BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12703
         (632 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB061265_1522026 Solanum tuberosum StLTSR mRNA for low temper...    77   3e-13   
gb:AY554050_1613540 Oryza sativa (japonica cultivar-group) droug...    72   8e-12   
gb:AY316308_1598415 Poncirus trifoliata Clt1 mRNA, complete cds.       71   1e-11   
gb:ATAC012393_1543452 Arabidopsis thaliana chromosome III BAC F1...    71   1e-11   
sp|Q9ZNS6|RC2B_ARATH|RC2B_ARATH Hydrophobic protein RCI2B (Low temperature ...    71   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AY823549_1628907 Pennisetum glaucum low temperature and salt ...    67   2e-10   
gb:AY554051_1613541 Oryza sativa (japonica cultivar-group) droug...    67   2e-10   
gb:AB161677_1528558 Leymus chinensis AcPMP3-2 mRNA for plasma me...    66   4e-10   
sp|Q9ZNQ7|RC2A_ARATH|RC2A_ARATH Hydrophobic protein RCI2A (Low temperature ...    66   4e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AB161676_1528557 Leymus chinensis AcPMP3-1 mRNA for plasma me...    65   9e-10   
gb:AY496072_1609088 Physcomitrella patens small hydrophobic prot...    64   3e-09   
gb:AC082644_1733153 Oryza sativa chromosome 3 BAC OSJNBa0013M12 ...    62   6e-09   
gb:AC005770_1532992 Arabidopsis thaliana chromosome 2 clone T7F6...    58   1e-07   
sp|Q9ARD5|LT02_HORVU|LT02_HORVU Low-temperature induced protein lt101.2.>gb...    57   3e-07   Hordeum vulgare [barley]
gb:AY496071_1609087 Physcomitrella patens small hydrophobic prot...    56   4e-07   
sp|Q42509|LT01_HORVU|LT01_HORVU Low-temperature induced protein lt101.1 (Bl...    52   6e-06   Hordeum vulgare [barley]
gb:AC093089_1735867 Oryza sativa (japonica cultivar-group) chrom...    52   8e-06   
sp|Q9LRI7|OSR8_ORYSA|OSR8_ORYSA Hydrophobic protein OSR8.>gb:AB030211_15184...    52   1e-05   Oryza sativa [red rice]
gb:AC137616_1743606 Oryza sativa (japonica cultivar-group) chrom...    51   1e-05   
sp|Q9FE70|RC21_ARATH|RC21_ARATH Hypothetical UPF0057 protein At1g57550.>pir...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AC134232_1741656 Oryza sativa (japonica cultivar-group) chrom...    50   2e-05   
gb:AY823550_1628908 Pennisetum glaucum low temperature and salt ...    50   3e-05   
gb:AP005919_1860146 Oryza sativa (japonica cultivar-group) genom...    49   5e-05   
gb:AY131234_1581222 Triticum aestivum putative low temperature a...    47   3e-04   
gb:CR382135_1667757 Debaryomyces hansenii chromosome C of strain...    44   0.002   
pir|S77036|S77036 salt stress-induced hydrophobic protein ESI3 -...    44   0.002   Synechocystis sp. PCC 6803
sp|P74805|YB69_SYNY3|YB69_SYNY3 Hypothetical UPF0057 protein ssr1169.             44   0.002   Synechocystis sp.
sp|O82232|RC22_ARATH|RC22_ARATH Hypothetical UPF0057 protein At2g24040.>pir...    44   0.003   Arabidopsis thaliana [mouse-ear cress]
pir|D97409|D97409 hypothetical protein AGR_C_727 [imported] - Ag...    43   0.005   Agrobacterium tumefaciens
pir|AD2627|AD2627 stress induced protein [imported] - Agrobacter...    43   0.005   Agrobacterium tumefaciens
gb:AY601678_1617434 Brassica rapa subsp. pekinensis salt and low...    42   0.007   
sp|Q9M095|RC23_ARATH|RC23_ARATH Hypothetical UPF0057 protein At4g30650.>pir...    42   0.007   Arabidopsis thaliana [mouse-ear cress]
pir|T16929|T16929 hypothetical protein T23F2.4 - Caenorhabditis ...    42   0.009   Caenorhabditis elegans [roundworm]
sp|Q22701|YCU4_CAEEL|YCU4_CAEEL Hypothetical UPF0057 protein T23F2.4 in chr...    42   0.009   Caenorhabditis elegans [roundworm]
sp|Q22700|YCU3_CAEEL|YCU3_CAEEL Hypothetical UPF0057 protein T23F2.3 in chr...    42   0.009   Caenorhabditis elegans [roundworm]
sp|Q9I5W9|Y567_PSEAE|Y567_PSEAE Hypothetical UPF0057 protein PA0567.>pir|H8...    41   0.019   Pseudomonas aeruginosa
gb:AE016775_329818 Pseudomonas putida KT2440 section 2 of 21 of ...    40   0.033   
gb:AE017343_1755339 Cryptococcus neoformans var. neoformans JEC2...    40   0.043   
gb:AY646240_1619849 Brassica napus cold and salt response protei...    39   0.056   
pir|AE2280|AE2280 stress induced hydrophobic peptide [imported] ...    39   0.073   Nostoc sp. PCC 7120
sp|Q9SUI0|RC24_ARATH|RC24_ARATH Hypothetical UPF0057 protein At4g30660.>pir...    39   0.073   Arabidopsis thaliana [mouse-ear cress]
gb:CR522870_99884 Desulfotalea psychrophila LSv54 chromosome.          38   0.12    
gb:AE016857_349962 Pseudomonas syringae pv. tomato str. DC3000 s...    38   0.16    
gb:NC100H1_1688181 Neurospora crassa DNA linkage group V Cosmid ...    36   0.47    
sp|Q22702|YCU5_CAEEL|YCU5_CAEEL Hypothetical UPF0057 protein T23F2.5 in chr...    36   0.62    Caenorhabditis elegans [roundworm]
sp|Q9Y068|RIC1_PHYIN|RIC1_PHYIN Protein Ric1.>gb:PIN133023_1700300 Phytopht...    36   0.62    Phytophthora infestans [potato late blight]
sp|Q9P824|PMP3_CANAL|PMP3_CANAL Plasma membrane proteolipid 3 homolog.>gb:C...    35   0.80    Candida albicans
gb:SPBC713_1720383 S.pombe chromosome II cosmid c713.                  35   1.1     
gb:BX294152_771055 Pirellula sp. strain 1 complete genome; segme...    35   1.4     
gb:AE016816_1746769 Ashbya gossypii (= Eremothecium gossypii) AT...    33   3.1     
pir|T26079|T26079 hypothetical protein W02A2.5 - Caenorhabditis ...    33   3.1     Caenorhabditis elegans [roundworm]
gb:BX294140_767482 Pirellula sp. strain 1 complete genome; segme...    33   4.0     
gb:BA000032_708949 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    32   8.9     


>gb:AB061265_1522026 Solanum tuberosum StLTSR mRNA for low
           temperature and salt responsive protein, complete cds.
          Length = 56

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 34/38 (89%), Positives = 36/38 (94%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           ST TCVDILLAI+LPPLGVFLKFGCK+EFWIC LLTLF
Sbjct: 4   STMTCVDILLAIILPPLGVFLKFGCKVEFWICVLLTLF 41



>gb:AY554050_1613540 Oryza sativa (japonica cultivar-group)
           drought-induced hydrophobic protein (DRR1) mRNA,
           complete cds.>gb:AY607689_1617519 Oryza sativa (japonica
           cultivar-group) low temperature-induced low molecular
           weight integral membrane protein LTI6a mRNA, complete
           cds.>gb:AP003749_1832836 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1136_D11.
          Length = 56

 Score = 72.0 bits (175), Expect = 8e-12
 Identities = 31/38 (81%), Positives = 34/38 (89%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           STATC+DI+LAI+LPPLGVF KFGC IEFWIC LLT F
Sbjct: 4   STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFF 41



>gb:AY316308_1598415 Poncirus trifoliata Clt1 mRNA, complete cds.
          Length = 54

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 30/36 (83%), Positives = 34/36 (94%)
 Frame = +3

Query: 84  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TATCVDI+LA++LPPLGVFLKFGCK EFWIC LLT+
Sbjct: 3   TATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTI 38



>gb:ATAC012393_1543452 Arabidopsis thaliana chromosome III BAC
           F10A16 genomic sequence, complete sequence.
          Length = 67

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 31/38 (81%), Positives = 36/38 (94%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           STAT V+I+LAI+LPPLGVFLKFGCK+EFWIC +LTLF
Sbjct: 2   STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLF 39



>sp|Q9ZNS6|RC2B_ARATH Hydrophobic protein RCI2B (Low temperature and
           salt responsive protein LTI6B).>gb:ATAC013454_1543528
           Arabidopsis thaliana chromosome III BAC F2O10 genomic
           sequence, complete sequence.>gb:AY084701_1569787
           Arabidopsis thaliana clone 11547 mRNA, complete
           sequence.>gb:AF104221_1768242 Arabidopsis thaliana low
           temperature and salt responsive protein LTI6B (lti6b)
           and low temperature and salt responsive protein LTI6A
           (lti6a) genes, complete cds.>gb:AF122006_1769846
           Arabidopsis thaliana hydrophobic protein (RCI2B) mRNA,
           complete cds.>gb:AF264749_1781875 Arabidopsis thaliana
           hydrophobic protein RCI2B (RCI2B) and hydrophobic
           protein RCI2A (RCI2A) genes, complete
           cds.>gb:AK176253_1818241 Arabidopsis thaliana mRNA for
           low temperature and salt responsive protein LTI6B,
           complete cds, clone: RAFL23-15-G04.
          Length = 54

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 31/38 (81%), Positives = 36/38 (94%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           STAT V+I+LAI+LPPLGVFLKFGCK+EFWIC +LTLF
Sbjct: 2   STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLF 39



>gb:AY823549_1628907 Pennisetum glaucum low temperature and salt
           responsive protein mRNA, complete cds.
          Length = 56

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 27/37 (72%), Positives = 32/37 (86%)
 Frame = +3

Query: 84  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           TA C+DI+LAI+LPPLGVF KFGC +EFWIC +LT F
Sbjct: 5   TANCIDIILAIILPPLGVFFKFGCGVEFWICLVLTFF 41



>gb:AY554051_1613541 Oryza sativa (japonica cultivar-group)
           drought-induced hydrophobic protein (DRR2) mRNA,
           complete cds.>gb:AY607690_1617520 Oryza sativa (japonica
           cultivar-group) low temperature-induced low molecular
           weight integral membrane protein LTI6b mRNA, complete
           cds.>gb:AF503583_1806748 Oryza sativa (indica
           cultivar-group) early drought induced protein (R1G1B)
           mRNA, complete cds.
          Length = 55

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 29/38 (76%), Positives = 32/38 (84%)
 Frame = +3

Query: 75  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT 188
           M  TA C+DIL+AI+LPPLGVFLKFGC  EFWIC LLT
Sbjct: 1   MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLT 38



>gb:AB161677_1528558 Leymus chinensis AcPMP3-2 mRNA for plasma
           membrane protein 3, complete cds.
          Length = 54

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 28/35 (80%), Positives = 32/35 (91%)
 Frame = +3

Query: 84  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT 188
           TATC+DI++AI+LPPLGVFLKFGC  EFWIC LLT
Sbjct: 3   TATCIDIIIAIILPPLGVFLKFGCGHEFWICLLLT 37



>sp|Q9ZNQ7|RC2A_ARATH Hydrophobic protein RCI2A (Low temperature and
           salt responsive protein LTI6A).>gb:ATAC012393_1543451
           Arabidopsis thaliana chromosome III BAC F10A16 genomic
           sequence, complete sequence.>gb:AY037244_1560138
           Arabidopsis thaliana AT3g05880/F10A16_18 mRNA, complete
           cds.>gb:AY039859_1560373 Arabidopsis thaliana
           AT3g05880/F10A16_18 mRNA, complete
           cds.>gb:AY077650_1567852 Arabidopsis thaliana
           AT3g05880/F10A16_18 mRNA, complete
           cds.>gb:AF104221_1768243 Arabidopsis thaliana low
           temperature and salt responsive protein LTI6B (lti6b)
           and low temperature and salt responsive protein LTI6A
           (lti6a) genes, complete cds.>gb:AF122005_1769845
           Arabidopsis thaliana hydrophobic protein (RCI2A) mRNA,
           complete cds.>gb:AF264749_1781876 Arabidopsis thaliana
           hydrophobic protein RCI2B (RCI2B) and hydrophobic
           protein RCI2A (RCI2A) genes, complete cds.
          Length = 54

 Score = 66.2 bits (160), Expect = 4e-10
 Identities = 29/37 (78%), Positives = 34/37 (91%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           STAT VDI++AILLPPLGVFL+FGC +EFWIC +LTL
Sbjct: 2   STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTL 38



>gb:AB161676_1528557 Leymus chinensis AcPMP3-1 mRNA for plasma
           membrane protein 3, complete cds.
          Length = 54

 Score = 65.1 bits (157), Expect = 9e-10
 Identities = 28/35 (80%), Positives = 31/35 (88%)
 Frame = +3

Query: 84  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT 188
           TA C+DI+LAI+LPPLGVFLKFGC  EFWIC LLT
Sbjct: 3   TANCIDIILAIILPPLGVFLKFGCGHEFWICLLLT 37



>gb:AY496072_1609088 Physcomitrella patens small hydrophobic protein
           2 mRNA, complete cds.
          Length = 58

 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 28/40 (70%), Positives = 34/40 (85%)
 Frame = +3

Query: 72  KMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           K GSTAT  ++LLAILLPPLGVFL++ C +EFWIC LLT+
Sbjct: 3   KGGSTATFCEVLLAILLPPLGVFLRYACGLEFWICLLLTI 42



>gb:AC082644_1733153 Oryza sativa chromosome 3 BAC OSJNBa0013M12
           genomic sequence, complete sequence.
          Length = 64

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 27/35 (77%), Positives = 32/35 (91%)
 Frame = +3

Query: 84  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT 188
           TAT VD+++AI+LPPLGVFLK GC+IEFWIC LLT
Sbjct: 12  TATFVDLVIAIILPPLGVFLKVGCEIEFWICLLLT 46



>gb:AC005770_1532992 Arabidopsis thaliana chromosome 2 clone T7F6
           map CIC10A06, complete sequence.>gb:AY052231_1562604
           Arabidopsis thaliana unknown protein mRNA, complete
           cds.>gb:AY060504_1564813 Arabidopsis thaliana
           At2g38901/At2g38901 mRNA, complete cds.
          Length = 54

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 26/39 (66%), Positives = 34/39 (87%)
 Frame = +3

Query: 75  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           MGS  T ++I+LAILLPP+GVFL++GC +EFWIC LLT+
Sbjct: 1   MGSE-TFLEIILAILLPPVGVFLRYGCGVEFWICLLLTI 38



>sp|Q9ARD5|LT02_HORVU Low-temperature induced protein
           lt101.2.>gb:HVU310995_1682678 Hordeum vulgare lt101.2
           gene for putative membrane protein.
          Length = 54

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 22/37 (59%), Positives = 33/37 (89%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           ++AT ++++LAI+LPP+GVFL++G  +EFWIC LLTL
Sbjct: 2   ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTL 38



>gb:AY496071_1609087 Physcomitrella patens small hydrophobic protein
           1 mRNA, complete cds.
          Length = 59

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 24/34 (70%), Positives = 30/34 (88%)
 Frame = +3

Query: 90  TCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           T VD+LLAI+LPPLGVFLK+G + EFWIC +LT+
Sbjct: 10  TFVDVLLAIILPPLGVFLKYGLQSEFWICLVLTI 43



>sp|Q42509|LT01_HORVU Low-temperature induced protein lt101.1
           (Blt101) (Salt-stress induced hydrophobic peptide
           ESI3).>pir|S40406|S40406 blt101 protein -
           barley>gb:AB030210_1518476 Triticum aestivum wpi6 mRNA
           for hydrophobic polypeptide, complete
           cds.>gb:HVBLT101_1682288 H.vulgare blt101
           mRNA.>gb:HVU310994_1682677 Hordeum vulgare lt101.1 gene
           for putative membrane protein.>gb:U00966_1726188
           Lophopyrum elongatum salt-stress induced hydrophobic
           peptide (ESI3) gene, complete cds.
          Length = 54

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 23/39 (58%), Positives = 33/39 (84%)
 Frame = +3

Query: 75  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           MGS AT ++++LAI+LPP+GVFL++   +EFWIC LLT+
Sbjct: 1   MGS-ATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTI 38



>gb:AC093089_1735867 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1729_E02, complete sequence.
          Length = 54

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 26/39 (66%), Positives = 32/39 (82%)
 Frame = +3

Query: 75  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           MGS  T ++ILLAILLPPLGVFL++G  +EFWI  LLT+
Sbjct: 1   MGSE-TFLEILLAILLPPLGVFLRYGIGMEFWIALLLTI 38



>sp|Q9LRI7|OSR8_ORYSA Hydrophobic protein OSR8.>gb:AB030211_1518477
           Oryza sativa osr8 mRNA for hydrophobic polypeptide,
           complete cds.>gb:AP005090_1847597 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1065_E04.
          Length = 72

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 1/39 (2%)
 Frame = +3

Query: 78  GSTATCVDILLAILLPPLGVFLKFG-CKIEFWICCLLTL 191
           G   T ++ILLAI+LPPLGVFL+FG C +EF IC LLT+
Sbjct: 4   GRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTI 42



>gb:AC137616_1743606 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0069I13, complete sequence.
          Length = 49

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 21/29 (72%), Positives = 25/29 (86%)
 Frame = +3

Query: 75  MGSTATCVDILLAILLPPLGVFLKFGCKI 161
           M  TA C+DIL+AI+LPPLGVFLKFGC +
Sbjct: 1   MAGTANCIDILIAIILPPLGVFLKFGCGV 29



>sp|Q9FE70|RC21_ARATH Hypothetical UPF0057 protein
           At1g57550.>pir|D96609|D96609 hypothetical protein
           T8L23.2 [imported] - Arabidopsis
           thaliana>gb:AE005173_893549 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC009323_1536712 Arabidopsis thaliana
           chromosome I BAC F25P12 genomic sequence, complete
           sequence.>gb:AC079733_1732745 Arabidopsis thaliana
           chromosome 1 BAC T8L23 genomic sequence, complete
           sequence.
          Length = 52

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 19/33 (57%), Positives = 28/33 (84%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           +++L AI +PP+GVFL++G  +EFW+C LLTLF
Sbjct: 5   LEVLCAIFIPPVGVFLRYGLGLEFWVCLLLTLF 37



>gb:AC134232_1741656 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0013D02, complete sequence.
          Length = 54

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 22/37 (59%), Positives = 31/37 (83%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           ++AT +++LLAI LPP+GVFL++G  IEFWI  LLT+
Sbjct: 2   ASATFLEVLLAIFLPPVGVFLRYGLGIEFWIDLLLTI 38



>gb:AY823550_1628908 Pennisetum glaucum low temperature and salt
           responsive protein mRNA, complete cds.
          Length = 83

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 3/42 (7%)
 Frame = +3

Query: 75  MGSTATC--VDILLAILLPPLGVFLKFG-CKIEFWICCLLTL 191
           MG    C  ++ILLAI+LPPLGVFL+FG C +EF IC LLT+
Sbjct: 1   MGDANCCRFLEILLAIVLPPLGVFLRFGCCSMEFCICLLLTI 42



>gb:AP005919_1860146 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0554A06.
          Length = 76

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 24/40 (60%), Positives = 29/40 (72%), Gaps = 1/40 (2%)
 Frame = +3

Query: 75  MGSTATCVDILLAILLPPLGVFLKFG-CKIEFWICCLLTL 191
           MG    C++IL AILLPPLGV L+ G C +EFWI  LLT+
Sbjct: 1   MGCCCRCLEILCAILLPPLGVCLRHGCCTMEFWISVLLTI 40



>gb:AY131234_1581222 Triticum aestivum putative low temperature and
           salt responsive protein mRNA, partial cds.
          Length = 69

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 22/34 (64%), Positives = 27/34 (79%), Gaps = 1/34 (2%)
 Frame = +3

Query: 93  CVDILLAILLPPLGVFLKFG-CKIEFWICCLLTL 191
           C++IL AILLPPLGV L+ G C +EFWI  LLT+
Sbjct: 3   CLEILCAILLPPLGVCLRHGCCSMEFWISVLLTI 36



>gb:CR382135_1667757 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 57

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC DI   ++AI+LPPLGVFL+ GC   FWI  +LT+
Sbjct: 4   TCSDIFKIIIAIILPPLGVFLERGCASSFWINIVLTI 40



>pir|S77036|S77036 salt stress-induced hydrophobic protein ESI3 -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_690116
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 79

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           V I+ AILLPPLGVFL+ G   +FWI  LLT+F
Sbjct: 29  VKIICAILLPPLGVFLQVGIGKDFWINLLLTIF 61



>sp|P74805|YB69_SYNY3 Hypothetical UPF0057 protein ssr1169.
          Length = 54

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 21/33 (63%), Positives = 25/33 (75%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           V I+ AILLPPLGVFL+ G   +FWI  LLT+F
Sbjct: 4   VKIICAILLPPLGVFLQVGIGKDFWINLLLTIF 36



>sp|O82232|RC22_ARATH Hypothetical UPF0057 protein
           At2g24040.>pir|H84631|H84631 hypothetical protein
           At2g24040 [imported] - Arabidopsis
           thaliana>gb:AC005170_1532304 Arabidopsis thaliana
           chromosome 2 clone T29E15 map CIC06C07, complete
           sequence.>gb:BT012202_1641408 Arabidopsis thaliana
           At2g24040 mRNA, complete cds.>gb:BT012367_1641518
           Arabidopsis thaliana At2g24040 mRNA, complete cds.
          Length = 75

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/37 (54%), Positives = 27/37 (72%), Gaps = 1/37 (2%)
 Frame = +3

Query: 81  STATCVDILLAILLPPLGVFLKFG-CKIEFWICCLLT 188
           S   C +I +AILLPP+GV L+ G C +EF+IC +LT
Sbjct: 4   SCELCCEIFIAILLPPVGVCLRHGCCTVEFFICLILT 40



>pir|D97409|D97409 hypothetical protein AGR_C_727 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE007979_232169 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 37 of 254 of the
           complete sequence.>gb:AE007869_1081838 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 80

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 18/32 (56%), Positives = 26/32 (81%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           + IL+AI+LPP+GVFL+ G  ++FW+  LLTL
Sbjct: 32  IRILIAIILPPVGVFLQVGLGLQFWLNILLTL 63



>pir|AD2627|AD2627 stress induced protein [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>gb:AE009012_247461
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 38 of 256 of the complete
           sequence.>gb:AE008688_1085304 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 52

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 18/32 (56%), Positives = 26/32 (81%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           + IL+AI+LPP+GVFL+ G  ++FW+  LLTL
Sbjct: 4   IRILIAIILPPVGVFLQVGLGLQFWLNILLTL 35



>gb:AY601678_1617434 Brassica rapa subsp. pekinensis salt and low
           temperature response protein mRNA, complete cds.
          Length = 74

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +3

Query: 99  DILLAILLPPLGVFLKFG-CKIEFWICCLLTL 191
           +IL+AILLPPLGV LK G C +EF IC +LT+
Sbjct: 10  EILIAILLPPLGVCLKRGCCTVEFLICLVLTI 41



>sp|Q9M095|RC23_ARATH Hypothetical UPF0057 protein
           At4g30650.>pir|F85358|F85358 hypothetical protein
           AT4g30650 [imported] - Arabidopsis
           thaliana>gb:ATCHRIV73_1546986 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           73.>gb:BT010774_1640720 Arabidopsis thaliana At4g30650
           mRNA, complete cds.>gb:BT011262_1641012 Arabidopsis
           thaliana At4g30650 gene, complete cds.
          Length = 73

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 21/32 (65%), Positives = 26/32 (81%), Gaps = 1/32 (3%)
 Frame = +3

Query: 99  DILLAILLPPLGVFLKFG-CKIEFWICCLLTL 191
           +IL+AILLPPLGV LK G C +EF IC +LT+
Sbjct: 10  EILIAILLPPLGVCLKRGCCTVEFLICLVLTI 41



>pir|T16929|T16929 hypothetical protein T23F2.4 - Caenorhabditis
           elegans>gb:U39649_1402992 Caenorhabditis elegans cosmid
           T23F2, complete sequence.
          Length = 77

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC+DI   L A+LLPP+GVFL+ GC     IC LLT+
Sbjct: 24  TCMDIPKFLFALLLPPVGVFLEKGCTHHLAICILLTI 60



>sp|Q22701|YCU4_CAEEL Hypothetical UPF0057 protein T23F2.4 in
           chromosome X.
          Length = 57

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC+DI   L A+LLPP+GVFL+ GC     IC LLT+
Sbjct: 4   TCMDIPKFLFALLLPPVGVFLEKGCTHHLAICILLTI 40



>sp|Q22700|YCU3_CAEEL Hypothetical UPF0057 protein T23F2.3 in
           chromosome X.>pir|T16928|T16928 hypothetical protein
           T23F2.3 - Caenorhabditis elegans>gb:U39649_1402991
           Caenorhabditis elegans cosmid T23F2, complete sequence.
          Length = 57

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC DI   + A+LLPP+GVFL+ GC     IC LLT+
Sbjct: 4   TCTDIPKFICAVLLPPIGVFLEKGCDYHLAICILLTI 40



>sp|Q9I5W9|Y567_PSEAE Hypothetical UPF0057 protein
           PA0567.>pir|H83573|H83573 conserved hypothetical protein
           PA0567 [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004493_54802 Pseudomonas aeruginosa PAO1,
           section 54 of 529 of the complete
           genome.>gb:AE004091_968902 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 52

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 20/32 (62%), Positives = 24/32 (75%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           + IL+AILLPPLGVFL+ G    FW+  LLTL
Sbjct: 4   IRILIAILLPPLGVFLQVGFGGAFWLNILLTL 35



>gb:AE016775_329818 Pseudomonas putida KT2440 section 2 of 21 of the
           complete genome.>gb:AE015451_944895 Pseudomonas putida
           KT2440 complete genome.
          Length = 52

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 19/32 (59%), Positives = 24/32 (75%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           + I++AILLPPLGVFL+ G    FW+  LLTL
Sbjct: 4   IRIIIAILLPPLGVFLQVGFGGAFWLNILLTL 35



>gb:AE017343_1755339 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 57

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC DI   +LAI+LPPLGVFL+ GC  +  I  LLT+
Sbjct: 4   TCSDIFKIILAIILPPLGVFLERGCGADLLINILLTI 40



>gb:AY646240_1619849 Brassica napus cold and salt response protein
           mRNA, complete cds.
          Length = 74

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +3

Query: 99  DILLAILLPPLGVFLKFG-CKIEFWICCLLTL 191
           +IL+AILLP LGV LK G C +EF IC +LT+
Sbjct: 10  EILIAILLPSLGVCLKRGCCTVEFLICLVLTI 41



>pir|AE2280|AE2280 stress induced hydrophobic peptide [imported] -
           Nostoc sp.  (strain PCC 7120)>gb:BA000019_684785 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 52

 Score = 38.9 bits (89), Expect = 0.073
 Identities = 19/32 (59%), Positives = 22/32 (68%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           V +L AI  PPLGVFL+ G   +FWI  LLTL
Sbjct: 4   VRLLCAIFFPPLGVFLQVGIGKDFWINILLTL 35



>sp|Q9SUI0|RC24_ARATH Hypothetical UPF0057 protein
           At4g30660.>pir|G85358|G85358 stress responsive protein
           homolog [imported] - Arabidopsis
           thaliana>gb:ATCHRIV73_1546987 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           73.>gb:ATT10C21_1554199 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T10C21.
          Length = 74

 Score = 38.9 bits (89), Expect = 0.073
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +3

Query: 99  DILLAILLPPLGV-FLKFGCKIEFWICCLLTL 191
           +I++AILLPPLGV F K  C +EF IC +LT+
Sbjct: 10  EIIIAILLPPLGVCFRKGCCTVEFLICLVLTI 41



>gb:CR522870_99884 Desulfotalea psychrophila LSv54 chromosome.
          Length = 60

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/32 (53%), Positives = 22/32 (68%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           + I+ AI+LPPLG FL+ G    FWI  +LTL
Sbjct: 11  IKIICAIILPPLGAFLQVGIGKHFWINIILTL 42



>gb:AE016857_349962 Pseudomonas syringae pv. tomato str. DC3000
           section 2 of 21 of the complete
           genome.>gb:AE016853_1035137 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 53

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/32 (53%), Positives = 23/32 (71%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           + I+ AILLPP+GVF++ G    FW+  LLTL
Sbjct: 4   IRIIFAILLPPVGVFMQVGFAGAFWLNILLTL 35



>gb:NC100H1_1688181 Neurospora crassa DNA linkage group V Cosmid
           contig 100H1.
          Length = 57

 Score = 36.2 bits (82), Expect = 0.47
 Identities = 15/30 (50%), Positives = 23/30 (76%)
 Frame = +3

Query: 102 ILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           I++A++LPPLGVF + GC  + +I  LLT+
Sbjct: 11  IIVAVILPPLGVFFERGCGADLFINILLTI 40



>sp|Q22702|YCU5_CAEEL Hypothetical UPF0057 protein T23F2.5 in
           chromosome X.>pir|T16930|T16930 hypothetical protein
           T23F2.5 - Caenorhabditis elegans>gb:U39649_1402993
           Caenorhabditis elegans cosmid T23F2, complete sequence.
          Length = 57

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 19/37 (51%), Positives = 24/37 (64%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC DI   L A+LLPP+GV+L+ GC     I  LLT+
Sbjct: 4   TCTDIPKFLCALLLPPIGVWLEKGCTYHLAINILLTI 40



>sp|Q9Y068|RIC1_PHYIN Protein Ric1.>gb:PIN133023_1700300
           Phytophthora infestans mRNA for RIC1 protein.
          Length = 57

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC DI   + ++++PP+GVF + GC  +  I CLLT+
Sbjct: 4   TCGDIPRLICSVIIPPVGVFFQVGCTKDLAINCLLTV 40



>sp|Q9P824|PMP3_CANAL Plasma membrane proteolipid 3
           homolog.>gb:CAL390517_1645003 Candida albicans ORF DNA,
           clone 322c_cp.
          Length = 55

 Score = 35.4 bits (80), Expect = 0.80
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           +++++AI LPP+ VF+K G     WI  +L +F
Sbjct: 7   IEVIIAIFLPPVAVFMKCGATTPLWINLVLCIF 39



>gb:SPBC713_1720383 S.pombe chromosome II cosmid c713.
          Length = 50

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 4/31 (12%)
 Frame = +3

Query: 102 ILLAILLPPLGVFLKFGCK----IEFWICCL 182
           ++ AI+LPPLGVFL+ GC     I   +CCL
Sbjct: 4   VIFAIILPPLGVFLERGCGADVIINILLCCL 34



>gb:BX294152_771055 Pirellula sp. strain 1 complete genome; segment
           20/24.
          Length = 60

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +3

Query: 96  VDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           + +LL   LPP+ V+++FG    FWI  +LTL
Sbjct: 4   IRLLLVFFLPPVAVYMQFGVGHYFWISVILTL 35



>gb:AE016816_1746769 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 55

 Score = 33.5 bits (75), Expect = 3.1
 Identities = 18/40 (45%), Positives = 26/40 (65%)
 Frame = +3

Query: 75  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           M ST   V++++AI LPP+ VFL  G  +E  +  LLT+F
Sbjct: 1   MNSTKV-VNVIIAIFLPPVAVFLARGWGVECIVDLLLTIF 39



>pir|T26079|T26079 hypothetical protein W02A2.5 - Caenorhabditis
           elegans>gb:CEW02A2_1368814 Caenorhabditis elegans cosmid
           W02A2, complete sequence.
          Length = 551

 Score = 33.5 bits (75), Expect = 3.1
 Identities = 16/37 (43%), Positives = 25/37 (67%), Gaps = 3/37 (8%)
 Frame = +3

Query: 90  TCVDI---LLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           TC DI   + A+LLPP+GV+++ GC  +  I  +LT+
Sbjct: 498 TCTDIPKFICALLLPPIGVWMEKGCGADLVINIVLTI 534



>gb:BX294140_767482 Pirellula sp. strain 1 complete genome; segment
           8/24.
          Length = 59

 Score = 33.1 bits (74), Expect = 4.0
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +3

Query: 90  TCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL 191
           T + +LLAILLPPL V++  G   +F +  +LTL
Sbjct: 10  TVLKVLLAILLPPLAVYMDKGVGTQFLLNIVLTL 43



>gb:BA000032_708949 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 54

 Score = 32.0 bits (71), Expect = 8.9
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +3

Query: 84  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF 194
           T   + ILL I LPP+ V+++ G   +F+I  +LT F
Sbjct: 3   TKKLILILLCIFLPPVAVYMEKGLNKDFFINLILTFF 39


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 559,489,157
Number of Sequences: 1806583
Number of extensions: 10052159
Number of successful extensions: 23512
Number of sequences better than 10.0: 53
Number of HSP's better than 10.0 without gapping: 22824
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23497
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 33391048418
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)