RV  A QE P   P  L+ELAM TG  ++EM +  +R+ALECE    
Sbjct: 122 SRTTGTLFGYRKARVTLAVQETPGSVPILLLELAMQTGRFMQEMGAEHLRVALECEKKPP 181

Query: 647 TWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP-- 474
                      +LL+EP W  Y NGRK G+A RRE    D  V+  +  +++GAGVLP  
Sbjct: 182 G--AGAGIGRTRLLDEPLWTAYVNGRKIGYAMRREPTEGDLTVMQLLRTVSVGAGVLPTD 239

Query: 473 ---GKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
              G     +   G+L YMRA+++RVVGSRDSE+FYM++PDG+ GPE
Sbjct: 240 VMGGDAGAEVQDAGDLAYMRARFDRVVGSRDSESFYMLNPDGNNGPE 286



>gb:AC137507_1743425 Oryza sativa chromosome 3 BAC OSJNBb0033J23
           genomic sequence, complete sequence.
          Length = 316

 Score =  139 bits (350), Expect = 1e-31
 Identities = 75/167 (44%), Positives = 101/167 (60%), Gaps = 6/167 (3%)
 Frame = -3

Query: 830 GARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGP--VRIALECEG 657
           GARV GT +G RR R+  A QE P   P+ ++EL +PT  L++E+++G   VR+ALECE 
Sbjct: 134 GARVTGTFYGHRRARITLAVQERPGSLPSLVLELGVPTAKLMQEISTGGGHVRVALECEK 193

Query: 656 NTNTWEXXX-XXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGV 480
                           LLEE  W  Y NGR+ G+A RRE    D  V+  +  +++GAGV
Sbjct: 194 RPKKLPSAPPEQASVSLLEEAMWTAYVNGRRVGYAVRREASEGDLAVMQLLSTVSVGAGV 253

Query: 479 LPG---KEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGG 348
           LPG    E  G   DGE+ YMRA ++RV GS+DSE+FYM++PDG  G
Sbjct: 254 LPGDVLAEPAGAEGDGEVTYMRAGFDRVAGSKDSESFYMVNPDGDAG 300



>gb:AP005755_1857278 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBb0019B14.
          Length = 244

 Score =  138 bits (348), Expect = 2e-31
 Identities = 78/159 (49%), Positives = 103/159 (64%), Gaps = 5/159 (3%)
 Frame = -3

Query: 812 TLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNTNTWEXX 633
           TLFG RRGRV  A  ED R  P FL+EL M T  L +E++SG V++ALE +         
Sbjct: 73  TLFGHRRGRVSLAIHEDTRAPPVFLIELPMLTSALHKEISSGVVKLALESD--------- 123

Query: 632 XXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWR-VLNSIGPITMGAGVLPG--KED 462
                 +L+EE  W  YCNGRK G++ RR+   DD R VL  +  ++MGAGVLP   +++
Sbjct: 124 TRSARRRLVEEYVWAVYCNGRKAGYSIRRKEASDDERHVLRLLRGVSMGAGVLPAAPEKE 183

Query: 461 DGI--GPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHG 351
            G+  GPDGEL Y+RA+ ERVVGS+DSEAFYM++P+  G
Sbjct: 184 GGVPAGPDGELTYVRARVERVVGSKDSEAFYMINPNEGG 222



>gb:AP005606_1854795 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1590_E05.
          Length = 315

 Score =  132 bits (332), Expect = 1e-29
 Identities = 77/176 (43%), Positives = 98/176 (55%), Gaps = 15/176 (8%)
 Frame = -3

Query: 824 RVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMAS-GPVRIALECEGNTN 648
           RV GTLFG R+GRV  A QE PR  P  ++ELA+ T  L+RE+A+    RI LE E    
Sbjct: 132 RVTGTLFGHRKGRVALALQETPRCLPTLVIELAIQTNALLRELANPAGARIVLETERRAP 191

Query: 647 TWEXXXXXXXXK--LLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLP 474
           + +           LL+  AW  +CNGRK G A RRE   DD  VL ++ P++MGAGVLP
Sbjct: 192 STDAAAGKHRRAPPLLDVAAWTMFCNGRKTGLAVRREATDDDLAVLETLRPVSMGAGVLP 251

Query: 473 GK-----------EDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHG-GPE 342
                        E      D E+ YMR  ++  VGSRDSE+ YM++P G G GPE
Sbjct: 252 ASNRSSSSSSQSPEKGAAAADDEVAYMRGCFDHFVGSRDSESLYMIAPQGGGTGPE 307



>gb:OSJN00094_1694794 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0003B01, complete
           sequence.>gb:OSJN00101_1694941 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBb0034I13, complete
           sequence.
          Length = 301

 Score =  129 bits (325), Expect = 8e-29
 Identities = 74/190 (38%), Positives = 106/190 (55%), Gaps = 11/190 (5%)
 Frame = -3

Query: 878 VSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVRE 699
           +SKL ++ + G       R+ GTLFG+R  R+  + Q++PR  P  +VELA+PT  L+R+
Sbjct: 105 MSKLVASASTGAAGASRRRMTGTLFGYRDARIALSLQDNPRCQPTLVVELALPTHALLRD 164

Query: 698 MAS-GPVRIALECE----------GNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAA 552
           + +    RI LE E          G   +           +LEE  W   CNG+K G+A 
Sbjct: 165 LGTTAGARIVLESEKRAADGGDGAGAGASSRREREQQDGWVLEESMWTMSCNGKKVGYAV 224

Query: 551 RRECGPDDWRVLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYM 372
           RR+   DD  VL ++  ++MG GVLPG  D   G DGE+ YMR  +E ++GSR+SE+ YM
Sbjct: 225 RRDPTDDDIAVLETLWAVSMGGGVLPGISDMD-GKDGEMAYMRGSFEHIIGSRNSESLYM 283

Query: 371 MSPDGHGGPE 342
           +SP G   PE
Sbjct: 284 ISPHGGDCPE 293



>gb:AY087127_1572162 Arabidopsis thaliana clone 3200 mRNA, complete
           sequence.
          Length = 245

 Score =  126 bits (317), Expect = 7e-28
 Identities = 73/184 (39%), Positives = 106/184 (57%), Gaps = 3/184 (1%)
 Frame = -3

Query: 884 TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLG--PAFLVELAMPTGV 711
           ++ S   S+      S   + V GT FG RRGRV F  Q D  +G  P  L+ELA+PT  
Sbjct: 66  SSTSSSSSSSDHSSSSQSSSTVSGTFFGHRRGRVSFCLQ-DATVGSSPLLLLELAVPTAA 124

Query: 710 LVREM-ASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGP 534
           L +EM   G +RIALEC+   ++           + + P W  +CNGRK GFA RR+   
Sbjct: 125 LAKEMDEEGVLRIALECDRRRSS-----NSRSSSIFDVPVWSMFCNGRKMGFAVRRKVTE 179

Query: 533 DDWRVLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGH 354
           +D   L  +  +++GAGV+P +E+D      +++Y+RA++ERV GS DSE+F+MM+P G 
Sbjct: 180 NDAVFLRMMQSVSVGAGVVPSEEED------QMLYLRARFERVTGSSDSESFHMMNPGGS 233

Query: 353 GGPE 342
            G E
Sbjct: 234 YGQE 237



>pir|D86343|D86343 protein T22I11.13 [imported] - Arabidopsis
           thaliana>gb:AE005172_891063 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T22I11_1723803 Arabidopsis thaliana
           chromosome 1 BAC T22I11 sequence, complete
           sequence.>gb:AK118841_1816799 Arabidopsis thaliana
           At1g21050 mRNA for unknown protein, complete cds, clone:
           RAFL21-17-C24.
          Length = 242

 Score =  126 bits (317), Expect = 7e-28
 Identities = 73/184 (39%), Positives = 106/184 (57%), Gaps = 3/184 (1%)
 Frame = -3

Query: 884 TAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLG--PAFLVELAMPTGV 711
           ++ S   S+      S   + V GT FG RRGRV F  Q D  +G  P  L+ELA+PT  
Sbjct: 63  SSTSSSSSSSDHSSSSQSSSTVSGTFFGHRRGRVSFCLQ-DAAVGSSPLLLLELAVPTAA 121

Query: 710 LVREM-ASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGP 534
           L +EM   G +RIALEC+   ++           + + P W  +CNGRK GFA RR+   
Sbjct: 122 LAKEMDEEGVLRIALECDRRRSS-----NSRSSSIFDVPVWSMFCNGRKMGFAVRRKVTE 176

Query: 533 DDWRVLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGH 354
           +D   L  +  +++GAGV+P +E+D      +++Y+RA++ERV GS DSE+F+MM+P G 
Sbjct: 177 NDAVFLRMMQSVSVGAGVVPSEEED------QMLYLRARFERVTGSSDSESFHMMNPGGS 230

Query: 353 GGPE 342
            G E
Sbjct: 231 YGQE 234



>gb:AY648319_1619997 Arabidopsis thaliana hypothetical protein
           (At1g76610) mRNA, complete cds.
          Length = 226

 Score =  123 bits (309), Expect = 6e-27
 Identities = 70/165 (42%), Positives = 92/165 (55%), Gaps = 2/165 (1%)
 Frame = -3

Query: 830 GARVVGTLFGFRRGRVHFAFQED--PRLGPAFLVELAMPTGVLVREMASGPVRIALECEG 657
           G  V GT +G RRG V F  Q+D  P   P  L+ELA+PT  L REM  G +RIAL  + 
Sbjct: 73  GVVVTGTFYGHRRGHVSFCLQDDTRPSSPPLLLLELAVPTAALAREMEEGFLRIALRSKS 132

Query: 656 NTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVL 477
           N  +           +   P W  YCNGRK GFA RRE   +D   L  +  +++GAGV+
Sbjct: 133 NRRS----------SIFNVPVWSMYCNGRKFGFAVRRETTENDVGFLRLMQSVSVGAGVI 182

Query: 476 PGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
                    P+GE +Y+RAK+ERV GS DSE+F+M++  G  G E
Sbjct: 183 ---------PNGETLYLRAKFERVTGSXDSESFHMVNQGGGYGQE 218



>pir|C96794|C96794 hypothetical protein F14G6.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_895192 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC015450_1538053 Arabidopsis thaliana
           chromosome 1 BAC F14G6 genomic sequence, complete
           sequence.>gb:AY773831_1628207 Arabidopsis thaliana clone
           pENTR221-At1g76610 hypothetical protein (At1g76610)
           gene, complete cds.
          Length = 226

 Score =  123 bits (309), Expect = 6e-27
 Identities = 70/165 (42%), Positives = 92/165 (55%), Gaps = 2/165 (1%)
 Frame = -3

Query: 830 GARVVGTLFGFRRGRVHFAFQED--PRLGPAFLVELAMPTGVLVREMASGPVRIALECEG 657
           G  V GT +G RRG V F  Q+D  P   P  L+ELA+PT  L REM  G +RIAL  + 
Sbjct: 73  GVVVTGTFYGHRRGHVSFCLQDDTRPSSPPLLLLELAVPTAALAREMEEGFLRIALRSKS 132

Query: 656 NTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVL 477
           N  +           +   P W  YCNGRK GFA RRE   +D   L  +  +++GAGV+
Sbjct: 133 NRRS----------SIFNVPVWSMYCNGRKFGFAVRRETTENDVGFLRLMQSVSVGAGVI 182

Query: 476 PGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
                    P+GE +Y+RAK+ERV GS DSE+F+M++  G  G E
Sbjct: 183 ---------PNGETLYLRAKFERVTGSSDSESFHMVNQGGGYGQE 218



>gb:AP000969_1820698 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0011D01.>gb:AP001073_1820723
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0667A10.
          Length = 514

 Score =  122 bits (306), Expect = 1e-26
 Identities = 69/170 (40%), Positives = 99/170 (58%), Gaps = 9/170 (5%)
 Frame = -3

Query: 824 RVVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREM-ASGPVRIALECEGNTN 648
           R  GTL+G RR R+  AF + P   PA L+++A+PT   ++++ A+G VR+ LEC+   +
Sbjct: 337 RTTGTLYGHRRARITIAFHDSPGSPPALLLDIAVPTAKFIQDVSAAGMVRVTLECDKQQH 396

Query: 647 -----TWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAG 483
                           +LL+EP W    NG   G+AARRE    D RV+  +  ++MGAG
Sbjct: 397 QPPPHAHPPGDPLPPRRLLDEPVWSAEVNGESVGYAARREATEADERVMRLLHAMSMGAG 456

Query: 482 VLPGKEDDG--IGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHG-GPE 342
           VLP    D      DGE+ YMRA ++RVVGS+D+E +YM +P+G   GPE
Sbjct: 457 VLPAVAADAPTSAADGEVTYMRAHFDRVVGSKDAETYYMHNPEGCATGPE 506



>gb:AY087400_1572431 Arabidopsis thaliana clone 34976 mRNA, complete
           sequence.
          Length = 247

 Score =  122 bits (305), Expect = 2e-26
 Identities = 76/189 (40%), Positives = 101/189 (53%), Gaps = 11/189 (5%)
 Frame = -3

Query: 875 SKLRSALTFGIKS------PLGARVVGTLFGFRRGRVHFAFQEDP-RLGPAFLVELAMPT 717
           S+  SA+ + I +      P    V+GT+FG R+G V F  Q D   + P  L+EL++ T
Sbjct: 57  SEATSAVDYSISAVTVPQRPSKXMVIGTIFGRRKGHVWFCVQHDRLSVKPILLLELSIAT 116

Query: 716 GVLVREMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECG 537
             LV EM SG VR+ALEC                 L   P W  +CNGRK GFA RR   
Sbjct: 117 SQLVHEMGSGLVRVALECPTRPEL-------KSCLLRSVPVWTMFCNGRKLGFAVRRSAN 169

Query: 536 PDDWRVLNSIGPITMGAGVLPGKEDDGIGPD----GELMYMRAKYERVVGSRDSEAFYMM 369
            +   +L  +  +T+GAGVLP     G G D     E+MYMRA YE VVGS DSE+F+++
Sbjct: 170 EETRMMLKRLESMTVGAGVLPSGSGLG-GSDESDTDEVMYMRANYEHVVGSSDSESFHLI 228

Query: 368 SPDGHGGPE 342
           +PD +   E
Sbjct: 229 NPDANSAQE 237



>pir|C84798|C84798 hypothetical protein At2g37880 [imported] -
           Arabidopsis thaliana>gb:AC007661_1536100 Arabidopsis
           thaliana chromosome II section 205 of 255 of the
           complete sequence. Sequence from clones F13M22, T8P21,
           F16M14.
          Length = 247

 Score =  122 bits (305), Expect = 2e-26
 Identities = 76/189 (40%), Positives = 101/189 (53%), Gaps = 11/189 (5%)
 Frame = -3

Query: 875 SKLRSALTFGIKS------PLGARVVGTLFGFRRGRVHFAFQEDP-RLGPAFLVELAMPT 717
           S+  SA+ + I +      P    V+GT+FG R+G V F  Q D   + P  L+EL++ T
Sbjct: 57  SEATSAVDYSISAVTVPQRPSKTMVIGTIFGRRKGHVWFCVQHDRLSVKPILLLELSIAT 116

Query: 716 GVLVREMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECG 537
             LV EM SG VR+ALEC                 L   P W  +CNGRK GFA RR   
Sbjct: 117 SQLVHEMGSGLVRVALECPTRPEL-------KSCLLRSVPVWTMFCNGRKLGFAVRRSAN 169

Query: 536 PDDWRVLNSIGPITMGAGVLPGKEDDGIGPD----GELMYMRAKYERVVGSRDSEAFYMM 369
            +   +L  +  +T+GAGVLP     G G D     E+MYMRA YE VVGS DSE+F+++
Sbjct: 170 EETRMMLKRLESMTVGAGVLPSGSGLG-GSDESDTDEVMYMRANYEHVVGSSDSESFHLI 228

Query: 368 SPDGHGGPE 342
           +PD +   E
Sbjct: 229 NPDANSAQE 237



>gb:AB011479_1511437 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MNA5.>gb:BT010415_1640361 Arabidopsis thaliana
           At5g65340 mRNA, complete cds.>gb:AK175638_1817626
           Arabidopsis thaliana mRNA for putative protein, complete
           cds, clone: RAFL22-12-M16.
          Length = 253

 Score =  121 bits (303), Expect = 3e-26
 Identities = 71/161 (44%), Positives = 92/161 (57%), Gaps = 3/161 (1%)
 Frame = -3

Query: 815 GTLFGFRRGRVHFAFQ--EDPRLGPAF-LVELAMPTGVLVREMASGPVRIALECEGNTNT 645
           GT+FGFRRG+V+F  Q      L P   L+EL +PT VL REM  G +RIALE   N N 
Sbjct: 85  GTIFGFRRGKVNFCIQATNSKTLNPIIVLLELTVPTEVLAREMQGGVLRIALE--SNNND 142

Query: 644 WEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAGVLPGKE 465
                      LL  P W  YCNGRK GFA +RE    +   L  + P+  GAGV+ G+E
Sbjct: 143 GYDSHEDSSSSLLTTPLWNMYCNGRKVGFAIKREPSKSELAALKVLTPVAEGAGVVNGEE 202

Query: 464 DDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGGPE 342
            +    D  +MY+RA ++RV GS DSE+F+++ P G  G E
Sbjct: 203 INREKSD-HMMYLRASFKRVFGSFDSESFHLVDPRGIIGQE 242



>gb:AY231426_1591614 Arabidopsis thaliana hypothetical protein
           (At2g22460/F14M13.14) mRNA, complete cds.
          Length = 245

 Score =  118 bits (295), Expect = 3e-25
 Identities = 69/184 (37%), Positives = 102/184 (55%), Gaps = 2/184 (1%)
 Frame = -3

Query: 887 KTAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAF--LVELAMPTG 714
           K+  S  RS+ +        + V GT+FG+R+G+++F  Q  PR       L+ELA+PT 
Sbjct: 68  KSRTSSFRSSSSLS-----SSTVTGTIFGYRKGKINFCIQT-PRKSTNLDLLLELAVPTT 121

Query: 713 VLVREMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGP 534
           VL REM  G +RI LE        +          L +P W  YCNG++ G+A +R    
Sbjct: 122 VLAREMREGALRIVLERNNEKQDDDS--------FLSKPFWNMYCNGKRVGYARKRSPSQ 173

Query: 533 DDWRVLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGH 354
           DD   L ++  + +GAGV+ GKE      D ELMY+RA + RV GS++SE+F+++ P G+
Sbjct: 174 DDMTALTALSKVVVGAGVVTGKELGRF--DDELMYLRASFRRVNGSKESESFHLIDPAGN 231

Query: 353 GGPE 342
            G E
Sbjct: 232 IGQE 235



>pir|H84612|H84612 hypothetical protein At2g22460 [imported] -
           Arabidopsis thaliana>gb:AC006592_1534567 Arabidopsis
           thaliana chromosome 2 clone F14M13 map mi238, complete
           sequence.
          Length = 236

 Score =  118 bits (295), Expect = 3e-25
 Identities = 69/184 (37%), Positives = 102/184 (55%), Gaps = 2/184 (1%)
 Frame = -3

Query: 887 KTAVSKLRSALTFGIKSPLGARVVGTLFGFRRGRVHFAFQEDPRLGPAF--LVELAMPTG 714
           K+  S  RS+ +        + V GT+FG+R+G+++F  Q  PR       L+ELA+PT 
Sbjct: 59  KSRTSSFRSSSSLS-----SSTVTGTIFGYRKGKINFCIQT-PRKSTNLDLLLELAVPTT 112

Query: 713 VLVREMASGPVRIALECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGP 534
           VL REM  G +RI LE        +          L +P W  YCNG++ G+A +R    
Sbjct: 113 VLAREMREGALRIVLERNNEKQDDDS--------FLSKPFWNMYCNGKRVGYARKRSPSQ 164

Query: 533 DDWRVLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGH 354
           DD   L ++  + +GAGV+ GKE      D ELMY+RA + RV GS++SE+F+++ P G+
Sbjct: 165 DDMTALTALSKVVVGAGVVTGKELGRF--DDELMYLRASFRRVNGSKESESFHLIDPAGN 222

Query: 353 GGPE 342
            G E
Sbjct: 223 IGQE 226



>gb:AC130609_1740861 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0048F12, complete sequence.
          Length = 263

 Score =  113 bits (283), Expect = 6e-24
 Identities = 67/167 (40%), Positives = 91/167 (54%), Gaps = 9/167 (5%)
 Frame = -3

Query: 821 VVGTLFGFRRGRVHFAFQEDPRLGPAFLVELAMPTGVLVREMASGPVRIALECEGNTNT- 645
           +VGT+FG R G V F  Q D  + P FL EL++P   L  EM SG +RIALEC  ++   
Sbjct: 83  IVGTIFGRRSGHVTFCVQRDAAMPPPFLFELSVPMLSLAAEMGSGLLRIALECHHSSGKV 142

Query: 644 ------WEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARRECGPDDWRVLNSIGPITMGAG 483
                  +               W+  CNGR  G+A RR     D RVL S+   T G G
Sbjct: 143 VVGAADGDTINNAGTGGGGSRSVWKASCNGRDVGYAVRRRPTDQDCRVLESMRMTTTGVG 202

Query: 482 VLP--GKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDGHGG 348
           VLP  G  +DG G  G+++YMRA YERVVGS+D+ ++++++P    G
Sbjct: 203 VLPSTGFSEDGGG--GDVLYMRATYERVVGSKDAVSYHLITPGTASG 247



>gb:AC096689_1736288 Oryza sativa chromosome 3 BAC OSJNBa0027J18
           genomic sequence, complete sequence.>gb:AC103550_1737261
           Oryza sativa chromosome 3 BAC OSJNBa0079G12 genomic
           sequence, complete sequence.
          Length = 231

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 64/166 (38%), Positives = 85/166 (51%), Gaps = 11/166 (6%)
 Frame = -3

Query: 821 VVGTLF-----GFRRGRVHFAFQEDPRLGP-----AFLVELAMPTGVLVREMASGPVRIA 672
           V GTLF     G RR R+ F  + DP   P     A LV L +P G+   ++A+   R+ 
Sbjct: 67  VRGTLFLPSTGGDRRVRL-FLHEHDPSPSPDENHQAILV-LDLPPGLSGADIAAAG-RVV 123

Query: 671 LECEGNTNTWEXXXXXXXXKLLEEPAWRTYCNGRKCGFAARR-ECGPDDWRVLNSIGPIT 495
           LEC+   N            LLE   W  YCNGR+ GFAARR E    +  VL  +  +T
Sbjct: 124 LECQRQWNN-------GGGALLESAKWLVYCNGRRVGFAARRGEASDAEGWVLEKLWAVT 176

Query: 494 MGAGVLPGKEDDGIGPDGELMYMRAKYERVVGSRDSEAFYMMSPDG 357
            GAG LPG    G G +    YMR ++ER V S D+E+F+++ P G
Sbjct: 177 AGAGRLPG----GAGVE----YMRGRFERTVASSDAESFHLVDPIG 214



>gb:AP004161_1838408 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1311_H06.
          Length = 207

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 34/90 (37%), Positives = 40/90 (44%), Gaps = 1/90 (1%)
 Frame = -1

Query: 739 WWS-SPCPPAFWSGKWLPGRSESLWSARGTQTHGXXXXXXXXRSF*KSPLGGRTVTGGNA 563
           WW   P PPA  SG+  P  S S  SAR  Q+              +S  GG T T  +A
Sbjct: 109 WWRWPPTPPARSSGRCPPASSASRSSARSNQS----TQARSGGRCWRSRRGGPTATAESA 164

Query: 562 GSRRGENAGRTIGGC*TPSARSQWAPEFCP 473
            SR   +A  T GG   PS+R   AP F P
Sbjct: 165 ASRCAGSAAPTSGGFLAPSSRCPSAPAFSP 194



>gb:AP006840_568586 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 298

 Score = 37.7 bits (86), Expect(2) = 0.081
 Identities = 18/40 (45%), Positives = 20/40 (50%)
 Frame = -1

Query: 778 SPSRKTRAWARPSWWSSPCPPAFWSGKWLPGRSESLWSAR 659
           +P RK     RP WWS PC P   SG    G +   WSAR
Sbjct: 11  APPRKEAGGRRPGWWSPPCRPPSGSG----GTAPQPWSAR 46



 Score = 21.6 bits (44), Expect(2) = 0.081
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = -2

Query: 546 RMRAGRLAGVELHRPDHNG 490
           RMR  R  G+   RP H G
Sbjct: 46  RMRRRRRVGMRADRPQHPG 64



>gb:AE009843_256401 Pyrobaculum aerophilum strain IM2 section 98 of
           201 of the complete genome.>gb:AE009441_899027
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 344

 Score = 33.5 bits (75), Expect = 8.2
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 7/71 (9%)
 Frame = -3

Query: 548 RECGPDDWRVLNSIGPITMGAGVLPGKEDDGIGPDGELMYMRAK-------YERVVGSRD 390
           +EC P   +VL+ + P   G+G L G+E   + PD + + +  +       ++ V+G+ D
Sbjct: 177 KECNPRIRQVLSGLDPRFPGSGRLVGEEFRIVEPDNDYLRLVGRGGDEYIAWDFVLGTLD 236

Query: 389 SEAFYMMSPDG 357
           S  + +M+ DG
Sbjct: 237 SGEWIIMADDG 247


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 938,534,062
Number of Sequences: 1806583
Number of extensions: 17496651
Number of successful extensions: 51414
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 47750
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51251
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 89634994801
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)