BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12610
         (839 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|H96576|H96576 hypothetical protein F22G10.17 [imported] - Ar...   244   2e-67   Arabidopsis thaliana [mouse-ear cress]
gb:AY087664_1572693 Arabidopsis thaliana clone 3748 mRNA, comple...   244   4e-65   
gb:AP003545_1830714 Oryza sativa (japonica cultivar-group) genom...   243   3e-63   
gb:AP008231_581602 Synechococcus elongatus PCC 6301 DNA, complet...   181   2e-44   
sp|Q8DJK9|MSRB_SYNEL|MSRB_SYNEL Peptide methionine sulfoxide reductase msrB...   178   1e-43   Synechococcus elongatus
gb:BA000045_744094 Gloeobacter violaceus PCC 7421 DNA, complete ...   176   6e-43   
gb:BX640433_811586 Bordetella parapertussis strain 12822, comple...   167   2e-40   
gb:BX640421_807951 Bordetella pertussis strain Tohama I, complet...   166   7e-40   
gb:AY657350_2146360 Synthetic construct Peudomonas aeruginosa cl...   162   6e-39   
sp|Q9I016|MSRB_PSEAE|MSRB_PSEAE Peptide methionine sulfoxide reductase msrB...   162   6e-39   Pseudomonas aeruginosa
gb:AE017180_400744 Geobacter sulfurreducens PCA, complete genome.     160   2e-38   
gb:CR555306_108714 Azoarcus sp. EbN1 complete genome.                 160   4e-38   
gb:CR543861_103991 Acinetobacter sp. ADP1 complete genome.            160   4e-38   
gb:BA000045_744414 Gloeobacter violaceus PCC 7421 DNA, complete ...   159   5e-38   
gb:BC021619_2093567 Mus musculus methionine sulfoxide reductase ...   159   6e-38   
sp|O26807|MSRB_METTH|MSRB_METTH Peptide methionine sulfoxide reductase msrB...   159   6e-38   Methanothermobacter thermautotrophicus
gb:BX569689_775240 Synechococcus sp. WH8102 complete genome; seg...   158   1e-37   
sp|Q885Q1|MSRB_PSESM|MSRB_PSESM Peptide methionine sulfoxide reductase msrB...   155   7e-37   Pseudomonas syringae pv. tomato
sp|Q8XYL1|MSRB_RALSO|MSRB_RALSO Peptide methionine sulfoxide reductase msrB...   155   9e-37   Ralstonia solanacearum
gb:BX119963_2567060 Zebrafish DNA sequence from clone DKEY-6A5 i...   154   3e-36   
gb:BX119963_2567059 Zebrafish DNA sequence from clone DKEY-6A5 i...   154   3e-36   
gb:BX119963_2567058 Zebrafish DNA sequence from clone DKEY-6A5 i...   154   3e-36   
gb:BC071530_2556266 Danio rerio zgc:86909, mRNA (cDNA clone MGC:...   154   3e-36   
gb:CR859566_1183675 Pongo pygmaeus mRNA; cDNA DKFZp459F134 (from...   153   4e-36   
gb:AY358229_1947108 Homo sapiens clone DNA96898 SPRR1965 (UNQ196...   152   6e-36   
gb:HSM808927_1188055 Homo sapiens mRNA; cDNA DKFZp686I14130 (fro...   152   6e-36   
gb:BX572099_798928 Prochlorococcus marinus MIT9313 complete geno...   152   1e-35   
gb:AE011268_271062 Leptospira interrogans serovar lai str. 56601...   150   3e-35   
sp|Q8F7W8|MSRB_LEPIN|MSRB_LEPIN Peptide methionine sulfoxide reductase msrB...   150   3e-35   
gb:AF122004_1884863 Homo sapiens pilin-like transcription factor...   149   6e-35   
gb:CP000026_76370 Salmonella enterica subsp. enterica serovar Pa...   149   6e-35   
pir|AF0711|AF0711 conserved hypothetical protein STY1824 [import...   149   6e-35   Salmonella enterica subsp. enterica serovar Typhi
sp|Q8XGD3|MSRB_SALTY|MSRB_SALTY Peptide methionine sulfoxide reductase msrB...   149   6e-35   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q9Y3D2|MSRB_HUMAN|MSRB_HUMAN Methionine-R-sulfoxide reductase B (EC 1.8....   149   6e-35   Homo sapiens [man]
gb:AK086975_1174827 Mus musculus 0 day neonate lung cDNA, RIKEN ...   147   2e-34   
sp|Q88LQ6|MSRB_PSEPK|MSRB_PSEPK Peptide methionine sulfoxide reductase msrB...   147   3e-34   Pseudomonas putida
pir|AF2293|AF2293 hypothetical protein alr3901 [imported] - Nost...   146   5e-34   Nostoc sp. PCC 7120
gb:SME591785_185009 Sinorhizobium meliloti 1021 complete chromos...   145   1e-33   
sp|Q92RA4|MSB1_RHIME|MSB1_RHIME Peptide methionine sulfoxide reductase msrB...   145   1e-33   Sinorhizobium meliloti
gb:AY669150_1345398 Schistosoma mansoni methionine sulfoxide red...   144   2e-33   
gb:BX572606_803682 Rhodopseudomonas palustris CGA009 complete ge...   144   2e-33   
gb:AE016761_326189 Escherichia coli CFT073 section 7 of 18 of th...   144   2e-33   
gb:AE005674_71027 Shigella flexneri 2a str. 301, complete genome...   144   2e-33   
sp|P39903|MSRB_ECOLI|MSRB_ECOLI Peptide methionine sulfoxide reductase msrB...   144   2e-33   Escherichia coli [E. coli]
gb:AE010705_265831 Methanosarcina acetivorans str. C2A, section ...   144   3e-33   
gb:AY222978_1176444 Schistosoma japonicum clone ZZD100 mRNA sequ...   143   4e-33   
gb:BX572090_795641 Prochlorococcus marinus MED4 complete genome;...   143   4e-33   
gb:BX294146_769429 Pirellula sp. strain 1 complete genome; segme...   143   4e-33   
gb:AE017161_394473 Prochlorococcus marinus subsp. marinus str. C...   143   4e-33   
sp|Q8UGX7|MSRB_AGRT5|MSRB_AGRT5 Peptide methionine sulfoxide reductase msrB...   143   4e-33   Agrobacterium tumefaciens
gb:BC067722_2554888 Danio rerio zgc:85965, mRNA (cDNA clone MGC:...   142   6e-33   
gb:BX572095_797358 Prochlorococcus marinus MIT9313 complete geno...   142   1e-32   
gb:AE016921_358173 Chromobacterium violaceum ATCC 12472 section ...   141   1e-32   
gb:BA000038_724549 Vibrio vulnificus YJ016 DNA, chromosome II, c...   141   2e-32   
gb:AJ749949_531335 Francisella tularensis subsp. tularensis comp...   141   2e-32   
gb:AE016813_339297 Vibrio vulnificus CMCP6 chromosome II section...   140   2e-32   
gb:AE013397_291964 Methanosarcina mazei strain Goe1, section 179...   140   2e-32   
sp|Q89EM9|MSRB_BRAJA|MSRB_BRAJA Peptide methionine sulfoxide reductase msrB...   140   4e-32   Bradyrhizobium japonicum
gb:TSO428486_1401060 Taenia solium mRNA for putative transcripti...   139   7e-32   
pir|S74642|S74642 hypothetical protein sll1680 - Synechocystis s...   137   2e-31   Synechocystis sp. PCC 6803
gb:BX571965_791211 Burkholderia pseudomallei strain K96243, chro...   137   3e-31   
gb:BX572605_803550 Rhodopseudomonas palustris CGA009 complete ge...   137   3e-31   
pir|F70968|F70968 hypothetical protein Rv2674 - Mycobacterium tu...   137   3e-31   Mycobacterium tuberculosis
gb:BX569689_774918 Synechococcus sp. WH8102 complete genome; seg...   136   4e-31   
gb:CR555306_105872 Azoarcus sp. EbN1 complete genome.                 136   4e-31   
sp|Q9KQK0|MSRB_VIBCH|MSRB_VIBCH Peptide methionine sulfoxide reductase msrB...   136   4e-31   
gb:D90821_123005 E.coli genomic DNA, Kohara clone #330(39.9-40.3...   135   1e-30   
sp|Q87MS5|MSRB_VIBPA|MSRB_VIBPA Peptide methionine sulfoxide reductase msrB...   135   1e-30   
gb:BX571867_787414 Photorhabdus luminescens subsp. laumondii TTO...   135   1e-30   
pir|G82223|G82223 PilB-related protein VC1236 [imported] - Vibri...   135   1e-30   Vibrio cholerae
gb:AE017237_413499 Mycobacterium avium subsp. paratuberculosis s...   134   2e-30   
gb:CP000020_871090 Vibrio fischeri ES114 chromosome I, complete ...   134   2e-30   
pir|H84294|H84294 transcription regulator [imported] - Halobacte...   134   3e-30   Halobacterium salinarum
gb:AE017282_428685 Methylococcus capsulatus str. Bath, complete ...   133   4e-30   
gb:CP000021_872756 Vibrio fischeri ES114 chromosome II, complete...   133   5e-30   
gb:CR378671_95957 Photobacterium profundum SS9; segment 9/12.         132   1e-29   
gb:BX950851_841083 Erwinia carotovora subsp. atroseptica SCRI104...   131   1e-29   
gb:BA000032_708747 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   131   1e-29   
gb:AY458631_619193 Uncultured bacterium 159 clone EBAC750-03B02 ...   131   1e-29   
gb:AE013819_300468 Yersinia pestis KIM section 219 of 415 of the...   131   1e-29   
sp|Q8ZEK7|MSRB_YERPE|MSRB_YERPE Peptide methionine sulfoxide reductase msrB...   131   1e-29   Yersinia pestis
gb:AY223143_1176607 Schistosoma japonicum clone ZZD1489 mRNA seq...   131   2e-29   
gb:BA000012_669022 Mesorhizobium loti MAFF303099 DNA, complete g...   131   2e-29   
gb:AE016807_337712 Vibrio vulnificus CMCP6 chromosome I section ...   130   3e-29   
sp|Q8D849|MSRB_VIBVU|MSRB_VIBVU Peptide methionine sulfoxide reductase msrB...   130   3e-29   Vibrio vulnificus
pir|C82439|C82439 peptide methionine sulfoxide reductase VCA0615...   130   4e-29   Vibrio cholerae
sp|Q9KLX6|MSAB_VIBCH|MSAB_VIBCH Peptide methionine sulfoxide reductase msrA...   130   4e-29   Vibrio cholerae
gb:BA000037_721974 Vibrio vulnificus YJ016 DNA, chromosome I, co...   129   5e-29   
gb:BA000036_719625 Corynebacterium glutamicum ATCC 13032 DNA, co...   129   7e-29   
gb:AE016822_340775 Leifsonia xyli subsp. xyli str. CTCB07, compl...   129   9e-29   
sp|P45213|MSAB_HAEIN|MSAB_HAEIN Peptide methionine sulfoxide reductase msrA...   128   1e-28   Haemophilus influenzae
gb:AE012789_285593 Chlorobium tepidum TLS section 10 of 194 of t...   128   2e-28   
gb:AE017041_385561 Bacillus anthracis str. Ames section 18 of 18...   127   2e-28   
sp|Q9AL99|MSAB_ACTAC|MSAB_ACTAC Peptide methionine sulfoxide reductase msrA...   127   2e-28   Aggregatibacter actinomycetemcomitans
gb:CP000001_855721 Bacillus cereus ZK, complete genome.               127   3e-28   
gb:AP006840_568950 Symbiobacterium thermophilum DNA, complete ge...   127   3e-28   
gb:AE017355_466401 Bacillus thuringiensis serovar konkukian str....   127   3e-28   
gb:AE017340_457285 Idiomarina loihiensis L2TR, complete genome.       127   3e-28   
gb:AE017311_438830 Desulfovibrio vulgaris subsp. vulgaris str. H...   127   3e-28   
gb:AE017281_426768 Bacillus cereus ATCC 10987, section 18 of 18 ...   127   3e-28   
gb:AE017340_457026 Idiomarina loihiensis L2TR, complete genome.       127   3e-28   
gb:AE017015_380254 Bacillus cereus ATCC 14579 section 18 of 18 o...   126   6e-28   
gb:CR628336_111219 Legionella pneumophila str. Paris complete ge...   125   8e-28   
pir|T35853|T35853 probable oxidoreductase - Streptomyces coelico...   125   1e-27   Streptomyces coelicolor
gb:AY596297_631648 Haloarcula marismortui ATCC 43049 chromosome ...   125   1e-27   
gb:BA000040_734115 Bradyrhizobium japonicum USDA 110 DNA, comple...   124   2e-27   
gb:BA000012_669677 Mesorhizobium loti MAFF303099 DNA, complete g...   124   2e-27   
gb:AE014297_1138919 Drosophila melanogaster chromosome 3R, compl...   124   2e-27   
gb:AE014297_1138917 Drosophila melanogaster chromosome 3R, compl...   124   2e-27   
gb:AE017354_459477 Legionella pneumophila subsp. pneumophila str...   124   2e-27   
sp|P54155|MSRB_BACSU|MSRB_BACSU Peptide methionine sulfoxide reductase msrB...   124   2e-27   Bacillus subtilis
sp|Q9CMB1|MSRB_PASMU|MSRB_PASMU Peptide methionine sulfoxide reductase msrB...   124   3e-27   Pasteurella multocida
gb:BA000038_725621 Vibrio vulnificus YJ016 DNA, chromosome II, c...   123   4e-27   
gb:AY142897_592080 Heliobacillus mobilis Peptide methionine sulf...   123   4e-27   
gb:AE017283_430848 Propionibacterium acnes KPA171202, complete g...   123   4e-27   
gb:AE016811_338735 Vibrio vulnificus CMCP6 chromosome II section...   123   4e-27   
gb:BX842649_824287 Bdellovibrio bacteriovorus complete genome, s...   123   5e-27   
gb:AE017354_460451 Legionella pneumophila subsp. pneumophila str...   123   5e-27   
gb:AP006618_560132 Nocardia farcinica IFM 10152 DNA, complete ge...   122   6e-27   
gb:AY669149_1345397 Schistosoma mansoni methionine sulfoxide red...   122   8e-27   
gb:BA000030_700091 Streptomyces avermitilis MA-4680 genomic DNA,...   121   1e-26   
gb:CR522870_100072 Desulfotalea psychrophila LSv54 chromosome.        121   1e-26   
sp|Q9RUK6|MSRB_DEIRA|MSRB_DEIRA Peptide methionine sulfoxide reductase msrB...   121   1e-26   Deinococcus radiodurans
gb:CR382129_1661533 Yarrowia lipolytica chromosome C of strain C...   121   2e-26   
gb:AE014297_1138922 Drosophila melanogaster chromosome 3R, compl...   121   2e-26   
gb:AP006627_564066 Bacillus clausii KSM-K16 DNA, complete genome.     121   2e-26   
gb:AE017179_398188 Porphyromonas gingivalis W83 section 8 of 8 o...   121   2e-26   
sp|Q8XJZ6|MSRB_CLOPE|MSRB_CLOPE Peptide methionine sulfoxide reductase msrB...   121   2e-26   Clostridium perfringens
sp|Q92Y46|MSB2_RHIME|MSB2_RHIME Peptide methionine sulfoxide reductase msrB...   121   2e-26   Sinorhizobium meliloti
gb:BT001621_1356394 Drosophila melanogaster RE36040 full insert ...   120   2e-26   
gb:AP008231_580856 Synechococcus elongatus PCC 6301 DNA, complet...   120   2e-26   
gb:AP006841_574093 Bacteroides fragilis YCH46 DNA, complete genome.   120   2e-26   
gb:BX248358_762670 Corynebacterium diphtheriae gravis NCTC13129,...   120   4e-26   
gb:BA000035_716574 Corynebacterium efficiens YS-314 DNA, complet...   120   4e-26   
gb:AE017333_448144 Bacillus licheniformis DSM 13, complete genom...   120   4e-26   
gb:AE017154_392716 Haemophilus ducreyi strain 35000HP section 4 ...   120   4e-26   
gb:SME591783_184459 Sinorhizobium meliloti 1021 complete chromos...   119   5e-26   
gb:AY316747_609057 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...   118   1e-25   
gb:AE014297_1138921 Drosophila melanogaster chromosome 3R, compl...   118   2e-25   
gb:AE014297_1138918 Drosophila melanogaster chromosome 3R, compl...   118   2e-25   
sp|Q8INK9|MSRB_DROME|MSRB_DROME Methionine-R-sulfoxide reductase (EC 1.8.4....   118   2e-25   Drosophila melanogaster
gb:CR382134_1666984 Debaryomyces hansenii chromosome B of strain...   117   2e-25   
gb:AY458645_619842 Uncultured bacterium 577 clone EBAC080-L12H07...   117   3e-25   
sp|Q9KCX2|MSRB_BACHD|MSRB_BACHD Peptide methionine sulfoxide reductase msrB...   117   3e-25   Bacillus halodurans
gb:BX842648_823743 Bdellovibrio bacteriovorus complete genome, s...   116   5e-25   
gb:BT001854_1356627 Drosophila melanogaster RH61230 full insert ...   115   8e-25   
sp|Q97IU0|MSRB_CLOAB|MSRB_CLOAB Peptide methionine sulfoxide reductase msrB...   115   1e-24   Clostridium acetobutylicum
gb:AF053709_473680 Helicobacter pylori peptide methionine sulfox...   115   1e-24   
sp|O25011|MSAB_HELPY|MSAB_HELPY Peptide methionine sulfoxide reductase msrA...   115   1e-24   Helicobacter pylori
sp|Q9ZMK8|MSAB_HELPJ|MSAB_HELPJ Peptide methionine sulfoxide reductase msrA...   115   1e-24   Helicobacter pylori J99
pir|A97944|A97944 peptide methionine sulfoxide reductase homolog...   114   2e-24   Streptococcus pneumoniae R6
sp|Q97RX3|MAB2_STRPN|MAB2_STRPN Peptide methionine sulfoxide reductase msrA...   114   2e-24   Streptococcus pneumoniae
gb:AE013598_294391 Xanthomonas oryzae pv. oryzae KACC10331, comp...   114   3e-24   
gb:CR376602_93286 plasmid pFBAOT6 from Aeromonas punctata (Aerom...   114   3e-24   
gb:AE017342_1755162 Cryptococcus neoformans var. neoformans JEC2...   113   5e-24   
pir|G85060|G85060 hypothetical protein AT4g04830 [imported] - Ar...   113   5e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AE016819_1749544 Ashbya gossypii (= Eremothecium gossypii) AT...   112   7e-24   
gb:CP000009_862355 Gluconobacter oxydans 621H, complete genome.       112   7e-24   
gb:AE017354_460463 Legionella pneumophila subsp. pneumophila str...   112   9e-24   
pir|JC7624|JC7624 hypothetical 14.2K protein - yeast (Pichia pas...   112   9e-24   Komagataella pastoris
gb:AY085655_1570723 Arabidopsis thaliana clone 16643 mRNA, compl...   112   1e-23   
gb:AY051078_1562550 Arabidopsis thaliana unknown protein (At4g21...   112   1e-23   
gb:AE012019_278605 Xanthomonas axonopodis pv. citri str. 306, se...   112   1e-23   
sp|P34436|YL56_CAEEL|YL56_CAEEL Hypothetical 17.2 kDa protein F44E2.6 in ch...   112   1e-23   Caenorhabditis elegans [roundworm]
gb:AE016936_361867 Bacteroides thetaiotaomicron VPI-5482, sectio...   111   1e-23   
gb:AE012486_282877 Xanthomonas campestris pv. campestris str. AT...   111   1e-23   
gb:AY224463_1590665 Oryza sativa (japonica cultivar-group) isola...   111   2e-23   
gb:AC120991_1740107 Oryza sativa (japonica cultivar-group) chrom...   110   3e-23   
gb:AE010590_264700 Fusobacterium nucleatum subsp. nucleatum ATCC...   110   3e-23   
gb:T4B21_1724077 Arabidopsis thaliana BAC T4B21.                      109   6e-23   
pir|D85060|D85060 hypothetical protein AT4g04800 [imported] - Ar...   109   6e-23   Arabidopsis thaliana [mouse-ear cress]
sp|Q9A6B1|MSRB_CAUCR|MSRB_CAUCR Peptide methionine sulfoxide reductase msrB...   109   7e-23   Caulobacter vibrioides
gb:BT004230_1637323 Arabidopsis thaliana clone RAFL16-01-H09 (R5...   108   1e-22   
gb:AY086368_1571417 Arabidopsis thaliana clone 24573 mRNA, compl...   108   1e-22   
gb:AE010532_264095 Fusobacterium nucleatum subsp. nucleatum ATCC...   108   1e-22   
sp|Q9XB39|MSRB_ENTFA|MSRB_ENTFA Peptide methionine sulfoxide reductase msrB...   108   1e-22   Enterococcus faecalis
gb:AE004969_61695 Neisseria gonorrhoeae FA 1090, complete genome.     108   1e-22   
gb:AP006878_575971 Thermococcus kodakaraensis strain KOD1 DNA, c...   108   2e-22   
gb:CR382123_1655518 Kluyveromyces lactis strain NRRL Y-1140 chro...   107   3e-22   
gb:AY085310_1570382 Arabidopsis thaliana clone 14462 mRNA, compl...   107   3e-22   
gb:AY072355_1567172 Arabidopsis thaliana putative protein (At4g2...   107   3e-22   
gb:BA000028_696121 Oceanobacillus iheyensis HTE831 DNA, complete...   107   3e-22   
gb:AE017248_415759 Treponema denticola ATCC 35405, section 3 of ...   107   3e-22   
gb:EFA243482_135107 Enterococcus faecalis csrA gene.                  107   3e-22   
pir|T05465|T05465 hypothetical protein T8O5.40 - Arabidopsis tha...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
pir|T05466|T05466 hypothetical protein T8O5.50 - Arabidopsis tha...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
sp|Q87AJ9|MSRB_XYLFT|MSRB_XYLFT Peptide methionine sulfoxide reductase msrB...   107   3e-22   Xylella fastidiosa
sp|Q9PF29|MSRB_XYLFA|MSRB_XYLFA Peptide methionine sulfoxide reductase msrB...   107   3e-22   Xylella fastidiosa
sp|P14930|MSAB_NEIGO|MSAB_NEIGO Peptide methionine sulfoxide reductase msrA...   107   3e-22   Neisseria gonorrhoeae
sp|Q9JWM8|MSAB_NEIMA|MSAB_NEIMA Peptide methionine sulfoxide reductase msrA...   107   4e-22   Neisseria meningitidis
sp|Q9K1N8|MSAB_NEIMB|MSAB_NEIMB Peptide methionine sulfoxide reductase msrA...   106   5e-22   Neisseria meningitidis
gb:CP000003_861228 Streptococcus pyogenes MGAS10394, complete ge...   105   8e-22   
gb:AE010071_259022 Streptococcus pyogenes strain MGAS8232, secti...   105   8e-22   
gb:AE006588_220470 Streptococcus pyogenes M1 GAS, section 117 of...   105   8e-22   
sp|Q99YT1|MSAB_STRPY|MSAB_STRPY Peptide methionine sulfoxide reductase msrA...   105   8e-22   Streptococcus pyogenes
sp|Q8P046|MSAB_STRP8|MSAB_STRP8 Peptide methionine sulfoxide reductase msrA...   105   8e-22   Streptococcus pyogenes
gb:AE014160_304744 Streptococcus pyogenes MGAS315, section 25 of...   105   1e-21   
sp|Q938P0|MSAB_STRP3|MSAB_STRP3 Peptide methionine sulfoxide reductase msrA...   105   1e-21   Streptococcus pyogenes
gb:BX321861_774029 Nitrosomonas europaea ATCC 19718, complete ge...   104   2e-21   
gb:AE016822_339827 Leifsonia xyli subsp. xyli str. CTCB07, compl...   104   2e-21   
sp|P25566|YCD3_YEAST|YCD3_YEAST Hypothetical 19.3 kDa protein in STE50 5're...   104   2e-21   Saccharomyces cerevisiae [brewer's yeast]
sp|Q8YBR7|MSRB_BRUME|MSRB_BRUME Peptide methionine sulfoxide reductase msrB...   104   2e-21   
gb:BT005459_1638399 Arabidopsis thaliana clone U51274 unknown pr...   104   2e-21   
pir|H85060|H85060 hypothetical protein AT4g04840 [imported] - Ar...   104   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AY588242_630455 Lactobacillus sakei protein methionine sulfox...   103   3e-21   
gb:CR380948_1649233 Candida glabrata strain CBS138 chromosome B ...   103   4e-21   
gb:AE016969_369745 Mycoplasma gallisepticum strain R section 3 o...   103   4e-21   
gb:AE012887_286750 Chlorobium tepidum TLS section 108 of 194 of ...   102   9e-21   
gb:CP000003_860723 Streptococcus pyogenes MGAS10394, complete ge...   102   1e-20   
pir|E85060|E85060 hypothetical protein AT4g04810 [imported] - Ar...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
sp|Q8P172|MSRB_STRP8|MSRB_STRP8 Peptide methionine sulfoxide reductase msrB...   102   1e-20   Streptococcus pyogenes serotype M18
sp|Q88W33|MSRB_LACPL|MSRB_LACPL Peptide methionine sulfoxide reductase msrB...   102   1e-20   Lactobacillus plantarum
sp|Q8K7M6|MSRB_STRP3|MSRB_STRP3 Peptide methionine sulfoxide reductase msrB...   101   2e-20   Streptococcus pyogenes serotype M3
sp|Q9LAM9|MSAB_STRGC|MSAB_STRGC Peptide methionine sulfoxide reductase msrA...   101   2e-20   Streptococcus gordonii str. Challis
gb:CP000024_877131 Streptococcus thermophilus CNRZ1066, complete...   101   2e-20   
gb:AE017328_444308 Listeria monocytogenes str. 4b F2365, section...   101   2e-20   
sp|Q8Y641|MSRB_LISMO|MSRB_LISMO Peptide methionine sulfoxide reductase msrB...   101   2e-20   
sp|Q93KF3|MSAB_CAMFE|MSAB_CAMFE Peptide methionine sulfoxide reductase msrA...   101   2e-20   Campylobacter fetus
gb:AY204469_597174 Myxococcus xanthus clone C1213 putative histi...   100   3e-20   
gb:AE017308_437854 Mycoplasma mobile 163K complete genome.            100   3e-20   
gb:CP000023_875220 Streptococcus thermophilus LMG 18311, complet...   100   4e-20   
sp|Q99ZV6|MSRB_STRPY|MSRB_STRPY Peptide methionine sulfoxide reductase msrB...   100   4e-20   Streptococcus pyogenes
sp|Q9ZNJ9|MSRB_CLOHI|MSRB_CLOHI Peptide methionine sulfoxide reductase msrB...   100   6e-20   Hathewaya histolytica
sp|Q92AE9|MSRB_LISIN|MSRB_LISIN Peptide methionine sulfoxide reductase msrB...    99   1e-19   
gb:AE017204_404544 Lactobacillus johnsonii NCC 533, section 5 of...    98   2e-19   
gb:AY602216_635495 Lactobacillus reuteri methionine sulfoxide re...    98   2e-19   
gb:AE017332_445802 Mycoplasma hyopneumoniae 232, complete genome.      98   2e-19   
gb:CP000031_87733 Silicibacter pomeroyi DSS-3, complete genome.        98   2e-19   
sp|P47686|MSRB_MYCGE|MSRB_MYCGE Peptide methionine sulfoxide reductase msrB...    98   2e-19   Mycoplasma genitalium
gb:SAG766848_170448 Streptococcus agalactiae NEM316 complete gen...    97   3e-19   
gb:AJ749949_531562 Francisella tularensis subsp. tularensis comp...    97   5e-19   
sp|Q9CJ17|MSRB_LACLA|MSRB_LACLA Peptide methionine sulfoxide reductase msrB...    96   8e-19   Lactococcus lactis subsp. lactis
gb:AE014295_311937 Bifidobacterium longum NCC2705, complete genome.    96   1e-18   
sp|P75129|MSRB_MYCPN|MSRB_MYCPN Peptide methionine sulfoxide reductase msrB...    96   1e-18   Mycoplasma pneumoniae
gb:CP000033_89614 Lactobacillus acidophilus NCFM, complete genome.     95   1e-18   
gb:T4B21_1724080 Arabidopsis thaliana BAC T4B21.                       95   2e-18   
pir|B90575|B90575 hypothetical protein MYPU_5060 [imported] - My...    95   2e-18   Mycoplasma pulmonis
pir|T39910|T39910 conserved hypothetical protein SPBC216.04c - f...    94   3e-18   Schizosaccharomyces pombe
gb:BX294136_766180 Pirellula sp. strain 1 complete genome; segme...    93   7e-18   
gb:AY248842_602256 Staphylococcus sp. MRCNS378 trimethoprim-resi...    92   9e-18   
sp|Q8CSK6|MSRB_STAEP|MSRB_STAEP Peptide methionine sulfoxide reductase msrB...    92   9e-18   Staphylococcus epidermidis
gb:SPU41735_189536 Streptococcus pneumoniae peptide methionine s...    91   2e-17   
sp|P35593|MAB1_STRPN|MAB1_STRPN Peptide methionine sulfoxide reductase msrA...    91   2e-17   Streptococcus pneumoniae
pir|S02018|S02018 regulatory protein pilB - Neisseria gonorrhoea...    91   3e-17   Neisseria gonorrhoeae
sp|Q99U64|MSRB_STAAM|MSRB_STAAM Peptide methionine sulfoxide reductase msrB...    91   3e-17   Staphylococcus aureus
sp|Q93P62|MSRB_STAAW|MSRB_STAAW Peptide methionine sulfoxide reductase msrB...    91   4e-17   Staphylococcus aureus
sp|O83641|MSAB_TREPA|MSAB_TREPA Peptide methionine sulfoxide reductase msrB...    91   4e-17   Treponema pallidum
gb:AE015700_316957 Shewanella oneidensis MR-1 section 249 of 457...    89   1e-16   
gb:AE016964_368502 Coxiella burnetii strain RSA 493, section 5 o...    84   3e-15   
gb:CP000025_878996 Campylobacter jejuni RM1221, complete genome.       84   3e-15   
gb:BX908798_830520 Parachlamydia-related symbiont UWE25, complet...    84   4e-15   
pir|C81315|C81315 hypothetical protein Cj1112c [imported] - Camp...    84   4e-15   Campylobacter jejuni
gb:AE017354_461240 Legionella pneumophila subsp. pneumophila str...    83   6e-15   
gb:CR628337_116032 Legionella pneumophila str. Lens complete gen...    83   6e-15   
gb:CR628336_113094 Legionella pneumophila str. Paris complete ge...    83   6e-15   
gb:MC063_142999 M.capricolum DNA for CONTIG MC063.                     82   2e-14   
pir|S77828|S77828 probable transcription repressor MC063 - Mycop...    82   2e-14   Mycoplasma capricolum
gb:AE017148_391169 Helicobacter hepaticus ATCC 51449 section 5 o...    81   2e-14   
gb:BX842644_822776 Mycoplasma mycoides subsp. mycoides SC genomi...    81   3e-14   
gb:AY383491_1604105 Brassica rapa subsp. pekinensis clone ET39 u...    78   2e-13   
pir|T05467|T05467 hypothetical protein T8O5.60 - Arabidopsis tha...    76   7e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AL139281_1920504 Human DNA sequence from clone RP11-215C7 on ...    75   2e-12   
gb:HSM806988_2018518 Homo sapiens mRNA; cDNA DKFZp686C1178 (from...    61   3e-08   
sp|Q9NZV6|MSRX_HUMAN|MSRX_HUMAN Methionine-R-sulfoxide reductase (EC 1.8.4....    57   4e-07   Homo sapiens [man]
sp|Q9JLC3|MSRX_MOUSE|MSRX_MOUSE Methionine-R-sulfoxide reductase (EC 1.8.4....    54   5e-06   Mus musculus [mouse]
gb:BC081680_2562468 Danio rerio zgc:92822, mRNA (cDNA clone MGC:...    52   1e-05   
gb:AJ620476_1283336 Suberites sp. S29 partial mRNA for putative ...    51   2e-05   
gb:AY137521_591593 Streptococcus equi strain CF32 putative cytoc...    49   2e-04   
gb:AGA535208_1281953 Anopheles gambiae mRNA for SMC6 protein.          47   3e-04   
gb:AE006640_1875684 Homo sapiens 16p13.3 sequence section 8 of 8...    44   0.003   
gb:CR859820_1183922 Pongo pygmaeus mRNA; cDNA DKFZp469G2418 (fro...    44   0.004   
gb:AF161388_1150281 Homo sapiens HSPC270 mRNA, partial cds.            43   0.006   
gb:BC075488_2558591 Xenopus tropicalis MGC89326 protein, mRNA (c...    42   0.011   
gb:BC067380_2554712 Danio rerio selenoprotein X, 1, mRNA (cDNA c...    42   0.019   
gb:AY216585_2519623 Danio rerio methionine R-sulfoxide reductase...    42   0.019   
gb:AK002339_1151132 Mus musculus adult male kidney cDNA, RIKEN f...    41   0.032   


>pir|H96576|H96576 hypothetical protein F22G10.17 [imported] -
           Arabidopsis thaliana>gb:AE005173_893266 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539292 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.
          Length = 202

 Score =  244 bits (623), Expect(2) = 2e-67
 Identities = 106/131 (80%), Positives = 122/131 (93%)
 Frame = -1

Query: 560 EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE 381
           E    +F+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+CVCCDTPLF+
Sbjct: 64  EAEKNEFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCVCCDTPLFD 123

Query: 380 SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK 201
           SSTKFDSGTGWPSYY+P+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct: 124 SSTKFDSGTGWPSYYQPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK 183

Query: 200 RYCINSAALKL 168
           RYC+NSAALKL
Sbjct: 184 RYCLNSAALKL 194



 Score = 35.0 bits (79), Expect(2) = 2e-67
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = -3

Query: 726 SFNKPRNKVSFLIRGMGSSASSPKPDSAQ 640
           S +KPRN +S  +  MGSS+SSPKPD+ Q
Sbjct: 36  SLSKPRN-LSLSVYSMGSSSSSPKPDNVQ 63



>gb:AY087664_1572693 Arabidopsis thaliana clone 3748 mRNA, complete
           sequence.>gb:AK117314_1815354 Arabidopsis thaliana
           At1g53670 mRNA for putative transcriptional regulator,
           complete cds, clone: RAFL16-88-B20.
          Length = 153

 Score =  244 bits (623), Expect(2) = 4e-65
 Identities = 106/131 (80%), Positives = 122/131 (93%)
 Frame = -1

Query: 560 EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE 381
           E    +F+S+S+ EWKKRLT +Q+YITRQKGTERAFTGEYW++KTPG Y+CVCCDTPLF+
Sbjct: 15  EAEKNEFASLSENEWKKRLTPEQYYITRQKGTERAFTGEYWNSKTPGVYNCVCCDTPLFD 74

Query: 380 SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK 201
           SSTKFDSGTGWPSYY+P+GNNVK+KLDLSIIFMPRQEV+CA C+AHLGHVFDDGP PTGK
Sbjct: 75  SSTKFDSGTGWPSYYQPIGNNVKTKLDLSIIFMPRQEVVCAVCNAHLGHVFDDGPRPTGK 134

Query: 200 RYCINSAALKL 168
           RYC+NSAALKL
Sbjct: 135 RYCLNSAALKL 145



 Score = 27.3 bits (59), Expect(2) = 4e-65
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -3

Query: 681 MGSSASSPKPDSAQ 640
           MGSS+SSPKPD+ Q
Sbjct: 1   MGSSSSSPKPDNVQ 14



>gb:AP003545_1830714 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0613F06.
          Length = 160

 Score =  243 bits (621), Expect = 3e-63
 Identities = 107/125 (85%), Positives = 118/125 (94%)
 Frame = -1

Query: 539 SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS 360
           +S++DEEW+KRLT  Q+YITRQKGTERAFTGEYW+TKTPG YHCVCCDTPLFESSTKFDS
Sbjct: 33  TSLTDEEWRKRLTKDQYYITRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLFESSTKFDS 92

Query: 359 GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA 180
           GTGWPSYY+P+G+NVK KLD+SIIFMPR EVLCA CDAHLGHVFDDGP PTGKRYCINSA
Sbjct: 93  GTGWPSYYQPIGDNVKCKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPRPTGKRYCINSA 152

Query: 179 ALKLK 165
           +LKLK
Sbjct: 153 SLKLK 157



>gb:AP008231_581602 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 140

 Score =  181 bits (459), Expect = 2e-44
 Identities = 80/122 (65%), Positives = 97/122 (79%), Gaps = 1/122 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+EEW+ +LT +QF +TR+ GTERAFTG YWDTK PG Y C+CCD PLF S TKFDSGTG
Sbjct: 8   SEEEWRAQLTPEQFQVTRKHGTERAFTGAYWDTKDPGLYRCICCDAPLFRSDTKFDSGTG 67

Query: 350 WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS++ PV  + +  K D S + M R E+LCA CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct: 68  WPSFWAPVDESAITYKKDFSFLMM-RTEILCARCDAHLGHVFPDGPKPTGQRYCLNSASL 126

Query: 173 KL 168
           KL
Sbjct: 127 KL 128



>sp|Q8DJK9|MSRB_SYNEL Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:BA000039_726998 Thermosynechococcus
           elongatus BP-1 DNA, complete genome.
          Length = 135

 Score =  178 bits (451), Expect = 1e-43
 Identities = 81/125 (64%), Positives = 99/125 (79%), Gaps = 1/125 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+ +LT +Q+Y+TR+KGTERAFTG YW+ K PG Y CVCC TPLF S TK+DSGTG
Sbjct: 7   TDAEWQAQLTPEQYYVTRKKGTERAFTGCYWNNKKPGLYSCVCCGTPLFRSETKYDSGTG 66

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+++P+  NN++ + DLS   M R EVLCA CDAHLGHVF+DGP PTG RYCINSAAL
Sbjct: 67  WPSFWQPLDPNNIRMERDLS-HGMVRTEVLCAVCDAHLGHVFEDGPPPTGLRYCINSAAL 125

Query: 173 KLKPK 159
              P+
Sbjct: 126 AFVPE 130



>gb:BA000045_744094 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 149

 Score =  176 bits (445), Expect = 6e-43
 Identities = 85/133 (63%), Positives = 101/133 (75%), Gaps = 1/133 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+ EWKK LT +QF ITR+KGTERAFTG+Y DTK  G Y CVCC+TPLF S+ K+DSGTG
Sbjct: 8   SEAEWKKILTPEQFLITRKKGTERAFTGKYHDTKQAGIYQCVCCETPLFSSAQKYDSGTG 67

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS++ PV   N+ +K D S +FM R EVLCA CDAH GH+F+DGP PTG RYCINSAAL
Sbjct: 68  WPSFWGPVNPKNIATKADFS-LFMRRTEVLCAVCDAHQGHLFNDGPPPTGLRYCINSAAL 126

Query: 173 KLKPK*EVSKGGQ 135
           K      VS+ G+
Sbjct: 127 KFVKLPLVSRLGR 139



>gb:BX640433_811586 Bordetella parapertussis strain 12822, complete
           genome; segment 11/14.>gb:BX640448_816449 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           12/16.
          Length = 133

 Score =  167 bits (424), Expect = 2e-40
 Identities = 76/124 (61%), Positives = 93/124 (75%), Gaps = 1/124 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+ +LT +++ + RQKGTERAF+G YWDT TPG Y C+ C TPLF S TKFD+G G
Sbjct: 7   TDAEWRTQLTPEEYAVARQKGTERAFSGRYWDTSTPGIYRCIGCGTPLFASDTKFDAGCG 66

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPSY++P+    V+ +LD S   M R EVLC  CDAHLGHVF DGPEPTG RYCINS +L
Sbjct: 67  WPSYFEPLAPERVREELDTS-HGMVRTEVLCNICDAHLGHVFPDGPEPTGLRYCINSLSL 125

Query: 173 KLKP 162
           K +P
Sbjct: 126 KFEP 129



>gb:BX640421_807951 Bordetella pertussis strain Tohama I, complete
           genome; segment 11/12.
          Length = 133

 Score =  166 bits (419), Expect = 7e-40
 Identities = 75/124 (60%), Positives = 92/124 (74%), Gaps = 1/124 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+ +L  +++ + RQKGTERAF+G YWDT TPG Y C+ C TPLF S TKFD+G G
Sbjct: 7   TDAEWRTQLAPEEYAVARQKGTERAFSGRYWDTSTPGIYRCIGCGTPLFASDTKFDAGCG 66

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPSY++P+    V+ +LD S   M R EVLC  CDAHLGHVF DGPEPTG RYCINS +L
Sbjct: 67  WPSYFEPLAPERVREELDTS-HGMVRTEVLCNICDAHLGHVFPDGPEPTGLRYCINSLSL 125

Query: 173 KLKP 162
           K +P
Sbjct: 126 KFEP 129



>gb:AY657350_2146360 Synthetic construct Peudomonas aeruginosa clone
           FLH042872.01F PA2827 gene, partial cds.
          Length = 133

 Score =  162 bits (411), Expect = 6e-39
 Identities = 74/122 (60%), Positives = 88/122 (72%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           + W++ LT +QF+I R  GTERAF+GEY  TKTPG YHC CC T LF+S  K+DSG+GWP
Sbjct: 9   DSWREELTEEQFHICRLGGTERAFSGEYHATKTPGIYHCTCCGTALFDSDAKYDSGSGWP 68

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
           SY++PV      +LD     M R EV C  CDAHLGHVF DGP PTG RYCINSA+LKL 
Sbjct: 69  SYFQPVDAEAVRELDDFSHGMHRIEVRCGRCDAHLGHVFPDGPRPTGLRYCINSASLKLV 128

Query: 164 PK 159
           P+
Sbjct: 129 PR 130



>sp|Q9I016|MSRB_PSEAE Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|A83293|A83293 conserved hypothetical
           protein PA2827 [imported] - Pseudomonas aeruginosa
           (strain PAO1)>gb:AE004709_57063 Pseudomonas aeruginosa
           PAO1, section 270 of 529 of the complete
           genome.>gb:AE004091_971163 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 132

 Score =  162 bits (411), Expect = 6e-39
 Identities = 74/122 (60%), Positives = 88/122 (72%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           + W++ LT +QF+I R  GTERAF+GEY  TKTPG YHC CC T LF+S  K+DSG+GWP
Sbjct: 9   DSWREELTEEQFHICRLGGTERAFSGEYHATKTPGIYHCTCCGTALFDSDAKYDSGSGWP 68

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
           SY++PV      +LD     M R EV C  CDAHLGHVF DGP PTG RYCINSA+LKL 
Sbjct: 69  SYFQPVDAEAVRELDDFSHGMHRIEVRCGRCDAHLGHVFPDGPRPTGLRYCINSASLKLV 128

Query: 164 PK 159
           P+
Sbjct: 129 PR 130



>gb:AE017180_400744 Geobacter sulfurreducens PCA, complete genome.
          Length = 137

 Score =  160 bits (406), Expect = 2e-38
 Identities = 75/122 (61%), Positives = 93/122 (76%), Gaps = 1/122 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D +W+ +LT +Q+ ITR+KGTE AFTG YWD    GTY CVCC  PLF+S+ KFDSGTG
Sbjct: 8   TDAQWRGQLTPEQYEITRRKGTEPAFTGAYWDCHDRGTYRCVCCGAPLFDSADKFDSGTG 67

Query: 350 WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+  P+ G+ V+S+ D S  FM R EV CA+C AHLGH+F DGP PTG+RYCINSA+L
Sbjct: 68  WPSFTAPLDGDGVESEEDRS-FFMHRTEVHCASCGAHLGHLFPDGPAPTGRRYCINSASL 126

Query: 173 KL 168
            L
Sbjct: 127 VL 128



>gb:CR555306_108714 Azoarcus sp. EbN1 complete genome.
          Length = 146

 Score =  160 bits (404), Expect = 4e-38
 Identities = 75/137 (54%), Positives = 95/137 (69%), Gaps = 1/137 (0%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           + EW+ +LT  QF +TR+KGTERAFTGEYWD    G YHC+ C  PLF S  KFD+G GW
Sbjct: 9   EAEWRAQLTPAQFQVTREKGTERAFTGEYWDCWDKGEYHCIGCGAPLFSSEHKFDAGCGW 68

Query: 347 PSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           PS++      NV++  D S  FM R EVLC  C AHLGHVF+DGP+PTG RYCINSA+++
Sbjct: 69  PSFWTAAAPENVETAEDRS-HFMQRTEVLCHECGAHLGHVFEDGPQPTGLRYCINSASIR 127

Query: 170 LKPK*EVSKGGQEGCES 120
           L+P+   + G   G +S
Sbjct: 128 LEPEASANDGQPRGPQS 144



>gb:CR543861_103991 Acinetobacter sp. ADP1 complete genome.
          Length = 139

 Score =  160 bits (404), Expect = 4e-38
 Identities = 69/122 (56%), Positives = 91/122 (74%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++ EW++ L+ +++ ITRQKGTE AFTG+YW+TK  GTY C CC T LF S +K+DSG G
Sbjct: 7   TEREWQRELSPEEYRITRQKGTEPAFTGQYWNTKQSGTYVCRCCGTELFSSISKYDSGCG 66

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+YKP+      + D     M R E++C  CDAHLGHVF+DGP+PTG RYC+NSA+L+
Sbjct: 67  WPSFYKPINTTAIEEHDDFSHGMVRTEIVCHHCDAHLGHVFEDGPQPTGLRYCVNSASLQ 126

Query: 170 LK 165
           LK
Sbjct: 127 LK 128



>gb:BA000045_744414 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 133

 Score =  159 bits (403), Expect = 5e-38
 Identities = 75/125 (60%), Positives = 92/125 (73%), Gaps = 1/125 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD+EW+++LT +Q+ ITRQKGTER F G ++D K PG Y CVCC+ PLF +  KFDSGTG
Sbjct: 7   SDQEWRQQLTPEQYKITRQKGTERPFCGVFYDHKQPGEYTCVCCELPLFTAEAKFDSGTG 66

Query: 350 WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+  P+   NV ++ D S   M R EVLCA CDAHLGHVF DGP PT  RYC+NSAAL
Sbjct: 67  WPSFLAPINAENVATQKDFS-HGMSRVEVLCARCDAHLGHVFTDGPPPTRLRYCLNSAAL 125

Query: 173 KLKPK 159
           +  P+
Sbjct: 126 EFVPQ 130



>gb:BC021619_2093567 Mus musculus methionine sulfoxide reductase B2,
           mRNA (cDNA clone MGC:38012 IMAGE:5150285), complete cds.
          Length = 175

 Score =  159 bits (402), Expect = 6e-38
 Identities = 73/137 (53%), Positives = 96/137 (70%), Gaps = 8/137 (5%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K   S+S+ +W+K+LT +QFY+TR+KGTE  F+G Y + K  G YHCVCCD+PLF S  K
Sbjct: 37  KSKRSLSEADWQKKLTPEQFYVTREKGTEAPFSGMYLNNKETGMYHCVCCDSPLFSSEKK 96

Query: 368 FDSGTGWPSYYKPVGN--------NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPE 213
           + SGTGWPS+ +  G+         +  +LD S +  PR EV+C  C+AHLGHVF DGP+
Sbjct: 97  YCSGTGWPSFSEAYGSKGSDESHTGILRRLDTS-LGCPRMEVVCKQCEAHLGHVFPDGPK 155

Query: 212 PTGKRYCINSAALKLKP 162
           PTG+R+CINS ALK KP
Sbjct: 156 PTGQRFCINSVALKFKP 172



>sp|O26807|MSRB_METTH Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|A69195|A69195 transcription regulator
           - Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000850_28412 Methanobacterium
           thermoautotrophicum from bases 631143 to 642211 (section
           56 of 148) of the complete genome.>gb:AE000666_925494
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 151

 Score =  159 bits (402), Expect = 6e-38
 Identities = 75/129 (58%), Positives = 94/129 (72%), Gaps = 1/129 (0%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           +SD+EW++ L  + F + R+ GTE  FTG+Y D    G Y C+CC T LF+S TKFDSGT
Sbjct: 23  LSDDEWREILDPEAFRVARKAGTEPPFTGKYHDLHDDGIYRCICCGTDLFDSETKFDSGT 82

Query: 353 GWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA 177
           GWPS+Y  V  +N+K + D S + M R EVLCA CDAHLGHVFDDGP PTGKRYC+NSAA
Sbjct: 83  GWPSFYDVVSEHNIKLREDRS-LGMVRCEVLCARCDAHLGHVFDDGPRPTGKRYCMNSAA 141

Query: 176 LKLKPK*EV 150
           LK  P+ ++
Sbjct: 142 LKFIPRDQI 150



>gb:BX569689_775240 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 131

 Score =  158 bits (400), Expect = 1e-37
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 1/123 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EEW++ L+ +QF + R  GTERAFTG YW+ K  GTYHC+CCD PLF S TKF+SGTG
Sbjct: 8   SPEEWRQTLSPEQFQVARCGGTERAFTGAYWNKKDSGTYHCICCDAPLFSSQTKFESGTG 67

Query: 350 WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS++  V +  + +K DLS   M R E+ CA CDAHLGHVF DGP PT +RYC+NSA+L
Sbjct: 68  WPSFWDGVSSEAITTKQDLS-HGMVRVEINCARCDAHLGHVFPDGPAPTRQRYCVNSASL 126

Query: 173 KLK 165
             K
Sbjct: 127 DFK 129



>sp|Q885Q1|MSRB_PSESM Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE016862_351212 Pseudomonas syringae
           pv. tomato str. DC3000 section 7 of 21 of the complete
           genome.>gb:AE016853_1036387 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 131

 Score =  155 bits (393), Expect = 7e-37
 Identities = 74/123 (60%), Positives = 90/123 (73%), Gaps = 1/123 (0%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           EEWK+ L   Q+ + R KGTER F+G+Y DTKT G YHC+CC+  LF+S+TKFDSG GWP
Sbjct: 9   EEWKEMLDPAQYSVCRLKGTERPFSGKYNDTKTAGVYHCICCNEALFDSTTKFDSGCGWP 68

Query: 344 SYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           S+Y P+ G+ V    D+S   M R EV+CA CDAHLGHVF DGP PTG RYCINS  L+L
Sbjct: 69  SFYAPLEGSAVVEVRDVS-HGMIRTEVVCARCDAHLGHVFPDGPPPTGLRYCINSVCLEL 127

Query: 167 KPK 159
            P+
Sbjct: 128 VPR 130



>sp|Q8XYL1|MSRB_RALSO Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AL646066_546675 Ralstonia solanacearum
           GMI1000 chromosome, complete sequence; segment 10/19.
          Length = 128

 Score =  155 bits (392), Expect = 9e-37
 Identities = 70/120 (58%), Positives = 84/120 (70%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+ +L+  ++ +TR+  TER FTG YWD    G YHCVCC TPLFESSTKFD+G G
Sbjct: 6   TDAEWRDQLSDIEYRVTREAATERPFTGRYWDHWARGIYHCVCCGTPLFESSTKFDAGCG 65

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPSY+ P+   V ++       M R EV C  C AHLGHVF+DGP PTG RYCINSAALK
Sbjct: 66  WPSYFAPINGEVIAEKTDHSHGMVRIEVQCKQCGAHLGHVFEDGPAPTGLRYCINSAALK 125



>gb:BX119963_2567060 Zebrafish DNA sequence from clone DKEY-6A5 in
           linkage group 4 Contains the 3' end of the gene for a
           novel protein similar to vertebrate glutamate receptor
           interacting protein 1 (GRIP1), the gene for a novel
           protein (zgc:64112), the gene for a novel protein
           similar to vertebrate integral inner nuclear membrane
           protein (MAN1), the gene for a novel protein similar to
           vertebrate methionine sulfoxide reductase B (MsrB)
           family, the 5' end of the gene for a novel protein
           similar to vertebrate high mobility group AT-hook 2
           (HMGA2), the wif1 gene for wnt inhibitory factor-1, two
           novel genes and a CpG island, complete sequence.
          Length = 186

 Score =  154 bits (388), Expect = 3e-36
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 4/142 (2%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +EE +KRLT  Q+++T+QKGTE AFTG+Y D K  GTYHCV C  PLF S  KFDSG+GW
Sbjct: 40  EEELRKRLTPMQYHVTQQKGTESAFTGKYVDNKEEGTYHCVVCGAPLFMSEKKFDSGSGW 99

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           PS++  +  +  ++ D     M R E  C+ C AHLGH+FDDGP PT KRYCINSA+L  
Sbjct: 100 PSFFDLINKDAIAQTDDFSYGMHRVETTCSQCGAHLGHLFDDGPRPTKKRYCINSASLSF 159

Query: 167 KPK----*EVSKGGQEGCESVA 114
           +PK     EV   G  G  S +
Sbjct: 160 QPKNSATEEVEASGAAGQSSTS 181



>gb:BX119963_2567059 Zebrafish DNA sequence from clone DKEY-6A5 in
           linkage group 4 Contains the 3' end of the gene for a
           novel protein similar to vertebrate glutamate receptor
           interacting protein 1 (GRIP1), the gene for a novel
           protein (zgc:64112), the gene for a novel protein
           similar to vertebrate integral inner nuclear membrane
           protein (MAN1), the gene for a novel protein similar to
           vertebrate methionine sulfoxide reductase B (MsrB)
           family, the 5' end of the gene for a novel protein
           similar to vertebrate high mobility group AT-hook 2
           (HMGA2), the wif1 gene for wnt inhibitory factor-1, two
           novel genes and a CpG island, complete sequence.
          Length = 200

 Score =  154 bits (388), Expect = 3e-36
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 4/142 (2%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +EE +KRLT  Q+++T+QKGTE AFTG+Y D K  GTYHCV C  PLF S  KFDSG+GW
Sbjct: 54  EEELRKRLTPMQYHVTQQKGTESAFTGKYVDNKEEGTYHCVVCGAPLFMSEKKFDSGSGW 113

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           PS++  +  +  ++ D     M R E  C+ C AHLGH+FDDGP PT KRYCINSA+L  
Sbjct: 114 PSFFDLINKDAIAQTDDFSYGMHRVETTCSQCGAHLGHLFDDGPRPTKKRYCINSASLSF 173

Query: 167 KPK----*EVSKGGQEGCESVA 114
           +PK     EV   G  G  S +
Sbjct: 174 QPKNSATEEVEASGAAGQSSTS 195



>gb:BX119963_2567058 Zebrafish DNA sequence from clone DKEY-6A5 in
           linkage group 4 Contains the 3' end of the gene for a
           novel protein similar to vertebrate glutamate receptor
           interacting protein 1 (GRIP1), the gene for a novel
           protein (zgc:64112), the gene for a novel protein
           similar to vertebrate integral inner nuclear membrane
           protein (MAN1), the gene for a novel protein similar to
           vertebrate methionine sulfoxide reductase B (MsrB)
           family, the 5' end of the gene for a novel protein
           similar to vertebrate high mobility group AT-hook 2
           (HMGA2), the wif1 gene for wnt inhibitory factor-1, two
           novel genes and a CpG island, complete sequence.
          Length = 187

 Score =  154 bits (388), Expect = 3e-36
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 4/142 (2%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +EE +KRLT  Q+++T+QKGTE AFTG+Y D K  GTYHCV C  PLF S  KFDSG+GW
Sbjct: 41  EEELRKRLTPMQYHVTQQKGTESAFTGKYVDNKEEGTYHCVVCGAPLFMSEKKFDSGSGW 100

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           PS++  +  +  ++ D     M R E  C+ C AHLGH+FDDGP PT KRYCINSA+L  
Sbjct: 101 PSFFDLINKDAIAQTDDFSYGMHRVETTCSQCGAHLGHLFDDGPRPTKKRYCINSASLSF 160

Query: 167 KPK----*EVSKGGQEGCESVA 114
           +PK     EV   G  G  S +
Sbjct: 161 QPKNSATEEVEASGAAGQSSTS 182



>gb:BC071530_2556266 Danio rerio zgc:86909, mRNA (cDNA clone
           MGC:86909 IMAGE:6905546), complete cds.
          Length = 186

 Score =  154 bits (388), Expect = 3e-36
 Identities = 74/142 (52%), Positives = 93/142 (65%), Gaps = 4/142 (2%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +EE +KRLT  Q+++T+QKGTE AFTG+Y D K  GTYHCV C  PLF S  KFDSG+GW
Sbjct: 40  EEELRKRLTPMQYHVTQQKGTESAFTGKYVDNKEEGTYHCVVCGAPLFMSEKKFDSGSGW 99

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           PS++  +  +  ++ D     M R E  C+ C AHLGH+FDDGP PT KRYCINSA+L  
Sbjct: 100 PSFFDLINKDAIAQTDDFSYGMHRVETTCSQCGAHLGHLFDDGPRPTKKRYCINSASLSF 159

Query: 167 KPK----*EVSKGGQEGCESVA 114
           +PK     EV   G  G  S +
Sbjct: 160 QPKNSATEEVEASGAAGQSSAS 181



>gb:CR859566_1183675 Pongo pygmaeus mRNA; cDNA DKFZp459F134 (from
           clone DKFZp459F134).
          Length = 185

 Score =  153 bits (386), Expect = 4e-36
 Identities = 75/139 (53%), Positives = 91/139 (65%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S +E +KRLT  Q+++T++KGTE AF GEY   K PG Y CV C TPLF+S TKFDSG+G
Sbjct: 39  SQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSG 98

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS++  + +   +  D     M R E  C+ C AHLGH+FDDGP PTGKRYCINSAAL 
Sbjct: 99  WPSFHDVISSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALS 158

Query: 170 LKPK*EVSKGGQEGCESVA 114
             P    S G  EG   VA
Sbjct: 159 FTP--ADSSGAAEGESGVA 175



>gb:AY358229_1947108 Homo sapiens clone DNA96898 SPRR1965 (UNQ1965)
           mRNA, complete cds.
          Length = 192

 Score =  152 bits (385), Expect = 6e-36
 Identities = 75/139 (53%), Positives = 91/139 (65%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S +E +KRLT  Q+++T++KGTE AF GEY   K PG Y CV C TPLF+S TKFDSG+G
Sbjct: 46  SQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSG 105

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS++  + +   +  D     M R E  C+ C AHLGH+FDDGP PTGKRYCINSAAL 
Sbjct: 106 WPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALS 165

Query: 170 LKPK*EVSKGGQEGCESVA 114
             P    S G  EG   VA
Sbjct: 166 FTP--ADSSGTAEGGSGVA 182



>gb:HSM808927_1188055 Homo sapiens mRNA; cDNA DKFZp686I14130 (from
           clone DKFZp686I14130).>gb:BC040053_1982710 Homo sapiens
           methionine sulfoxide reductase B3, mRNA (cDNA clone
           MGC:50900 IMAGE:6025598), complete cds.
          Length = 185

 Score =  152 bits (385), Expect = 6e-36
 Identities = 75/139 (53%), Positives = 91/139 (65%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S +E +KRLT  Q+++T++KGTE AF GEY   K PG Y CV C TPLF+S TKFDSG+G
Sbjct: 39  SQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSG 98

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS++  + +   +  D     M R E  C+ C AHLGH+FDDGP PTGKRYCINSAAL 
Sbjct: 99  WPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALS 158

Query: 170 LKPK*EVSKGGQEGCESVA 114
             P    S G  EG   VA
Sbjct: 159 FTP--ADSSGTAEGGSGVA 175



>gb:BX572099_798928 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 144

 Score =  152 bits (383), Expect = 1e-35
 Identities = 71/132 (53%), Positives = 89/132 (67%)
 Frame = -1

Query: 545 DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF 366
           D+  +S EEW+ RLT +Q+ + R+ GTERAFTG YW+ K  G Y CVCC  PLF S+TKF
Sbjct: 13  DWIKLSPEEWQARLTREQYQVARKGGTERAFTGAYWNHKAAGMYCCVCCGAPLFSSATKF 72

Query: 365 DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN 186
           DSGTGWPS+   V     +    +   M R E+ CA C AHLGHVF+DGP PTG+RYC+N
Sbjct: 73  DSGTGWPSFSDGVKAGAITTHRDTSHGMERTEINCARCGAHLGHVFNDGPAPTGQRYCVN 132

Query: 185 SAALKLKPK*EV 150
           SA+L    + EV
Sbjct: 133 SASLDFSEEAEV 144



>gb:AE011268_271062 Leptospira interrogans serovar lai str. 56601
           chromosome I, section 77 of 397 of the complete
           sequence.>gb:AE017298_434963 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 12 of 14 of the complete
           sequence.>gb:AE010300_1004461 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1067974 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 166

 Score =  150 bits (379), Expect = 3e-35
 Identities = 69/122 (56%), Positives = 85/122 (69%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDE+WKK LT +Q+ I RQKGTE AFTG  +  +  GTY C  C   LF S TK++SG+G
Sbjct: 43  SDEDWKKELTPEQYRILRQKGTEMAFTGALYKNQDKGTYVCAACGAVLFSSDTKYESGSG 102

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+Y+PV + V  K   S   M R E+LC+ C  HLGHVF+DGP PTG RYCINSA+LK
Sbjct: 103 WPSFYQPVKDGVVDKQKDSSHGMERTEILCSKCGGHLGHVFNDGPRPTGLRYCINSASLK 162

Query: 170 LK 165
            +
Sbjct: 163 FQ 164



>sp|Q8F7W8|MSRB_LEPIN Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).
          Length = 132

 Score =  150 bits (379), Expect = 3e-35
 Identities = 69/122 (56%), Positives = 85/122 (69%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDE+WKK LT +Q+ I RQKGTE AFTG  +  +  GTY C  C   LF S TK++SG+G
Sbjct: 9   SDEDWKKELTPEQYRILRQKGTEMAFTGALYKNQDKGTYVCAACGAVLFSSDTKYESGSG 68

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+Y+PV + V  K   S   M R E+LC+ C  HLGHVF+DGP PTG RYCINSA+LK
Sbjct: 69  WPSFYQPVKDGVVDKQKDSSHGMERTEILCSKCGGHLGHVFNDGPRPTGLRYCINSASLK 128

Query: 170 LK 165
            +
Sbjct: 129 FQ 130



>gb:AF122004_1884863 Homo sapiens pilin-like transcription factor
           mRNA, complete cds.>gb:AL139281_1920503 Human DNA
           sequence from clone RP11-215C7 on chromosome 10 Contains
           the gene for pilin-like transcription factor (PILB)
           (CGI-131), a tyrosine 3-monooxygenase/tryptophan
           5-monooxygenase activation protein zeta polypeptide
           (YWHAZ) pseudogene, the gene for a novel protein similar
           to bHLH protein Ptf1-p48 (PTF1A) (possible ortholog of
           rodent pancreas specific transcription factor 1a
           (Ptf1a)), a novel gene, a novel pseudogene and five CpG
           islands, complete sequence.
          Length = 182

 Score =  149 bits (376), Expect = 6e-35
 Identities = 69/133 (51%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           ++  EW+K+LT +QFY+TR+KGTE  F+G Y + K  G YHCVCCD+PLF S  K+ SGT
Sbjct: 49  LAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGT 108

Query: 353 GWPSYYKPVGNN--------VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR 198
           GWPS+ +  G +        +  +LD S +   R EV+C  C+AHLGHVF DGP P G+R
Sbjct: 109 GWPSFSEAHGTSGSDESHTGILRRLDTS-LGSARTEVVCKQCEAHLGHVFPDGPGPNGQR 167

Query: 197 YCINSAALKLKPK 159
           +CINS ALK KP+
Sbjct: 168 FCINSVALKFKPR 180



>gb:CP000026_76370 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 142

 Score =  149 bits (376), Expect = 6e-35
 Identities = 67/119 (56%), Positives = 82/119 (68%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EE KK+L+  QFY+T+ +GTE  FTG     K  G YHC+ CDTPLF S TK+DSG G
Sbjct: 11  SAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCG 70

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y+PV       +D     M R E+ C  CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct: 71  WPSFYQPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASL 129



>pir|AF0711|AF0711 conserved hypothetical protein STY1824 [imported]
           - Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE008756_242988 Salmonella typhimurium
           LT2, section 60 of 220 of the complete
           genome.>gb:AE016838_345294 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 5 of 16 of the
           complete genome.>gb:AL627271_542005 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 7/20.>gb:AE014613_982626 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1000070 Salmonella typhimurium LT2,
           complete genome.
          Length = 147

 Score =  149 bits (376), Expect = 6e-35
 Identities = 67/119 (56%), Positives = 82/119 (68%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EE KK+L+  QFY+T+ +GTE  FTG     K  G YHC+ CDTPLF S TK+DSG G
Sbjct: 16  SAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCG 75

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y+PV       +D     M R E+ C  CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct: 76  WPSFYQPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASL 134



>sp|Q8XGD3|MSRB_SALTY Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).
          Length = 137

 Score =  149 bits (376), Expect = 6e-35
 Identities = 67/119 (56%), Positives = 82/119 (68%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EE KK+L+  QFY+T+ +GTE  FTG     K  G YHC+ CDTPLF S TK+DSG G
Sbjct: 6   SAEELKKKLSEMQFYVTQDRGTEPPFTGRLLHNKRDGVYHCLVCDTPLFHSHTKYDSGCG 65

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y+PV       +D     M R E+ C  CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct: 66  WPSFYQPVSEEAIRYIDDFSHGMQRVEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASL 124



>sp|Q9Y3D2|MSRB_HUMAN Methionine-R-sulfoxide reductase B (EC
           1.8.4.-) (CGI-131).>gb:AF151889_1886374 Homo sapiens
           CGI-131 protein mRNA, complete cds.
          Length = 201

 Score =  149 bits (376), Expect = 6e-35
 Identities = 69/133 (51%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           ++  EW+K+LT +QFY+TR+KGTE  F+G Y + K  G YHCVCCD+PLF S  K+ SGT
Sbjct: 68  LAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGT 127

Query: 353 GWPSYYKPVGNN--------VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR 198
           GWPS+ +  G +        +  +LD S +   R EV+C  C+AHLGHVF DGP P G+R
Sbjct: 128 GWPSFSEAHGTSGSDESHTGILRRLDTS-LGSARTEVVCKQCEAHLGHVFPDGPGPNGQR 186

Query: 197 YCINSAALKLKPK 159
           +CINS ALK KP+
Sbjct: 187 FCINSVALKFKPR 199



>gb:AK086975_1174827 Mus musculus 0 day neonate lung cDNA, RIKEN
           full-length enriched library, clone:E030016P18
           product:weakly similar to TRANSCRIPTIONAL REGULATOR
           [Methanothermobacter thermautotrophicus], full insert
           sequence.
          Length = 186

 Score =  147 bits (372), Expect = 2e-34
 Identities = 67/123 (54%), Positives = 84/123 (68%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S +E +KRLT  Q+++T++KGTE AF GEY   K PG Y CV C TPLF+S TKFDSG+G
Sbjct: 39  SQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSG 98

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WP+++  + +      D     M R E  C+ C AHLGH+FDDGP PTGKRYCINSA+L 
Sbjct: 99  WPAFHDVISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSASLS 158

Query: 170 LKP 162
             P
Sbjct: 159 FTP 161



>sp|Q88LQ6|MSRB_PSEPK Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE016780_331306 Pseudomonas putida
           KT2440 section 7 of 21 of the complete
           genome.>gb:AE015451_946383 Pseudomonas putida KT2440
           complete genome.
          Length = 131

 Score =  147 bits (370), Expect = 3e-34
 Identities = 62/122 (50%), Positives = 84/122 (68%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           +EW+  L  +Q+ + R KGTER F+G+Y   +  G YHC+CC  PLF++ TKFD+G GWP
Sbjct: 9   DEWRSMLDPEQYQVCRLKGTERPFSGKYNSERRDGIYHCICCGLPLFDAQTKFDAGCGWP 68

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
           S+Y P+ ++   ++  +   M R EV CA CDAHLGHVF DGP PTG RYCINS  + L+
Sbjct: 69  SFYAPIEDSAMIEIRDTSHGMIRTEVTCARCDAHLGHVFPDGPPPTGLRYCINSVCIDLR 128

Query: 164 PK 159
           P+
Sbjct: 129 PR 130



>pir|AF2293|AF2293 hypothetical protein alr3901 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684890 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 164

 Score =  146 bits (368), Expect = 5e-34
 Identities = 69/132 (52%), Positives = 88/132 (66%), Gaps = 1/132 (0%)
 Frame = -1

Query: 554 SNKDFS-SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           SN  F  + S++EW+  LT +QF + R+ GTERAFT       + GTY C  CD PLF S
Sbjct: 33  SNTKFEIAKSEQEWQTILTPEQFRVLRKHGTERAFTSPLDKEYSQGTYVCAACDQPLFTS 92

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR 198
            TKF+SGTGWPS++ P+   + + +D S  FM R EV C+ C  HLGHVFDDGP PTGKR
Sbjct: 93  DTKFNSGTGWPSFFNPIEGGIGTTVDRS-FFMTRVEVHCSRCGGHLGHVFDDGPAPTGKR 151

Query: 197 YCINSAALKLKP 162
           YC+N  +LK +P
Sbjct: 152 YCMNGVSLKFEP 163



>gb:SME591785_185009 Sinorhizobium meliloti 1021 complete
           chromosome; segment 4/12.
          Length = 153

 Score =  145 bits (365), Expect = 1e-33
 Identities = 65/119 (54%), Positives = 80/119 (67%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++EEW+  LT +Q+ +TR+ GTER FTG + D K  GTY CVCC   LF S TKFDSG G
Sbjct: 30  TNEEWRAALTPEQYRVTREHGTERPFTGPFLDNKRHGTYKCVCCGRALFRSDTKFDSGCG 89

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPSY+ PV  +  ++       M R E+ CA CDAHLGHVF DGP PTG RYC+N  A+
Sbjct: 90  WPSYFAPVDPDAIAEYVDRSHLMVRTEIRCADCDAHLGHVFPDGPPPTGLRYCLNGTAM 148



>sp|Q92RA4|MSB1_RHIME Peptide methionine sulfoxide reductase msrB 1
           (EC 1.8.4.6).
          Length = 135

 Score =  145 bits (365), Expect = 1e-33
 Identities = 65/119 (54%), Positives = 80/119 (67%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++EEW+  LT +Q+ +TR+ GTER FTG + D K  GTY CVCC   LF S TKFDSG G
Sbjct: 12  TNEEWRAALTPEQYRVTREHGTERPFTGPFLDNKRHGTYKCVCCGRALFRSDTKFDSGCG 71

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPSY+ PV  +  ++       M R E+ CA CDAHLGHVF DGP PTG RYC+N  A+
Sbjct: 72  WPSYFAPVDPDAIAEYVDRSHLMVRTEIRCADCDAHLGHVFPDGPPPTGLRYCLNGTAM 130



>gb:AY669150_1345398 Schistosoma mansoni methionine sulfoxide
           reductase B2b (msrB) mRNA, complete cds.
          Length = 137

 Score =  144 bits (364), Expect = 2e-33
 Identities = 67/129 (51%), Positives = 87/129 (67%), Gaps = 7/129 (5%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDEEWK  L  +Q+ + R KGTE  FTGEY+  K  G Y CVCC + LF+SS+KFDSG+G
Sbjct: 6   SDEEWKCVLNPEQYRVARLKGTEAPFTGEYYHNKEKGEYLCVCCGSKLFDSSSKFDSGSG 65

Query: 350 WPSYYKPVGNNVKSKLDLSII-------FMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC 192
           WPS+Y+  G+N +     ++I        + R E+ C  C AHLGHVF+DGP+PTG RYC
Sbjct: 66  WPSFYQVHGSNGRDDSQTNVIRTEDNSLDLMRIEISCKQCGAHLGHVFEDGPKPTGLRYC 125

Query: 191 INSAALKLK 165
           +NSA+L  K
Sbjct: 126 VNSASLSFK 134



>gb:BX572606_803682 Rhodopseudomonas palustris CGA009 complete
           genome; segment 14/16.
          Length = 138

 Score =  144 bits (363), Expect = 2e-33
 Identities = 71/125 (56%), Positives = 85/125 (68%), Gaps = 1/125 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+ EW+K LT  Q+ + R+K TER +TGEY     PGTY C  C   LFES TKFDSG G
Sbjct: 15  SEAEWRKELTPMQYAVLREKATERPYTGEYEYETRPGTYVCAGCGQTLFESDTKFDSGCG 74

Query: 350 WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+  P   +++  + D+S   M R EVLC+ C  HLGHVF DGP PTG RYCINSAAL
Sbjct: 75  WPSFTAPAQASSIDEERDVS-HGMIRTEVLCSRCSGHLGHVFPDGPGPTGLRYCINSAAL 133

Query: 173 KLKPK 159
           KL+PK
Sbjct: 134 KLQPK 138



>gb:AE016761_326189 Escherichia coli CFT073 section 7 of 18 of the
           complete genome.>gb:AE014075_956773 Escherichia coli
           CFT073 complete genome.
          Length = 147

 Score =  144 bits (363), Expect = 2e-33
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 1/121 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EE KK L+  QFY+T+  GTE  FTG     K  G YHC+ CD PLF S TK+DSG G
Sbjct: 16  SAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCG 75

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y+PV   +++   DLS   M R E+ C  CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct: 76  WPSFYEPVSEESIRYIKDLS-HGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASL 134

Query: 173 K 171
           +
Sbjct: 135 R 135



>gb:AE005674_71027 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016983_371385 Shigella flexneri 2a str.
           2457T section 6 of 16 of the complete
           genome.>gb:AE014073_996135 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 137

 Score =  144 bits (363), Expect = 2e-33
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 1/121 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EE KK L+  QFY+T+  GTE  FTG     K  G YHC+ CD PLF S TK+DSG G
Sbjct: 6   SAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSETKYDSGCG 65

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y+PV   +++   DLS   M R E+ C  CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct: 66  WPSFYEPVSEESIRYIKDLS-HGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASL 124

Query: 173 K 171
           +
Sbjct: 125 R 125



>sp|P39903|MSRB_ECOLI Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|B64938|B64938 hypothetical protein
           b1778 - Escherichia coli (strain K-12)>pir|G90939|G90939
           hypothetical protein ECs2487 [imported] - Escherichia
           coli  (strain O157:H7, substrain RIMD
           0509952)>pir|C85788|C85788 hypothetical protein yeaA
           [imported] - Escherichia coli  (strain O157:H7,
           substrain EDL933)>gb:AE005174_66766 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:U00096_200844
           Escherichia coli K-12 MG1655 complete
           genome.>gb:BA000007_660499 Escherichia coli O157:H7 DNA,
           complete genome.
          Length = 137

 Score =  144 bits (363), Expect = 2e-33
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 1/121 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EE KK L+  QFY+T+  GTE  FTG     K  G YHC+ CD PLF S TK+DSG G
Sbjct: 6   SAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCG 65

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y+PV   +++   DLS   M R E+ C  CDAHLGHVF DGP+PTG+RYC+NSA+L
Sbjct: 66  WPSFYEPVSEESIRYIKDLS-HGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASL 124

Query: 173 K 171
           +
Sbjct: 125 R 125



>gb:AE010705_265831 Methanosarcina acetivorans str. C2A, section 50
           of 534 of the complete genome.>gb:AE010299_906390
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 147

 Score =  144 bits (362), Expect = 3e-33
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 1/130 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+EEWKK LT +Q+++ RQKGTE+ F+G  +  K  G Y C  C   LF S TKF+SGTG
Sbjct: 16  SEEEWKKILTPEQYHVLRQKGTEKPFSGNLYYNKEKGVYTCAACGQELFSSDTKFESGTG 75

Query: 350 WPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y  + ++ V+ K D S  FM R EV+C+ C +HLGHVF+DGP PTGKRYCINS +L
Sbjct: 76  WPSFYDAISSDKVRLKEDNS-YFMHRIEVVCSRCGSHLGHVFEDGPVPTGKRYCINSVSL 134

Query: 173 KLKPK*EVSK 144
             + + E  +
Sbjct: 135 GFEKEEEAER 144



>gb:AY222978_1176444 Schistosoma japonicum clone ZZD100 mRNA
           sequence.
          Length = 137

 Score =  143 bits (361), Expect = 4e-33
 Identities = 67/129 (51%), Positives = 86/129 (66%), Gaps = 7/129 (5%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDEEWK  L  +Q+ + R KGTE  FTGEY+  K  G Y CVCC + LF+SS+K+DSG+G
Sbjct: 6   SDEEWKYVLNPEQYRVARLKGTEAPFTGEYYHNKEKGEYLCVCCGSKLFDSSSKYDSGSG 65

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMP-------RQEVLCAACDAHLGHVFDDGPEPTGKRYC 192
           WPS+YK  G++ +     +II          R E+ C  C AHLGHVF+DGP+PTG RYC
Sbjct: 66  WPSFYKAHGSDGRDDSQTNIIRTEDNSLDNMRIEISCKQCGAHLGHVFEDGPKPTGLRYC 125

Query: 191 INSAALKLK 165
           +NSA+L  K
Sbjct: 126 VNSASLSFK 134



>gb:BX572090_795641 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 164

 Score =  143 bits (361), Expect = 4e-33
 Identities = 64/131 (48%), Positives = 92/131 (70%)
 Frame = -1

Query: 563 AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF 384
           A  ++ D  ++S E+WK +L+ + +YI R++GTERAF+ +  + K  G ++C  C+ PLF
Sbjct: 31  AFAASDDDWNLSKEDWKNKLSPESYYILREEGTERAFSSQLNNEKRKGIFYCAGCNQPLF 90

Query: 383 ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG 204
            S TKFDSGTGWPS++ P+  +V++K+D  +I +PR E  C+ C  H GHVF+DGP PTG
Sbjct: 91  TSDTKFDSGTGWPSFWDPIQGSVETKVDFKLI-VPRTEYHCSRCGGHQGHVFNDGPLPTG 149

Query: 203 KRYCINSAALK 171
           KRYC N  ALK
Sbjct: 150 KRYCNNGLALK 160



>gb:BX294146_769429 Pirellula sp. strain 1 complete genome; segment
           14/24.
          Length = 194

 Score =  143 bits (361), Expect = 4e-33
 Identities = 65/131 (49%), Positives = 89/131 (67%), Gaps = 1/131 (0%)
 Frame = -1

Query: 560 EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE 381
           E S +D+   +  E ++RL   Q+ +T+   TE AF+  YW+ K  G YHC+ CD PLF+
Sbjct: 55  ESSEEDYVPATKAELRRRLNRIQYDVTQNAATEPAFSNAYWNNKKTGEYHCIVCDKPLFD 114

Query: 380 SSTKFDSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG 204
           S TKF SGTGWPS+Y P+  + V  + D  +I+ PR EV C  C AHLGH+FDDGP P+G
Sbjct: 115 SKTKFKSGTGWPSFYLPIEKDAVGYQTDYKMIY-PRTEVHCKRCKAHLGHLFDDGPAPSG 173

Query: 203 KRYCINSAALK 171
           KR+C+NSA++K
Sbjct: 174 KRFCMNSASMK 184



>gb:AE017161_394473 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030142 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 166

 Score =  143 bits (361), Expect = 4e-33
 Identities = 63/127 (49%), Positives = 89/127 (70%)
 Frame = -1

Query: 554 SNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESS 375
           SN D  S++ ++WK+RL+ + +Y+ R++GTER F+    D K  G + C  CD PLF+SS
Sbjct: 35  SNSDSWSLTKDQWKQRLSREAYYVLREEGTERPFSSLLNDEKREGIFACAGCDLPLFDSS 94

Query: 374 TKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRY 195
            KFDSGTGWPS+++P+ N +++K D  +I +PR E  C+ C  H GHVF+DGP P+GKRY
Sbjct: 95  RKFDSGTGWPSFWEPLPNAIETKTDFKLI-VPRTEYHCSRCGGHQGHVFNDGPRPSGKRY 153

Query: 194 CINSAAL 174
           C N  AL
Sbjct: 154 CNNGVAL 160



>sp|Q8UGX7|MSRB_AGRT5 Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|AD2688|AD2688 transcription regulator
           Atu0908 [imported] - Agrobacterium tumefaciens (strain
           C58, Dupont)>pir|G97469|G97469 hypothetical protein
           AGR_C_1655 [imported] - Agrobacterium tumefaciens
           (strain C58, Cereon)>gb:AE008022_232652 Agrobacterium
           tumefaciens str. C58 circular chromosome, section 80 of
           254 of the complete sequence.>gb:AE009056_247949
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 82 of 256 of the complete
           sequence.>gb:AE007869_1082321 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1085792 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 135

 Score =  143 bits (361), Expect = 4e-33
 Identities = 63/123 (51%), Positives = 82/123 (66%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD +W+++LT +Q++I R+ GTER FTG YW++   G Y C  CD PLF S TKFD+G G
Sbjct: 12  SDADWREQLTPEQYHILREHGTERPFTGPYWNSTEKGLYRCAACDEPLFLSDTKFDAGCG 71

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPSY++PV     ++   S   M R E+ CA C  HLGHVF DGP PTG RYCIN  ++ 
Sbjct: 72  WPSYFEPVKPGAVTEHRDSTHGMVRTEIRCANCGGHLGHVFPDGPPPTGLRYCINGHSMV 131

Query: 170 LKP 162
            +P
Sbjct: 132 FEP 134



>gb:BC067722_2554888 Danio rerio zgc:85965, mRNA (cDNA clone
           MGC:85965 IMAGE:6968176), complete cds.
          Length = 180

 Score =  142 bits (359), Expect = 6e-33
 Identities = 62/128 (48%), Positives = 87/128 (67%), Gaps = 7/128 (5%)
 Frame = -1

Query: 521 EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS 342
           +W+++L+ +Q+ +TR+KGTE  F+G Y +    G YHCVCCD+PLF S  K+D+G GWPS
Sbjct: 51  DWQRKLSPEQYVVTREKGTEVPFSGIYLNHNEVGMYHCVCCDSPLFSSEAKYDAGAGWPS 110

Query: 341 YYKPVGNNVKSKLDLSIIFMPRQ-------EVLCAACDAHLGHVFDDGPEPTGKRYCINS 183
           + +  G   K +   +I+  P         EV+C  CDAHLGHVF+DGP+PTG+R+CINS
Sbjct: 111 FCEAHGTWEKDESHANIVRRPDNSLGSTGTEVICKHCDAHLGHVFEDGPDPTGQRFCINS 170

Query: 182 AALKLKPK 159
            AL  KP+
Sbjct: 171 VALNFKPR 178



>gb:BX572095_797358 Prochlorococcus marinus MIT9313 complete genome;
           segment 1/7.
          Length = 168

 Score =  142 bits (357), Expect = 1e-32
 Identities = 62/125 (49%), Positives = 84/125 (67%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           S+S+E+W K L+ + + + R++GTER FT      K  G YHC  CD PLF S+ KFDSG
Sbjct: 43  SLSNEQWAKCLSPEAYRVLREEGTERPFTSSLNKEKRVGIYHCAGCDLPLFSSAAKFDSG 102

Query: 356 TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAA 177
           TGWPS+++P+   +++K+D  +I +PR E  C  C  H GHVF+DGP PTGKRYC N  A
Sbjct: 103 TGWPSFWEPLAGAIQTKVDFKLI-IPRSEYHCRRCGGHQGHVFNDGPRPTGKRYCNNGVA 161

Query: 176 LKLKP 162
           L  +P
Sbjct: 162 LTFRP 166



>gb:AE016921_358173 Chromobacterium violaceum ATCC 12472 section 12
           of 16 of the complete genome.>gb:AE016825_1043327
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 129

 Score =  141 bits (356), Expect = 1e-32
 Identities = 64/122 (52%), Positives = 82/122 (67%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+ +LT +Q+ + RQ GTER F+GE++     G Y CVCC T LF S TKFD+G G
Sbjct: 6   TDAEWRAQLTSEQYRVARQAGTERPFSGEHYFHNKKGDYFCVCCGTLLFHSDTKFDAGCG 65

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS++        ++L  +   M R EV C+ CDAHLGHVF+DGPEPTG+RYCINS  L 
Sbjct: 66  WPSFWAEAAGANIARLTDTTHGMVRVEVRCSHCDAHLGHVFEDGPEPTGERYCINSVCLD 125

Query: 170 LK 165
            K
Sbjct: 126 FK 127



>gb:BA000038_724549 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 390

 Score =  141 bits (355), Expect = 2e-32
 Identities = 68/138 (49%), Positives = 92/138 (66%), Gaps = 1/138 (0%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K +S  SD+E K +LT  Q+Y+T+++GTER F  EYWD K  G Y  +    PLF S+ K
Sbjct: 245 KTYSRPSDKEIKAQLTDLQYYVTQKEGTERPFNNEYWDNKEAGIYVDIVSGEPLFSSTDK 304

Query: 368 FDSGTGWPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC 192
           + SGTGWPS+ KP+ +  + +K D  +++ PR EV     D+HLGHVFDDGP PTG RYC
Sbjct: 305 YKSGTGWPSFTKPISSAYIVTKTDYKLLY-PRTEVRSKFADSHLGHVFDDGPAPTGLRYC 363

Query: 191 INSAALKLKPK*EVSKGG 138
           +NSAA+K  P  ++ K G
Sbjct: 364 MNSAAMKFVPVAQMEKMG 381



>gb:AJ749949_531335 Francisella tularensis subsp. tularensis
           complete genome.>gb:AY774218_2148931 Synthetic construct
           Francisella tularensis clone FLH155980.01X NT02FT0665
           gene, complete cds.
          Length = 170

 Score =  141 bits (355), Expect = 2e-32
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 1/125 (0%)
 Frame = -1

Query: 509 RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP 330
           +LT  Q+Y+T++ GTERAF  +YW+    G Y  V    PLF S+ K+DSGTGWPS+ KP
Sbjct: 33  KLTRLQYYVTQKGGTERAFNNKYWNNHRQGIYVDVVSGEPLFSSTDKYDSGTGWPSFTKP 92

Query: 329 VGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK*E 153
           + N+ +K+K D S  FM R EVL    ++HLGHVFDDGP+PTGKRYC+NSAALK  PK +
Sbjct: 93  IDNSFIKTKTDNS-WFMTRTEVLSRYANSHLGHVFDDGPQPTGKRYCMNSAALKFIPKED 151

Query: 152 VSKGG 138
           + K G
Sbjct: 152 MQKDG 156



>gb:AE016813_339297 Vibrio vulnificus CMCP6 chromosome II section 6
           of 6 of the complete sequence.>gb:AE016796_1049021
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 380

 Score =  140 bits (354), Expect = 2e-32
 Identities = 68/138 (49%), Positives = 92/138 (66%), Gaps = 1/138 (0%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K +S  SD+E K +LT  Q+Y+T+++GTER F  EYWD K  G Y  +    PLF S+ K
Sbjct: 235 KTYSRPSDKEIKAQLTDLQYYVTQKEGTERPFNNEYWDNKEAGIYVDIVSGEPLFSSTDK 294

Query: 368 FDSGTGWPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC 192
           + SGTGWPS+ KP+ +  + +K D  +++ PR EV     D+HLGHVFDDGP PTG RYC
Sbjct: 295 YKSGTGWPSFTKPISSAYIVTKTDYKLLY-PRTEVRSKFADSHLGHVFDDGPAPTGLRYC 353

Query: 191 INSAALKLKPK*EVSKGG 138
           +NSAA+K  P  ++ K G
Sbjct: 354 MNSAAMKFIPVAQMEKMG 371



>gb:AE013397_291964 Methanosarcina mazei strain Goe1, section 179 of
           379 of the complete genome.>gb:AE008384_966073
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 140

 Score =  140 bits (354), Expect = 2e-32
 Identities = 62/119 (52%), Positives = 83/119 (69%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+E+WK  LT +Q+++ RQKGTER F+G  +  K  G Y C  C   LF S TKF+SGTG
Sbjct: 9   SEEDWKSVLTPEQYHVLRQKGTERPFSGNLYYNKEKGIYTCAACGQELFSSDTKFESGTG 68

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y  + ++     + +  FM R EV+C+ C +HLGHVF+DGPEPTG+RYCINS +L
Sbjct: 69  WPSFYDVISSDRVRLHEDNSYFMKRIEVVCSRCGSHLGHVFEDGPEPTGQRYCINSVSL 127



>sp|Q89EM9|MSRB_BRAJA Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:BA000040_735304 Bradyrhizobium
           japonicum USDA 110 DNA, complete genome.
          Length = 139

 Score =  140 bits (352), Expect = 4e-32
 Identities = 70/125 (56%), Positives = 86/125 (68%), Gaps = 1/125 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+E+W++ L+  Q+ + R+K TER F+GEY      GTY C  C   LFES  KFDSG G
Sbjct: 16  SEEQWRRELSPIQYAVLREKATERPFSGEYEHDHRAGTYVCAGCGNVLFESDAKFDSGCG 75

Query: 350 WPSYYKP-VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+ +P V ++V  + D+S   M R EVLCA C  HLGHVF DGP PTG RYCINSAAL
Sbjct: 76  WPSFTQPAVESHVDEERDVS-HGMIRTEVLCAKCSGHLGHVFPDGPGPTGLRYCINSAAL 134

Query: 173 KLKPK 159
           KL+PK
Sbjct: 135 KLEPK 139



>gb:TSO428486_1401060 Taenia solium mRNA for putative transcription
           regulator (trh gene).
          Length = 140

 Score =  139 bits (350), Expect = 7e-32
 Identities = 65/134 (48%), Positives = 87/134 (64%), Gaps = 9/134 (6%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           ++D++WK+RL    +++TR+KGTE  FTG+Y      G Y CVCC   LF S  KFDSG 
Sbjct: 5   LNDDDWKRRLPPDVYHVTREKGTEEPFTGKYNKLFENGYYKCVCCGALLFTSKDKFDSGC 64

Query: 353 GWPSYYK---------PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK 201
           GWP++ +           G NVK +LD S + M R E++C  CDAHLGHVF+DGP PT  
Sbjct: 65  GWPAFSRAASSSASGADAGTNVKRRLDTS-LGMRRVEIVCKLCDAHLGHVFEDGPAPTNL 123

Query: 200 RYCINSAALKLKPK 159
           RYC+NSA+L  +P+
Sbjct: 124 RYCVNSASLSFEPE 137



>pir|S74642|S74642 hypothetical protein sll1680 - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_687573 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 176

 Score =  137 bits (346), Expect = 2e-31
 Identities = 64/120 (53%), Positives = 81/120 (67%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+++L+ + + + R+ GTERA T         GTY C  C+ PLF S TKF+SGTG
Sbjct: 54  TDAEWQQQLSPEAYKVLRKHGTERAGTSPLDKNYDLGTYECAGCELPLFSSETKFNSGTG 113

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+Y P+ N V   +D S  FM R EV CA C  HLGHVFDDGP+PTGKRYC+N  +LK
Sbjct: 114 WPSFYAPLENAVAYTVDKS-FFMTRTEVHCARCGGHLGHVFDDGPQPTGKRYCMNGVSLK 172



>gb:BX571965_791211 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_865707
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 143

 Score =  137 bits (345), Expect = 3e-31
 Identities = 70/127 (55%), Positives = 84/127 (66%), Gaps = 2/127 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           D E ++RLT  Q+ +T+   TE  FTGEY DT+  G YHCV C T LFES  KF SG GW
Sbjct: 16  DAELRRRLTPMQYEVTQHAATEPPFTGEYTDTEDAGIYHCVVCGTALFESGAKFHSGCGW 75

Query: 347 PSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAAL 174
           PSY+KP+ G  +  K+D +   M R EV C  C AHLGHVF+DGP + TG RYCINSAAL
Sbjct: 76  PSYFKPIDGEVIDEKMDYT-HGMTRVEVRCNQCGAHLGHVFEDGPRDKTGLRYCINSAAL 134

Query: 173 KLKPK*E 153
             + K E
Sbjct: 135 NFEAKPE 141



>gb:BX572605_803550 Rhodopseudomonas palustris CGA009 complete
           genome; segment 13/16.
          Length = 165

 Score =  137 bits (344), Expect = 3e-31
 Identities = 63/121 (52%), Positives = 80/121 (66%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           EEW+K+LT  Q++I R++ TER F+         GT+ C  CD PLF S TKFDSGTGWP
Sbjct: 40  EEWRKQLTPMQYHILREEDTERPFSSPLLKEHRKGTFACAGCDLPLFSSDTKFDSGTGWP 99

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
           S+++P+ N V  + D S + M R EV C  C  HLGHVFDDGP+PTG RYC++  AL   
Sbjct: 100 SFWQPLSNAVGERTD-STLGMTRTEVHCRRCGGHLGHVFDDGPKPTGLRYCMDGYALTFH 158

Query: 164 P 162
           P
Sbjct: 159 P 159



>pir|F70968|F70968 hypothetical protein Rv2674 - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_22835
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248343_760050 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           10/14.>gb:BX842580_820764 Mycobacterium tuberculosis
           H37Rv complete genome; segment 9/13.
          Length = 136

 Score =  137 bits (344), Expect = 3e-31
 Identities = 64/126 (50%), Positives = 85/126 (67%), Gaps = 2/126 (1%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           +SD+EW+++LT Q+F++ R+ GTER FTGEY DT T G Y C  C   LF S+ KF+S  
Sbjct: 8   LSDDEWRQKLTPQEFHVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFRSTEKFESHC 67

Query: 353 GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSA 180
           GWPS++ P  ++  +      + M R EVLCA CD+HLGHVF  +  P PT KRYCINS 
Sbjct: 68  GWPSFFDPKSSDAVTLRPDHSLGMTRTEVLCANCDSHLGHVFAGEGYPTPTDKRYCINSI 127

Query: 179 ALKLKP 162
           +L+L P
Sbjct: 128 SLRLVP 133



>gb:BX569689_774918 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 168

 Score =  136 bits (343), Expect = 4e-31
 Identities = 59/124 (47%), Positives = 82/124 (66%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           ++ ++W++RL+ + + + R +GTER FT      K  GTYHC  CD  LF S  KFDSGT
Sbjct: 44  LTPDQWRERLSSEAYDVLRNEGTERPFTSPLNAEKRSGTYHCAGCDLSLFSSEAKFDSGT 103

Query: 353 GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           GWPS+++P+   + +K+D  +I +PR E  C+ C  H GHVF+DGP PTGKRYC N  AL
Sbjct: 104 GWPSFWQPLQGAIATKVDFKLI-IPRTEYHCSRCGGHQGHVFNDGPRPTGKRYCNNGVAL 162

Query: 173 KLKP 162
             +P
Sbjct: 163 VFRP 166



>gb:CR555306_105872 Azoarcus sp. EbN1 complete genome.
          Length = 164

 Score =  136 bits (343), Expect = 4e-31
 Identities = 64/123 (52%), Positives = 80/123 (65%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDEEW+K LT +QF + R  GTE A +    D K  G Y C  C+ PLF S  K+DSGTG
Sbjct: 40  SDEEWRKLLTPEQFRVLRDDGTESAGSSPLNDEKRKGEYVCAGCELPLFTSDMKYDSGTG 99

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS++  +  +V++KLD  +I +PR E  CA C  H GHVFDDGP P+GKR+C N  ALK
Sbjct: 100 WPSFFTTIPGHVETKLDFRMI-LPRTEYHCARCGGHQGHVFDDGPPPSGKRWCNNGVALK 158

Query: 170 LKP 162
             P
Sbjct: 159 FVP 161



>sp|Q9KQK0|MSRB_VIBCH Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|D82131|D82131 PilB-related protein
           VC1998 [imported] - Vibrio cholerae  (strain N16961
           serogroup O1)>gb:AE004274_52376 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, section 182 of
           251 of the complete chromosome.>gb:AE003852_1053150
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, complete chromosome.
          Length = 147

 Score =  136 bits (343), Expect = 4e-31
 Identities = 60/123 (48%), Positives = 79/123 (64%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DE W++ LT + FY+ RQ+GTE  ++G+    K  G YHC CC + LF S  K+DSG GW
Sbjct: 25  DEYWREHLTEEAFYVCRQQGTEAPYSGKLLHNKDTGLYHCTCCQSALFSSENKYDSGCGW 84

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           PS+  P+   V   LD     M R E+ CAACD+HLGHVF+DGP+ TG R+C+NS +L  
Sbjct: 85  PSFDAPINEQVIRFLDDFSHGMVRTEIRCAACDSHLGHVFEDGPKTTGLRFCVNSVSLIF 144

Query: 167 KPK 159
             K
Sbjct: 145 NKK 147



>gb:D90821_123005 E.coli genomic DNA, Kohara clone #330(39.9-40.3
           min.).
          Length = 121

 Score =  135 bits (340), Expect = 1e-30
 Identities = 62/109 (56%), Positives = 77/109 (70%), Gaps = 1/109 (0%)
 Frame = -1

Query: 494 QFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVG-NN 318
           QFY+T+  GTE  FTG     K  G YHC+ CD PLF S TK+DSG GWPS+Y+PV   +
Sbjct: 2   QFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKYDSGCGWPSFYEPVSEES 61

Query: 317 VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           ++   DLS   M R E+ C  CDAHLGHVF DGP+PTG+RYC+NSA+L+
Sbjct: 62  IRYIKDLS-HGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVNSASLR 109



>sp|Q87MS5|MSRB_VIBPA Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:BA000031_707616 Vibrio parahaemolyticus
           RIMD 2210633 DNA, chromosome 1, complete sequence.
          Length = 147

 Score =  135 bits (340), Expect = 1e-30
 Identities = 60/131 (45%), Positives = 87/131 (66%)
 Frame = -1

Query: 566 YAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPL 387
           + E S K  +  SDE+W+++L+ ++F + R++GTE  F+G+    K  G Y C CC+ PL
Sbjct: 11  FVEQSGKKVTK-SDEQWREQLSDEEFRVCREQGTEPPFSGKLLHNKETGVYACTCCNAPL 69

Query: 386 FESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT 207
           F S  K+DSG GWPS+  P+ N     L+     M R E+ CA+CD+HLGHVF+DGP+ T
Sbjct: 70  FISDNKYDSGCGWPSFDAPLNNEAIRYLEDLSHGMVRTEIRCASCDSHLGHVFEDGPKTT 129

Query: 206 GKRYCINSAAL 174
           G+RYC+NS +L
Sbjct: 130 GERYCVNSVSL 140



>gb:BX571867_787414 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 9/17.
          Length = 136

 Score =  135 bits (339), Expect = 1e-30
 Identities = 62/113 (54%), Positives = 77/113 (68%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           K LT  Q ++T+  GTE  F+G+    K  G YHC+CC+ PLF S TKFDSG GWPS+Y+
Sbjct: 11  KELTDIQRHVTQNAGTEPPFSGKLLHNKKSGVYHCLCCEQPLFMSGTKFDSGCGWPSFYQ 70

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           P  ++    LD     M R EV C  C+AHLGHVF DGP+PTG+R+CINSAAL
Sbjct: 71  PATHDAVQYLDDDSHNMHRIEVRCGHCNAHLGHVFPDGPQPTGERFCINSAAL 123



>pir|G82223|G82223 PilB-related protein VC1236 [imported] - Vibrio
           cholerae  (strain N16961 serogroup O1)>gb:AE004203_51625
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, section 111 of 251 of the complete
           chromosome.>gb:AE003852_1052399 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 148

 Score =  135 bits (339), Expect = 1e-30
 Identities = 65/120 (54%), Positives = 81/120 (67%), Gaps = 1/120 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDEEW+  L  QQ+Y+ RQ GTERAF+    +   PG Y C  C T LF+S+TKFDSGTG
Sbjct: 25  SDEEWRTLLDEQQYYVMRQHGTERAFSNAMCELFEPGLYQCAGCQTLLFDSATKFDSGTG 84

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+ +PV  N +   +D S+    R EV C  C++HLGHVF DGP P+G RYCINS A+
Sbjct: 85  WPSFSQPVKFNAISYHMDQSLA-RARVEVRCNTCESHLGHVFPDGPPPSGLRYCINSVAV 143



>gb:AE017237_413499 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 11 of 16 of the complete
           genome.>gb:AE016958_1056903 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 134

 Score =  134 bits (338), Expect = 2e-30
 Identities = 63/126 (50%), Positives = 82/126 (65%), Gaps = 2/126 (1%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           ++D+EW++RLT ++F++ RQ GTER FTGEY DTKT G Y C  C   LF S+ KF+S  
Sbjct: 8   LTDDEWRQRLTPEEFHVLRQAGTERPFTGEYTDTKTEGVYQCRACGAELFRSTEKFESHC 67

Query: 353 GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSA 180
           GWPS+Y P  ++         +   R EVLCA C +HLGHVF  +  P PT +RYCINS 
Sbjct: 68  GWPSFYDPANSDAVILRPDHSLGTTRTEVLCANCHSHLGHVFTGEGYPTPTDQRYCINSI 127

Query: 179 ALKLKP 162
            L+L P
Sbjct: 128 CLRLAP 133



>gb:CP000020_871090 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 135

 Score =  134 bits (337), Expect = 2e-30
 Identities = 61/127 (48%), Positives = 82/127 (64%)
 Frame = -1

Query: 554 SNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESS 375
           + K F   +DEEW+K+LT ++F I R++GTE  F+G     K  G Y C CC T LF S 
Sbjct: 3   TQKTFLEYTDEEWRKKLTKEEFDICRKQGTEAPFSGTLLHNKEKGYYACTCCQTILFVSD 62

Query: 374 TKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRY 195
            K+DSG GWPS+  PV + V   ++ +   M R E+ C  CD+HLGHVFDDGP+ T +RY
Sbjct: 63  NKYDSGCGWPSFDAPVNDQVIRYIEDNSHGMKRIEIRCRHCDSHLGHVFDDGPKTTNERY 122

Query: 194 CINSAAL 174
           C+NS +L
Sbjct: 123 CVNSVSL 129



>pir|H84294|H84294 transcription regulator [imported] -
           Halobacterium sp. NRC-1>gb:AE005058_62884 Halobacterium
           sp. NRC-1 section 89 of 170 of the complete
           genome.>gb:AE004437_887803 Halobacterium sp. NRC-1
           complete genome.
          Length = 133

 Score =  134 bits (336), Expect = 3e-30
 Identities = 59/126 (46%), Positives = 80/126 (63%)
 Frame = -1

Query: 539 SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS 360
           +   D +W   LT  Q+ + R++GTER F+G++ D    GTY CV CDT LF+  TKFD+
Sbjct: 6   TDADDTDWAATLTDDQYRVLREQGTERPFSGDHVDRDEDGTYSCVGCDTTLFDGETKFDA 65

Query: 359 GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA 180
             GWPS++    ++   + +     M R EV+CA C  HLGHVF DGP+PTG+RYCINS 
Sbjct: 66  HCGWPSFWDAADDDAIERREDHSNGMERTEVVCAECGGHLGHVFQDGPDPTGERYCINSV 125

Query: 179 ALKLKP 162
           AL  +P
Sbjct: 126 ALDFEP 131



>gb:AE017282_428685 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 202

 Score =  133 bits (335), Expect = 4e-30
 Identities = 68/139 (48%), Positives = 86/139 (61%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K+F   ++EE K+RL+ +Q+ I R  GTER F   YWD    G Y  +    PLF S+ K
Sbjct: 57  KNFRRPTEEEIKERLSEEQYAICRGNGTERPFANPYWDNHREGIYVDIVSGEPLFSSADK 116

Query: 368 FDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI 189
           FDSGTGWPS+ +P+  +    L      M R EV     D+HLGHVFDDGP PTGKRYCI
Sbjct: 117 FDSGTGWPSFTRPLEPDHIVTLTDHSHLMVRTEVRSRYGDSHLGHVFDDGPAPTGKRYCI 176

Query: 188 NSAALKLKPK*EVSKGGQE 132
           NS AL+  PK E+++ G E
Sbjct: 177 NSGALRFIPKEELAEAGYE 195



>gb:CP000021_872756 Vibrio fischeri ES114 chromosome II, complete
           sequence.
          Length = 378

 Score =  133 bits (334), Expect = 5e-30
 Identities = 63/140 (45%), Positives = 88/140 (62%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           V+ K +S  S+ + KK LT  Q+Y+T+++GTER F   YWD K  G Y  +    PLF S
Sbjct: 230 VNVKPYSKPSESQIKKSLTELQYYVTQEEGTERPFDNAYWDNKAEGIYVDIVSGEPLFSS 289

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR 198
           + K+ SGTGWPS+ KP+      + D   +F  R E+     D+HLGHVF+DGP+PTG R
Sbjct: 290 TDKYKSGTGWPSFTKPINKAYIVEEDDFQLFTKRTEIRSKFADSHLGHVFNDGPKPTGLR 349

Query: 197 YCINSAALKLKPK*EVSKGG 138
           YC+NSAA++   K ++ K G
Sbjct: 350 YCMNSAAMRFVAKADLEKEG 369



>gb:CR378671_95957 Photobacterium profundum SS9; segment 9/12.
          Length = 142

 Score =  132 bits (331), Expect = 1e-29
 Identities = 57/119 (47%), Positives = 77/119 (64%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D  W+K+LT  Q++I R+KGTE +F+G     +  G Y C CC+ PLF S  K+DSG G
Sbjct: 18  TDAYWRKKLTEDQYHICREKGTEASFSGTLLHNRETGLYSCTCCEAPLFVSDNKYDSGCG 77

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+  PV       ++ +   M R E+ CA CD+HLGHVF DGP  TG+RYC+NS +L
Sbjct: 78  WPSFDAPVNKEAVRYIEDNSHGMLRTEIRCANCDSHLGHVFPDGPNTTGERYCVNSVSL 136



>gb:BX950851_841083 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 139

 Score =  131 bits (330), Expect = 1e-29
 Identities = 58/111 (52%), Positives = 76/111 (68%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           +T  Q Y+T+Q+GTE AF+G+    K  G YHC+CC  PLF S +K+DSG GWPS+ +PV
Sbjct: 16  MTEMQRYVTQQRGTEPAFSGKLLHNKRTGAYHCLCCQAPLFYSDSKYDSGCGWPSFDQPV 75

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
            +     L+     M R E+ C  CDAHLGHVF DGP+ TG+RYC+NSA+L
Sbjct: 76  SSEAVRYLEDESHNMRRIEIRCGQCDAHLGHVFPDGPKTTGERYCVNSASL 126



>gb:BA000032_708747 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 380

 Score =  131 bits (330), Expect = 1e-29
 Identities = 68/141 (48%), Positives = 88/141 (62%), Gaps = 1/141 (0%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K ++  S  + K  LT  Q+Y+T+++GTER F  EYWD K  G Y  +    PLF S+ K
Sbjct: 234 KAYNKPSQSKIKSTLTELQYYVTQEEGTERPFDNEYWDNKEAGIYVDIVTGEPLFSSTDK 293

Query: 368 FDSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYC 192
           + SGTGWPS+ KP+    +  K D  +I+ PR EV     D+HLGHVF DGP+PTG RYC
Sbjct: 294 YKSGTGWPSFTKPINPGYIVEKTDYKLIY-PRTEVRSKFGDSHLGHVFTDGPKPTGLRYC 352

Query: 191 INSAALKLKPK*EVSKGGQEG 129
           +NSAA+K  P   VSK  Q G
Sbjct: 353 MNSAAMKFVP---VSKMAQLG 370



>gb:AY458631_619193 Uncultured bacterium 159 clone EBAC750-03B02
           genomic sequence.
          Length = 132

 Score =  131 bits (330), Expect = 1e-29
 Identities = 61/123 (49%), Positives = 82/123 (66%), Gaps = 1/123 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+ EW   LT  ++ I R+KGTE AFTG+Y+  K  G Y C  CD  LF S+TK+DS TG
Sbjct: 8   SESEWATCLTPDEYSILREKGTEMAFTGKYYKHKDDGKYVCAACDYELFSSNTKYDSDTG 67

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+Y  +  + +  K D + + M R E+LCA C++HLGH+F DGP P+G RYC+NS +L
Sbjct: 68  WPSFYAALDKDRILEKRD-NTLGMVRTEILCARCESHLGHLFPDGPRPSGLRYCVNSISL 126

Query: 173 KLK 165
             K
Sbjct: 127 DFK 129



>gb:AE013819_300468 Yersinia pestis KIM section 219 of 415 of the
           complete genome.>gb:AE017134_387752 Yersinia pestis
           biovar Medievalis str. 91001 section 8 of 16 of the
           complete genome.>gb:AE009952_930651 Yersinia pestis KIM
           complete genome.>gb:AE017042_1144318 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 156

 Score =  131 bits (330), Expect = 1e-29
 Identities = 59/113 (52%), Positives = 78/113 (69%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           ++L+  Q Y+T+++GTE  FTG+    K  G Y C+CC  PLF S +KFDSG GWPS+Y+
Sbjct: 31  EKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKFDSGCGWPSFYQ 90

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           P+  +    +D     M R E+ C  CDAHLGHVF DGP+PTG+RYCINSA+L
Sbjct: 91  PIDADSIRYIDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERYCINSASL 143



>sp|Q8ZEK7|MSRB_YERPE Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|AB0263|AB0263 conserved hypothetical
           protein YPO2158 [imported] - Yersinia pestis (strain
           CO92)>gb:AJ414151_523959 Yersinia pestis strain CO92
           complete genome; segment 11/20.>gb:BX936398_836727
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.
          Length = 137

 Score =  131 bits (330), Expect = 1e-29
 Identities = 59/113 (52%), Positives = 78/113 (69%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           ++L+  Q Y+T+++GTE  FTG+    K  G Y C+CC  PLF S +KFDSG GWPS+Y+
Sbjct: 12  EKLSDIQRYVTQERGTEAPFTGKLLHNKRDGVYQCLCCHQPLFISESKFDSGCGWPSFYQ 71

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           P+  +    +D     M R E+ C  CDAHLGHVF DGP+PTG+RYCINSA+L
Sbjct: 72  PIDADSIRYIDDYSHNMHRIEIRCGNCDAHLGHVFPDGPQPTGERYCINSASL 124



>gb:AY223143_1176607 Schistosoma japonicum clone ZZD1489 mRNA
           sequence.
          Length = 175

 Score =  131 bits (329), Expect = 2e-29
 Identities = 71/150 (47%), Positives = 93/150 (62%), Gaps = 1/150 (0%)
 Frame = -1

Query: 605 RISHCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKT 426
           RI   + +S  F   E  N + S  S E  K RL+  +F +T+ K TE+AF+G+Y + K+
Sbjct: 16  RIQALLKESNRFKSNEGKNNE-SQFSRESLKARLSDLEFRVTQNKETEKAFSGKYVNEKS 74

Query: 425 PGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACD 249
           PG Y CV C + LF S  KF    GWP++  P+  N + + +DLS   + R EV C  C+
Sbjct: 75  PGIYKCVVCSSKLFSSEAKFFCSCGWPAFNSPIEYNCLVASIDLSSGDV-RVEVSCKRCN 133

Query: 248 AHLGHVFDDGPEPTGKRYCINSAALKLKPK 159
           AHLGHVFDDGP+PTG RYCINS AL L PK
Sbjct: 134 AHLGHVFDDGPDPTGLRYCINSCALVLDPK 163



>gb:BA000012_669022 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 134

 Score =  131 bits (329), Expect = 2e-29
 Identities = 62/123 (50%), Positives = 80/123 (65%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+ RLT +Q+ + R  GTER  +      K  GT+ CV CD PLFES  KF+SGTG
Sbjct: 11  TDAEWRARLTPEQYAVMRNHGTERPGSCALLYEKRAGTFSCVGCDQPLFESKLKFESGTG 70

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+  PV  ++++ +D S   M R E  C+ C +HLGHVF+DGP PTG RYCIN  AL 
Sbjct: 71  WPSFNDPVPGSIETTVDRS-YGMVRTECHCSRCGSHLGHVFEDGPPPTGLRYCINGVALN 129

Query: 170 LKP 162
            +P
Sbjct: 130 FEP 132



>gb:AE016807_337712 Vibrio vulnificus CMCP6 chromosome I section 11
           of 11 of the complete sequence.>gb:AE016795_1047436
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 138

 Score =  130 bits (327), Expect = 3e-29
 Identities = 55/119 (46%), Positives = 79/119 (66%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD++W+++L+ Q++++ R++GTE  F+G+    K  G Y C CC  PLF S  K+DSG G
Sbjct: 11  SDQQWREQLSEQEYHVCREQGTEPPFSGKLLHNKDSGEYACTCCHAPLFSSVNKYDSGCG 70

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+  P+       LD     M R E+ CA CD+HLGHVF DGP+ TG+R+C+NS +L
Sbjct: 71  WPSFDAPINETAVLYLDDFSHGMKRVEIRCARCDSHLGHVFPDGPKTTGERFCVNSVSL 129



>sp|Q8D849|MSRB_VIBVU Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).
          Length = 154

 Score =  130 bits (327), Expect = 3e-29
 Identities = 55/119 (46%), Positives = 79/119 (66%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD++W+++L+ Q++++ R++GTE  F+G+    K  G Y C CC  PLF S  K+DSG G
Sbjct: 27  SDQQWREQLSEQEYHVCREQGTEPPFSGKLLHNKDSGEYACTCCHAPLFSSVNKYDSGCG 86

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+  P+       LD     M R E+ CA CD+HLGHVF DGP+ TG+R+C+NS +L
Sbjct: 87  WPSFDAPINETAVLYLDDFSHGMKRVEIRCARCDSHLGHVFPDGPKTTGERFCVNSVSL 145



>pir|C82439|C82439 peptide methionine sulfoxide reductase VCA0615
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004391_53746 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome II, section 48 of 93 of the
           complete chromosome.>gb:AE003853_1050692 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome II, complete
           chromosome.
          Length = 394

 Score =  130 bits (326), Expect = 4e-29
 Identities = 62/137 (45%), Positives = 87/137 (63%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K +   SDE+ + +LT  Q+ +T++ GTER F  EYWD K  G Y  +    PLF S+ K
Sbjct: 249 KAYVRPSDEQIRAKLTSLQYKVTQRDGTERPFDNEYWDNKEEGIYVDIVSGEPLFSSTDK 308

Query: 368 FDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI 189
           +DS TGWPS+ +P+ ++     D + +F  R EV     D+HLGHVF+DGP PTG RYC+
Sbjct: 309 YDSKTGWPSFTQPLNSSYIVTKDDNSLFYTRTEVRSRFADSHLGHVFNDGPAPTGLRYCM 368

Query: 188 NSAALKLKPK*EVSKGG 138
           NSAA++  PK E++  G
Sbjct: 369 NSAAMRFIPKQEMAAQG 385



>sp|Q9KLX6|MSAB_VIBCH Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].
          Length = 378

 Score =  130 bits (326), Expect = 4e-29
 Identities = 62/137 (45%), Positives = 87/137 (63%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K +   SDE+ + +LT  Q+ +T++ GTER F  EYWD K  G Y  +    PLF S+ K
Sbjct: 233 KAYVRPSDEQIRAKLTSLQYKVTQRDGTERPFDNEYWDNKEEGIYVDIVSGEPLFSSTDK 292

Query: 368 FDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCI 189
           +DS TGWPS+ +P+ ++     D + +F  R EV     D+HLGHVF+DGP PTG RYC+
Sbjct: 293 YDSKTGWPSFTQPLNSSYIVTKDDNSLFYTRTEVRSRFADSHLGHVFNDGPAPTGLRYCM 352

Query: 188 NSAALKLKPK*EVSKGG 138
           NSAA++  PK E++  G
Sbjct: 353 NSAAMRFIPKQEMAAQG 369



>gb:BA000037_721974 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 154

 Score =  129 bits (325), Expect = 5e-29
 Identities = 55/119 (46%), Positives = 79/119 (66%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD++W+++L+ Q++++ R++GTE  F+G+    K  G Y C CC  PLF S  K+DSG G
Sbjct: 27  SDQQWREQLSEQEYHVCREQGTEPPFSGKLLHNKDSGEYACTCCYAPLFSSVNKYDSGCG 86

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+  P+       LD     M R E+ CA CD+HLGHVF DGP+ TG+R+C+NS +L
Sbjct: 87  WPSFDAPINETAVLYLDDFSHGMKRVEIRCARCDSHLGHVFPDGPKTTGERFCVNSVSL 145



>gb:BA000036_719625 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927153_833432 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 6/10.>gb:AX763740_1474420 Sequence 47
           from Patent WO03040180.
          Length = 136

 Score =  129 bits (324), Expect = 7e-29
 Identities = 65/132 (49%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = -1

Query: 545 DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF 366
           DF  +SD EW++RLT Q+F++ R+ GTE    GEY +T T G Y C  C   LF S+ KF
Sbjct: 3   DFKLISDTEWRERLTPQEFHVLREAGTEPPHVGEYTNTTTEGVYSCRACGEELFRSTEKF 62

Query: 365 DSGTGWPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFD-DGPE-PTGKRY 195
           +S  GWPS++ P+ G+ +  K DLS+  M R E+LCA C +H+GHVF+ +G + PT  RY
Sbjct: 63  ESHCGWPSFFSPLAGDKIIEKEDLSL-GMRRVEILCANCGSHMGHVFEGEGYDTPTDLRY 121

Query: 194 CINSAALKLKPK 159
           CINS +LKL+ K
Sbjct: 122 CINSISLKLEEK 133



>gb:AE016822_340775 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 139

 Score =  129 bits (323), Expect = 9e-29
 Identities = 62/127 (48%), Positives = 80/127 (62%), Gaps = 1/127 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDEEW++ LT +Q+ + RQ GTE+ +TGE  D    G Y C  C   LF S TKFDSG G
Sbjct: 13  SDEEWRRELTPEQYGVLRQAGTEQPWTGELLDESRAGVYACAACGAELFRSGTKFDSGCG 72

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDG-PEPTGKRYCINSAAL 174
           WPS+Y+ V       L+ + + + R EV CA C +HLGHVF DG   PTG RYC+NS +L
Sbjct: 73  WPSFYESVRPEAVELLEDTRLGITRTEVRCANCGSHLGHVFPDGFRTPTGDRYCMNSISL 132

Query: 173 KLKPK*E 153
             +P+ E
Sbjct: 133 DFQPEDE 139



>sp|P45213|MSAB_HAEIN Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].>pir|E64124|E64124
           peptide methionine sulfoxide reductase - Haemophilus
           influenzae (strain Rd KW20)>gb:U32823_205115 Haemophilus
           influenzae Rd KW20 section 138 of 163 of the complete
           genome.>gb:L42023_1097664 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 353

 Score =  128 bits (322), Expect = 1e-28
 Identities = 66/141 (46%), Positives = 87/141 (61%), Gaps = 1/141 (0%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           +  KD+   SD E K +LT  Q+ +T+ K TER+F+ EYWD   PG Y  +    P+F S
Sbjct: 203 IDEKDYPKPSDAELKAKLTPLQYSVTQNKHTERSFSNEYWDNFQPGIYVDITTGEPVFSS 262

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGK 201
           + KF+SG GWPS+ KP+  +V      +   M R EVL  A +AHLGHVFDDGP +  G 
Sbjct: 263 NDKFESGCGWPSFTKPIIKDVVHYETDNSFNMQRTEVLSRAGNAHLGHVFDDGPKDKGGL 322

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYCINSA++K  P  E+ K G
Sbjct: 323 RYCINSASIKFIPLAEMEKAG 343



>gb:AE012789_285593 Chlorobium tepidum TLS section 10 of 194 of the
           complete genome.>gb:AE006470_932761 Chlorobium tepidum
           TLS complete genome.
          Length = 185

 Score =  128 bits (321), Expect = 2e-28
 Identities = 59/122 (48%), Positives = 77/122 (63%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +E WKK L+ + + + R   TERAFTG+YW+ +  GTY+C  C   LF S  KF S  GW
Sbjct: 55  NEVWKKVLSPELYAVARLAETERAFTGKYWNYEGLGTYYCAACGNTLFRSDAKFASTCGW 114

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           PS+++ V     +  + +   M R EVLC  C AHLGHVFDDGP PTGKR+C+NS  L  
Sbjct: 115 PSFFETVRPGSVAYREDTSFGMVRTEVLCGRCGAHLGHVFDDGPPPTGKRFCMNSICLDF 174

Query: 167 KP 162
           +P
Sbjct: 175 EP 176



>gb:AE017041_385561 Bacillus anthracis str. Ames section 18 of 18 of
           the complete genome.>gb:AE017225_410655 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_455408 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1015266 Bacillus
           anthracis str. Ames complete genome.
          Length = 321

 Score =  127 bits (320), Expect = 2e-28
 Identities = 67/127 (52%), Positives = 81/127 (63%), Gaps = 1/127 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K++L   QFY+T++ GTE  F  EYW+ K  G Y  +    PLF S  KFDSG GWPS+ 
Sbjct: 184 KEKLNDMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSIDKFDSGCGWPSFT 243

Query: 335 KPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK 159
           KPV   +VK K+D+S   M R EV     D+HLGHVF DGP P G RYCINSAAL+  PK
Sbjct: 244 KPVMSASVKEKMDVS-HNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRYCINSAALRFIPK 302

Query: 158 *EVSKGG 138
            E+ K G
Sbjct: 303 EELEKEG 309



>sp|Q9AL99|MSAB_ACTAC Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].>gb:AY026361_585106
           Actinobacillus actinomycetemcomitans methionine
           sulfoxide reductase gene, complete cds.
          Length = 356

 Score =  127 bits (320), Expect = 2e-28
 Identities = 67/146 (45%), Positives = 84/146 (57%), Gaps = 1/146 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +  KD+   SD E K +LT  Q+ +T+ K TE +F+ EYWD   PG 
Sbjct: 193 YCHIDLEQANYVIIDEKDYPKPSDAELKAKLTPLQYSVTQNKNTEHSFSNEYWDNFKPGI 252

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ KP+   V +  D     M R EV+  +  AHLG
Sbjct: 253 YVDVTTGEPLFSSKDKFESGCGWPSFTKPITKEVVTYQDDHSFNMLRTEVISRSGKAHLG 312

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKP 162
           HVFDDGP +  G RYCINSAA+K  P
Sbjct: 313 HVFDDGPKDKGGLRYCINSAAVKFIP 338



>gb:CP000001_855721 Bacillus cereus ZK, complete genome.
          Length = 321

 Score =  127 bits (319), Expect = 3e-28
 Identities = 67/127 (52%), Positives = 81/127 (63%), Gaps = 1/127 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K++L   QFY+T++ GTE  F  EYW+ K  G Y  +    PLF S  KFDSG GWPS+ 
Sbjct: 184 KEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSIDKFDSGCGWPSFT 243

Query: 335 KPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK 159
           KPV   +VK K+D+S   M R EV     D+HLGHVF DGP P G RYCINSAAL+  PK
Sbjct: 244 KPVMSASVKEKMDVS-HNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRYCINSAALRFIPK 302

Query: 158 *EVSKGG 138
            E+ K G
Sbjct: 303 EELEKEG 309



>gb:AP006840_568950 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 319

 Score =  127 bits (319), Expect = 3e-28
 Identities = 68/131 (51%), Positives = 83/131 (63%), Gaps = 1/131 (0%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           D E ++RLT  Q+ +T+   TER FTGEYW+    G Y  V    PLF S  KFD+G GW
Sbjct: 181 DAELRRRLTPIQYEVTQLGATERPFTGEYWNHFEEGIYVDVVSGEPLFSSRDKFDAGCGW 240

Query: 347 PSYYKP-VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           PS+ +P V  N+  +LDLS   M R EV     D+HLGHVF DGP PTG RYCINSAAL+
Sbjct: 241 PSFTRPLVPENIVERLDLS-HGMVRTEVRSRGADSHLGHVFPDGPAPTGLRYCINSAALR 299

Query: 170 LKPK*EVSKGG 138
             PK ++ K G
Sbjct: 300 FIPKEDLEKEG 310



>gb:AE017355_466401 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 321

 Score =  127 bits (319), Expect = 3e-28
 Identities = 67/127 (52%), Positives = 81/127 (63%), Gaps = 1/127 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K++L   QFY+T++ GTE  F  EYW+ K  G Y  +    PLF S  KFDSG GWPS+ 
Sbjct: 184 KEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWPSFT 243

Query: 335 KPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK 159
           KPV   +VK K+D+S   M R EV     D+HLGHVF DGP P G RYCINSAAL+  PK
Sbjct: 244 KPVMSASVKEKMDVS-HNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRYCINSAALRFIPK 302

Query: 158 *EVSKGG 138
            E+ K G
Sbjct: 303 EELEKEG 309



>gb:AE017340_457285 Idiomarina loihiensis L2TR, complete genome.
          Length = 370

 Score =  127 bits (319), Expect = 3e-28
 Identities = 62/141 (43%), Positives = 85/141 (60%)
 Frame = -1

Query: 560 EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE 381
           +   + F   SD E KKRLT  Q+ +T++  TE AF   YWD +  G Y  V    PLF 
Sbjct: 219 KAEQQSFVKPSDSELKKRLTDIQYAVTQEDQTEPAFDNRYWDNERKGIYVDVVSGEPLFS 278

Query: 380 SSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK 201
           S+ K++SGTGWPS+ KP+  +   + D S  F  R E+     D+H+GHVF+DGP PTG 
Sbjct: 279 SADKYESGTGWPSFTKPISPDAVVEKDDSSWFYTRTEIRSRKADSHVGHVFNDGPPPTGL 338

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYC+NSAAL+  P  ++ + G
Sbjct: 339 RYCMNSAALRFIPLEKMEEEG 359



>gb:AE017311_438830 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 3 of 12 of the complete
           genome.>gb:AE017285_1071991 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 143

 Score =  127 bits (319), Expect = 3e-28
 Identities = 65/132 (49%), Positives = 84/132 (63%), Gaps = 1/132 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S EE KKRLT  Q+ +T+++GTE  F  EYWD K  G Y  +    PLF S  K+DSGTG
Sbjct: 4   SREELKKRLTPLQYDVTQEEGTEPPFRNEYWDEKREGLYVDIVSGEPLFSSRDKYDSGTG 63

Query: 350 WPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS+ +PV    +  ++D   +F  R EV     D+HLGHVF DGP+PTG RYCINSAAL
Sbjct: 64  WPSFTRPVDPQGIVERVDRK-LFTTRTEVRSRNGDSHLGHVFPDGPQPTGLRYCINSAAL 122

Query: 173 KLKPK*EVSKGG 138
           +  P  ++ + G
Sbjct: 123 RFVPVEDLEQQG 134



>gb:AE017281_426768 Bacillus cereus ATCC 10987, section 18 of 18 of
           the complete genome.>gb:AE017194_1065187 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 321

 Score =  127 bits (319), Expect = 3e-28
 Identities = 67/127 (52%), Positives = 81/127 (63%), Gaps = 1/127 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K++L   QFY+T++ GTE  F  EYW+ K  G Y  +    PLF S  KFDSG GWPS+ 
Sbjct: 184 KEKLNEMQFYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWPSFT 243

Query: 335 KPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK 159
           KPV   +VK K+D+S   M R EV     D+HLGHVF DGP P G RYCINSAAL+  PK
Sbjct: 244 KPVMSASVKEKMDVS-HNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRYCINSAALRFIPK 302

Query: 158 *EVSKGG 138
            E+ K G
Sbjct: 303 EELEKEG 309



>gb:AE017340_457026 Idiomarina loihiensis L2TR, complete genome.
          Length = 133

 Score =  127 bits (318), Expect = 3e-28
 Identities = 56/129 (43%), Positives = 84/129 (65%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           +S  D+S+ +++EW++ L  + +Y+ R+KGTER F+G+Y      G YHC  C   LFE+
Sbjct: 1   MSEHDWSNRNEQEWREILGDEAYYVLREKGTERPFSGKYLSCDKDGVYHCAGCGQKLFEA 60

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKR 198
             +FD+  GWPS+ + +  ++    D S   M R E+LC+ C  HLGHVFDDGP  TG+R
Sbjct: 61  GHQFDAHCGWPSFDEAIKGSIDYVKD-SSHGMTRTEILCSQCGGHLGHVFDDGPTETGQR 119

Query: 197 YCINSAALK 171
           YC+NS A++
Sbjct: 120 YCVNSLAMR 128



>gb:AE017015_380254 Bacillus cereus ATCC 14579 section 18 of 18 of
           the complete genome.>gb:AE016877_1020504 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 321

 Score =  126 bits (316), Expect = 6e-28
 Identities = 66/127 (51%), Positives = 81/127 (63%), Gaps = 1/127 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K++L   Q+Y+T++ GTE  F  EYW+ K  G Y  +    PLF S  KFDSG GWPS+ 
Sbjct: 184 KEKLNEMQYYVTQENGTEPPFRNEYWNHKEEGLYVDIVSGEPLFTSLDKFDSGCGWPSFT 243

Query: 335 KPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK 159
           KPV   +VK K+D+S   M R EV     D+HLGHVF DGP P G RYCINSAAL+  PK
Sbjct: 244 KPVMSASVKEKMDVS-HNMTRTEVRSKEGDSHLGHVFPDGPGPNGLRYCINSAALRFIPK 302

Query: 158 *EVSKGG 138
            E+ K G
Sbjct: 303 EELEKEG 309



>gb:CR628336_111219 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_114306 Legionella pneumophila str.
           Lens complete genome.
          Length = 167

 Score =  125 bits (315), Expect = 8e-28
 Identities = 62/129 (48%), Positives = 81/129 (62%), Gaps = 1/129 (0%)
 Frame = -1

Query: 521 EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS 342
           E  K+LT  Q+ +T+   TE++F   YW+ K  G Y  +    PLF S+ K+DSGTGWPS
Sbjct: 28  EQLKKLTPLQYQVTQNGATEKSFDNAYWNNKEEGIYVDIVSGEPLFSSNDKYDSGTGWPS 87

Query: 341 YYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
           + KP+  + +    D S  F+ R EV     ++HLGHVF DGPEPTG RYC+NSAALK  
Sbjct: 88  FTKPIDTSYLVFHTDRSYFFIVRTEVRSKYANSHLGHVFKDGPEPTGLRYCMNSAALKFI 147

Query: 164 PK*EVSKGG 138
           PK E+ K G
Sbjct: 148 PKNEMEKAG 156



>pir|T35853|T35853 probable oxidoreductase - Streptomyces
           coelicolor>gb:SCO939126_179730 Streptomyces coelicolor
           A3(2) complete genome; segment 23/29.
          Length = 135

 Score =  125 bits (314), Expect = 1e-27
 Identities = 60/125 (48%), Positives = 78/125 (62%), Gaps = 2/125 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DE+W+  L   ++ + R+  TE AFTGEY DTKT G Y C  C   LF S+TKF+S  GW
Sbjct: 9   DEQWRAELAPAEYAVLREAATEPAFTGEYTDTKTEGVYSCRACGAELFTSTTKFESHCGW 68

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           PS+Y P   +    ++     M R EV CA C +HLGHVF  +  P PT +RYCINS +L
Sbjct: 69  PSFYDPRDTDAVELIEDRSHGMVRTEVRCARCGSHLGHVFKGEGYPTPTDQRYCINSISL 128

Query: 173 KLKPK 159
           +L+PK
Sbjct: 129 RLEPK 133



>gb:AY596297_631648 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 134

 Score =  125 bits (313), Expect = 1e-27
 Identities = 60/120 (50%), Positives = 81/120 (67%), Gaps = 1/120 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +DEEW++ L+ +++ I R+ GTE  F+ +  D +  G + C  C T LF+S  KF+S TG
Sbjct: 11  NDEEWREILSDEEYRILRESGTEPRFSSDLIDVEDEGVFTCAGCGTELFDSDRKFESETG 70

Query: 350 WPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           WPS++      NV+++ D S   M R EV+CA C  HLGHVFDDGPEP+GKRYCIN AAL
Sbjct: 71  WPSFWDVYQEGNVETRADNSH-GMERTEVVCAECGGHLGHVFDDGPEPSGKRYCINGAAL 129



>gb:BA000040_734115 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 178

 Score =  124 bits (312), Expect = 2e-27
 Identities = 60/123 (48%), Positives = 74/123 (60%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++ EW+ +LT QQ+ I R  GTER  +         G + C  CD PLF S TKF+SGTG
Sbjct: 51  TEAEWRAQLTPQQYEILRNHGTERPGSSPLLKEHRKGVFACAGCDLPLFASDTKFESGTG 110

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+Y+P+  NV  K +     M R EV C  C  HLGHVFDDGP+PTG RYCI+   L 
Sbjct: 111 WPSFYQPIEGNV-GKTEDRTYGMLRTEVHCRRCGGHLGHVFDDGPKPTGLRYCIDGFGLV 169

Query: 170 LKP 162
             P
Sbjct: 170 FHP 172



>gb:BA000012_669677 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 167

 Score =  124 bits (312), Expect = 2e-27
 Identities = 60/134 (44%), Positives = 80/134 (59%)
 Frame = -1

Query: 563 AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF 384
           A+ + K   + +D+EWK  L+   F + R++GTE   T    +    G + C  CD P++
Sbjct: 32  AQAAEKFEVTKTDDEWKAILSPAAFDVLRKQGTEYPGTSPLLNEHRKGIFACAGCDLPVY 91

Query: 383 ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG 204
            S TKFDSGTGWPS+++ + N +    D S + M R EV C  C  HLGHVFDDGP PTG
Sbjct: 92  PSETKFDSGTGWPSFWQEIANGIGKTEDRS-LGMTRTEVHCRRCGGHLGHVFDDGPAPTG 150

Query: 203 KRYCINSAALKLKP 162
            R+CIN  AL  KP
Sbjct: 151 LRHCINGVALSFKP 164



>gb:AE014297_1138919 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138920 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003688_1220912
           Drosophila melanogaster chromosome 3R, section 26 of 118
           of the complete sequence.>gb:AE003688_1220913 Drosophila
           melanogaster chromosome 3R, section 26 of 118 of the
           complete sequence.>gb:AF486578_1276098 Drosophila
           melanogaster cysteine-containing selenoprotein R-like
           protein mRNA, complete cds.>gb:AY070627_1294772
           Drosophila melanogaster RE73235 full insert cDNA.
          Length = 155

 Score =  124 bits (311), Expect = 2e-27
 Identities = 61/123 (49%), Positives = 80/123 (65%), Gaps = 1/123 (0%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 9   TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 68

Query: 356 TGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA 180
            GWP++   +    V    D SI    R EV CA C+AH+GHVF+DGP+PT KRYCINSA
Sbjct: 69  CGWPAFNDVLDKGKVTLHRDASIPERIRTEVRCARCNAHMGHVFEDGPKPTRKRYCINSA 128

Query: 179 ALK 171
           +++
Sbjct: 129 SIE 131



>gb:AE014297_1138917 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003688_1220910 Drosophila melanogaster
           chromosome 3R, section 26 of 118 of the complete
           sequence.
          Length = 197

 Score =  124 bits (311), Expect = 2e-27
 Identities = 61/123 (49%), Positives = 80/123 (65%), Gaps = 1/123 (0%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 51  TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 110

Query: 356 TGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA 180
            GWP++   +    V    D SI    R EV CA C+AH+GHVF+DGP+PT KRYCINSA
Sbjct: 111 CGWPAFNDVLDKGKVTLHRDASIPERIRTEVRCARCNAHMGHVFEDGPKPTRKRYCINSA 170

Query: 179 ALK 171
           +++
Sbjct: 171 SIE 173



>gb:AE017354_459477 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 167

 Score =  124 bits (311), Expect = 2e-27
 Identities = 61/129 (47%), Positives = 81/129 (62%), Gaps = 1/129 (0%)
 Frame = -1

Query: 521 EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS 342
           E  K+LT  Q+ +T+   TE++F   YW+ K  G Y  +    PLF S+ K+DSGTGWPS
Sbjct: 28  EQLKKLTPLQYQVTQNGATEKSFDNAYWNNKEEGIYVDIVSGEPLFSSNDKYDSGTGWPS 87

Query: 341 YYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
           + KP+  + +    D S  F+ R EV     ++HLGHVF DGPEPTG RYC+NSAALK  
Sbjct: 88  FTKPIDTSYLVFHTDRSYFFIVRTEVRSKYANSHLGHVFKDGPEPTGLRYCMNSAALKFI 147

Query: 164 PK*EVSKGG 138
           PK E+ + G
Sbjct: 148 PKKEMEQAG 156



>sp|P54155|MSRB_BACSU Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|F69940|F69940 transcription regulator
           PilB family homolog yppQ - Bacillus
           subtilis>gb:BACYACA_746716 Bacillus subtilis (YAC10-9
           clone) DNA region between the serA and kdg
           loci.>gb:BSUB0012_754133 Bacillus subtilis complete
           genome (section 12 of 21): from 2207806 to 2409180.
          Length = 143

 Score =  124 bits (311), Expect = 2e-27
 Identities = 65/131 (49%), Positives = 78/131 (59%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           EE  K L   Q+ +T+  GTE  F  EYWD K  G Y  +    PLF S  KFDS  GWP
Sbjct: 6   EEKIKSLNRMQYEVTQNNGTEPPFQNEYWDHKEEGLYVDIVSGKPLFTSKDKFDSQCGWP 65

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
           S+ KP+   V+ KLD S   M R EV     D+HLGHVF+DGP P G RYCINSAAL+  
Sbjct: 66  SFTKPIEEEVEEKLDTS-HGMIRTEVRSRTADSHLGHVFNDGPGPNGLRYCINSAALRFV 124

Query: 164 PK*EVSKGGQE 132
           PK ++ + G E
Sbjct: 125 PKHKLKEEGYE 135



>sp|Q9CMB1|MSRB_PASMU Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE006131_215811 Pasteurella multocida
           subsp. multocida str. Pm70 section 98 of 204 of the
           complete genome.>gb:AE004439_1118541 Pasteurella
           multocida subsp. multocida str. Pm70, complete genome.
          Length = 130

 Score =  124 bits (310), Expect = 3e-27
 Identities = 56/116 (48%), Positives = 74/116 (63%), Gaps = 2/116 (1%)
 Frame = -1

Query: 515 KKR--LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS 342
           KKR  +T  Q ++   +GTE  FTG+  D +  G Y CV C +PLF S TKFD+G GWPS
Sbjct: 2   KKREDMTEMQVHVCLNQGTEYPFTGKLLDQQKKGLYRCVVCHSPLFVSDTKFDAGCGWPS 61

Query: 341 YYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           +++ +       LD   +  PR E+ C  CDAHLGHVF+DGP PTG RYC+NS ++
Sbjct: 62  FFQAISPEAIRYLDDYTLSRPRTEIRCGQCDAHLGHVFEDGPPPTGLRYCVNSVSM 117



>gb:BA000038_725621 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 170

 Score =  123 bits (309), Expect = 4e-27
 Identities = 54/120 (45%), Positives = 78/120 (65%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD +W+++L   Q+Y+ RQ GTER F+ +  +   PG Y C  C   LF+S +KFDS TG
Sbjct: 44  SDAQWREQLGEAQYYVMRQHGTERPFSNQMCELFEPGLYRCAGCQNLLFDSGSKFDSRTG 103

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+ +P+ +N  S      +  PR EV C  C++HLGHVF DGP P+G RYC+N+ +++
Sbjct: 104 WPSFAQPMKSNAISYHLDETLARPRIEVRCNQCESHLGHVFPDGPAPSGLRYCVNAVSIE 163



>gb:AY142897_592080 Heliobacillus mobilis Peptide methionine
           sulfoxide reductase gene, partial cds.
          Length = 337

 Score =  123 bits (309), Expect = 4e-27
 Identities = 64/127 (50%), Positives = 79/127 (62%), Gaps = 1/127 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K++L+  Q+ +T+  GTE  F  EYWD    G Y  +    PLF S  KFDSG GWPS+ 
Sbjct: 199 KQKLSPVQYEVTQNNGTEPPFRNEYWDNHREGIYVDIVSGEPLFSSIDKFDSGCGWPSFS 258

Query: 335 KPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK 159
           +P+    VK K+DLS   M R EV     D+HLGHVFDDGP P G RYCINSAAL+  PK
Sbjct: 259 RPLHEEKVKEKMDLS-HGMTRTEVRSQGADSHLGHVFDDGPAPGGLRYCINSAALRFIPK 317

Query: 158 *EVSKGG 138
            ++ K G
Sbjct: 318 EDLEKEG 324



>gb:AE017283_430848 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 148

 Score =  123 bits (309), Expect = 4e-27
 Identities = 61/132 (46%), Positives = 80/132 (60%), Gaps = 3/132 (2%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           ++ E+W +RL+ +++Y+ R+ GTE  F GEY DT T G Y C  C   LF S+ KF S  
Sbjct: 17  LTPEQWHERLSDEEYYVLREAGTEAPFVGEYTDTTTEGVYRCRACGAELFRSTQKFHSSC 76

Query: 353 GWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINS 183
           GWPS+Y P+  + V+   D S+   PR EV CA CD+HLGHVF  +    PT  RYCINS
Sbjct: 77  GWPSFYAPLAEDRVRYLNDESLPGRPRTEVRCAQCDSHLGHVFAGEGFDTPTDLRYCINS 136

Query: 182 AALKLKPK*EVS 147
             L L P  E +
Sbjct: 137 ICLDLVPTDETT 148



>gb:AE016811_338735 Vibrio vulnificus CMCP6 chromosome II section 4
           of 6 of the complete sequence.>gb:AE016796_1048459
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 199

 Score =  123 bits (309), Expect = 4e-27
 Identities = 54/120 (45%), Positives = 78/120 (65%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD +W+++L   Q+Y+ RQ GTER F+ +  +   PG Y C  C   LF+S +KFDS TG
Sbjct: 73  SDAQWREQLGEAQYYVMRQHGTERPFSNQMCELFEPGLYRCAGCQNLLFDSGSKFDSRTG 132

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+ +P+ +N  S      +  PR EV C  C++HLGHVF DGP P+G RYC+N+ +++
Sbjct: 133 WPSFAQPMKSNAISYHLDETLARPRIEVRCNQCESHLGHVFPDGPAPSGLRYCVNAVSIE 192



>gb:BX842649_824287 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 4/11.
          Length = 175

 Score =  123 bits (308), Expect = 5e-27
 Identities = 67/161 (41%), Positives = 93/161 (57%), Gaps = 6/161 (3%)
 Frame = -1

Query: 602 ISHCVYDSLHFFYAEVS--NKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTK 429
           + H ++  +  F A +S   K++   SD E KK LT  Q+  T+Q  TE+ F   YW+ K
Sbjct: 1   MKHWIFVMVFVFSAAISAKEKEYVKPSDAELKKTLTPMQYQCTQQSATEKPFDNAYWNNK 60

Query: 428 TPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNN---VKSKLDLSIIFMPRQEVLCA 258
             G Y  +    PLF S+ K+DSGTGWPS+ KP+ ++    K   ++S+    R E+   
Sbjct: 61  REGIYVDIVSGEPLFSSTDKYDSGTGWPSFTKPIDDSSLVTKPDYEMSV---ERTELRSK 117

Query: 257 ACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
             D+HLGH+FDDGP +  GKRYCINSAALK  P  E+   G
Sbjct: 118 KADSHLGHLFDDGPKDKGGKRYCINSAALKFIPVEEMQAKG 158



>gb:AE017354_460451 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 173

 Score =  123 bits (308), Expect = 5e-27
 Identities = 60/128 (46%), Positives = 82/128 (64%), Gaps = 1/128 (0%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           K+LT  Q+ +T++  TE+ F   YW+ +  G Y  +    PLF S  K+DSGTGWPS+ K
Sbjct: 39  KQLTPLQYQVTQKAATEKPFDNPYWNNEQAGIYVDIVSGEPLFSSLDKYDSGTGWPSFTK 98

Query: 332 PVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKPK* 156
           P+   NV  K     +F  + EVL     +HLGHVF+DGP+PTG+RYC+NSAAL+  PK 
Sbjct: 99  PINTANVILKPARHYLFFVQTEVLSKNAQSHLGHVFNDGPKPTGERYCMNSAALRFIPKD 158

Query: 155 EVSKGGQE 132
           ++SK G E
Sbjct: 159 QMSKEGYE 166



>gb:AP006618_560132 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 147

 Score =  122 bits (307), Expect = 6e-27
 Identities = 59/126 (46%), Positives = 78/126 (61%), Gaps = 2/126 (1%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           ++ +EW+ +L  +++ + R+  TER FTGEY DTKT G Y C  C   LF S+ KFDS  
Sbjct: 16  LTPQEWRAKLNPEEYAVLREAATERPFTGEYTDTKTEGVYSCRACGAELFRSTEKFDSHC 75

Query: 353 GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDG--PEPTGKRYCINSA 180
           GWPS++ P  ++         + M R EVLCA C +HLGHVF+      PT KRYCINS 
Sbjct: 76  GWPSFFDPAKSDAVLLRPDDSLGMRRVEVLCANCHSHLGHVFEGEGYNTPTDKRYCINSI 135

Query: 179 ALKLKP 162
           AL+L P
Sbjct: 136 ALRLHP 141



>gb:AY669149_1345397 Schistosoma mansoni methionine sulfoxide
           reductase B2a (msrB) mRNA, complete cds.
          Length = 175

 Score =  122 bits (306), Expect = 8e-27
 Identities = 66/141 (46%), Positives = 87/141 (61%), Gaps = 1/141 (0%)
 Frame = -1

Query: 560 EVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFE 381
           E +N D S  S +  K RL+  +F +T+ K TE+ F+G+Y + K+PG Y CV C + LF 
Sbjct: 31  EDTNND-SPFSRDSLKARLSDLEFRVTQNKETEKPFSGKYVNEKSPGIYKCVVCSSKLFS 89

Query: 380 SSTKFDSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTG 204
           S  KF    GWP++  P+  N++   +DLS   + R EV C  C+AHLGHVFDDGP+PTG
Sbjct: 90  SEAKFYCSCGWPAFNSPIECNSLILSIDLSSGEV-RVEVSCKGCNAHLGHVFDDGPKPTG 148

Query: 203 KRYCINSAALKLKPK*EVSKG 141
            RYCINS AL L      S G
Sbjct: 149 LRYCINSCALILDSDSSSSSG 169



>gb:BA000030_700091 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 135

 Score =  121 bits (304), Expect = 1e-26
 Identities = 59/124 (47%), Positives = 75/124 (60%), Gaps = 2/124 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DE W+  LT  ++ + R+ GTE AFTGEY DT+T G Y C  C   LF S+ KF+S  GW
Sbjct: 9   DEAWRAELTPAEYAVLRKAGTEPAFTGEYTDTRTKGVYSCRACGAELFTSNEKFESHCGW 68

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDG--PEPTGKRYCINSAAL 174
           PS+Y P   +    +D     M R EV CA C +HLGHVF+      PT +RYCINS +L
Sbjct: 69  PSFYDPKNTDAVELIDDRSHGMVRTEVRCARCGSHLGHVFEGEGYATPTDQRYCINSISL 128

Query: 173 KLKP 162
           +L P
Sbjct: 129 RLAP 132



>gb:CR522870_100072 Desulfotalea psychrophila LSv54 chromosome.
          Length = 366

 Score =  121 bits (304), Expect = 1e-26
 Identities = 59/137 (43%), Positives = 81/137 (59%), Gaps = 1/137 (0%)
 Frame = -1

Query: 566 YAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPL 387
           +      ++  +SD++ +KRLT  Q+ + R+ GTE  +   YWD K  G Y  +    PL
Sbjct: 213 WGSAGEMNYEKMSDDQLRKRLTALQYEVVREDGTEPPYDNAYWDNKRAGIYVDIVSGEPL 272

Query: 386 FESSTKFDSGTGWPSYYKP-VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEP 210
           F S  K+ SGTGWPS+ +P V  NV    D S  F+ R E+     D+HLGH+F DGP P
Sbjct: 273 FSSRDKYKSGTGWPSFIRPLVAENVVELKDNSF-FLRRTELRSLHADSHLGHLFTDGPAP 331

Query: 209 TGKRYCINSAALKLKPK 159
           TG RYCINSA+L+  P+
Sbjct: 332 TGLRYCINSASLRFIPR 348



>sp|Q9RUK6|MSRB_DEIRA Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|C75404|C75404 MsrA-related protein -
           Deinococcus radiodurans (strain R1)>gb:AE001983_41647
           Deinococcus radiodurans R1 section 120 of 229 of the
           complete chromosome 1.>gb:AE000513_882542 Deinococcus
           radiodurans R1 complete chromosome 1.
          Length = 157

 Score =  121 bits (304), Expect = 1e-26
 Identities = 64/137 (46%), Positives = 84/137 (61%), Gaps = 1/137 (0%)
 Frame = -1

Query: 545 DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF 366
           DF   SD + ++RLT  Q+ +T+ +GTERAFTGEYWD    G Y  V    PLF S  K+
Sbjct: 8   DFQKPSDNDLRERLTPIQYQVTQHEGTERAFTGEYWDHDEDGIYVDVVSGEPLFSSLDKY 67

Query: 365 DSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCI 189
           D+G GWPS+ +P+ +   ++     I   R EV  A+ D+HLGHVF DGP +  G RYCI
Sbjct: 68  DAGCGWPSFTQPIPDVALTENTDYKIGYARTEVRSASADSHLGHVFPDGPRDRGGLRYCI 127

Query: 188 NSAALKLKPK*EVSKGG 138
           NSAAL+  P  E+   G
Sbjct: 128 NSAALRFVPLSELDAQG 144



>gb:CR382129_1661533 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 129

 Score =  121 bits (303), Expect = 2e-26
 Identities = 56/129 (43%), Positives = 82/129 (63%), Gaps = 2/129 (1%)
 Frame = -1

Query: 539 SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS 360
           S+ +D EW+  L+ +QF + R+KGTER  TG+Y  T   GTY+C  CD PL+ S  KF S
Sbjct: 2   SNKTDSEWRAVLSPEQFRVLREKGTERPHTGKYNSTFDNGTYNCAGCDAPLYTSKAKFRS 61

Query: 359 GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCIN 186
             GWP++Y+ +   +K  +D   + M R E++CA CD HLGH+F  +    PT +R+C+N
Sbjct: 62  SCGWPAFYEAIPGALKLNVD-KTLGMTRTEMVCANCDGHLGHIFKGEGYDTPTDERHCVN 120

Query: 185 SAALKLKPK 159
           S +L  KP+
Sbjct: 121 SVSLSFKPE 129



>gb:AE014297_1138922 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003688_1220915 Drosophila melanogaster
           chromosome 3R, section 26 of 118 of the complete
           sequence.
          Length = 197

 Score =  121 bits (303), Expect = 2e-26
 Identities = 60/127 (47%), Positives = 78/127 (61%), Gaps = 1/127 (0%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 9   TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 68

Query: 356 TGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA 180
            GWP++   +    V    D SI  M R EV C+ C AH+GHVFDDGP P  +R+CINSA
Sbjct: 69  CGWPAFNDVLDKGKVTLHRDASIPGMVRTEVRCSRCSAHMGHVFDDGPPPKHRRFCINSA 128

Query: 179 ALKLKPK 159
           ++    K
Sbjct: 129 SIDFVKK 135



>gb:AP006627_564066 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 144

 Score =  121 bits (303), Expect = 2e-26
 Identities = 63/137 (45%), Positives = 84/137 (61%), Gaps = 1/137 (0%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           +E KK+LT  Q+++T++ GTE  F  EY++T+  G Y  V    PLF S  K+D+G GWP
Sbjct: 7   DELKKKLTPIQYFVTQENGTEPPFQNEYYETEEEGIYVDVVSGKPLFSSKDKYDAGCGWP 66

Query: 344 SYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           S+ KP+    +  K D S  FM R EV     D+HLGHVF DGP P G RYCINSAAL+ 
Sbjct: 67  SFTKPIDEAEIIEKEDRS-HFMVRTEVRSKNADSHLGHVFPDGPGPNGLRYCINSAALRF 125

Query: 167 KPK*EVSKGGQEGCESV 117
            PK ++ + G    E +
Sbjct: 126 IPKAKLKEAGYGAYEKL 142



>gb:AE017179_398188 Porphyromonas gingivalis W83 section 8 of 8 of
           the complete genome.>gb:AE015924_1033799 Porphyromonas
           gingivalis W83 complete genome.
          Length = 352

 Score =  121 bits (303), Expect = 2e-26
 Identities = 68/156 (43%), Positives = 88/156 (56%), Gaps = 3/156 (1%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSN--KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTP 423
           +C  D   F  A  +N  + +    D E + RLT +Q+ +TR   TE AF  EYW+    
Sbjct: 186 YCHIDPSLFELARKANPARFYKKADDAELRARLTPEQYAVTRNNATEPAFDNEYWNEFRE 245

Query: 422 GTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAH 243
           G Y  V    PLF S+ KFDSG GWPS+ KP+G  + S+       M R EV     DAH
Sbjct: 246 GIYVDVTTGEPLFLSTDKFDSGCGWPSFSKPIGKELISERIDRSFGMTRTEVRSTTGDAH 305

Query: 242 LGHVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           LGH+F+DGP E  G RYCINSA+L+  PK ++ K G
Sbjct: 306 LGHLFNDGPLEKGGLRYCINSASLRFIPKEDMKKEG 341



>sp|Q8XJZ6|MSRB_CLOPE Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:BA000016_674647 Clostridium perfringens
           str. 13 DNA, complete genome.
          Length = 147

 Score =  121 bits (303), Expect = 2e-26
 Identities = 66/139 (47%), Positives = 85/139 (61%), Gaps = 2/139 (1%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           ++    EE KK LT +++Y+T++ GTER FT EYWD    G Y  +    PLF S  KF 
Sbjct: 3   YTKKEKEELKKVLTEEEYYVTQENGTERPFTNEYWDFNGEGIYVDITTGEPLFTSKDKFH 62

Query: 362 SGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-GKRYCI 189
           S  GWP++ KP+  + +K K+D S   M R EV     D+HLGHVF DGPE   G RYCI
Sbjct: 63  SSCGWPAFSKPIDRSIIKEKVDKS-HGMIRTEVRSKLGDSHLGHVFCDGPEELGGLRYCI 121

Query: 188 NSAALKLKPK*EVSKGGQE 132
           NSA+LK  PK E+ + G E
Sbjct: 122 NSASLKFIPKEELKEKGYE 140



>sp|Q92Y46|MSB2_RHIME Peptide methionine sulfoxide reductase msrB 2
           (EC 1.8.4.6).>pir|B95392|B95392 protein [imported] -
           Sinorhizobium meliloti (strain 1021) magaplasmid
           pSymA>gb:AE007290_225002 Sinorhizobium meliloti 1021
           plasmid pSymA section 96 of 121 of the complete plasmid
           sequence.>gb:AE006469_1102770 Sinorhizobium meliloti
           1021 plasmid pSymA, complete sequence.
          Length = 147

 Score =  121 bits (303), Expect = 2e-26
 Identities = 68/135 (50%), Positives = 85/135 (62%), Gaps = 1/135 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +DEE  K LT +Q+ +T+Q GTER FTGEY D K PG Y  +    PLF S+ KFDSG G
Sbjct: 6   TDEEVSK-LTPEQYRVTQQNGTERPFTGEYTDNKRPGIYVDIVSGEPLFASADKFDSGCG 64

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-GKRYCINSAAL 174
           WPS+ KP+     ++L  +   M R EV  A  D+HLGHVF DGP+   G RYCINSAAL
Sbjct: 65  WPSFTKPIVPANVNELRDNSHGMIRTEVRSAHGDSHLGHVFPDGPQDRGGLRYCINSAAL 124

Query: 173 KLKPK*EVSKGGQEG 129
           +  P+ E+   G  G
Sbjct: 125 RFIPREEMEAEGYGG 139



>gb:BT001621_1356394 Drosophila melanogaster RE36040 full insert
           cDNA.
          Length = 150

 Score =  120 bits (302), Expect = 2e-26
 Identities = 59/122 (48%), Positives = 77/122 (63%), Gaps = 1/122 (0%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 9   TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 68

Query: 356 TGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSA 180
            GWP++   +    V    D SI  M R EV C+ C AH+GHVFDDGP P  +R+CINSA
Sbjct: 69  CGWPAFNDVLDKGKVTLHRDASIPGMVRTEVRCSRCSAHMGHVFDDGPPPKHRRFCINSA 128

Query: 179 AL 174
           ++
Sbjct: 129 SI 130



>gb:AP008231_580856 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 202

 Score =  120 bits (302), Expect = 2e-26
 Identities = 52/124 (41%), Positives = 79/124 (63%)
 Frame = -1

Query: 533 VSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           +S+ EW++RL+ + + + R+  TER FT +    K  G Y C  C+ PLFES+ K++SGT
Sbjct: 75  LSEAEWQQRLSPEAYAVLREAATERPFTSDLLAEKRVGQYCCAGCEQPLFESAAKYESGT 134

Query: 353 GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           GWPS+ + +  ++  + D  ++ +PR E  C+ C  H GHVF+DGP PTGKR+C N  A+
Sbjct: 135 GWPSFREAIAGSLGFQTDYKLV-VPRTEYHCSRCGGHQGHVFNDGPAPTGKRFCNNGVAI 193

Query: 173 KLKP 162
              P
Sbjct: 194 AFVP 197



>gb:AP006841_574093 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 361

 Score =  120 bits (302), Expect = 2e-26
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 2/144 (1%)
 Frame = -1

Query: 563 AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF 384
           AE S  ++    D   + +LT +Q+ +T++  TE AF  EYWD K  G Y  +    PLF
Sbjct: 208 AEQSQTNYKKTDDATLRSKLTPEQYAVTQKNATEPAFHNEYWDEKRDGIYVDITTGEPLF 267

Query: 383 ESSTKFDSGTGWPSYYKPVGNNV-KSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EP 210
            S+ KFDSG GWPS+ KP+   V K K+D S   M R EV     DAHLGHVF DGP E 
Sbjct: 268 ISTDKFDSGCGWPSFTKPIEKEVIKEKMDTS-HGMIRTEVRSKTGDAHLGHVFTDGPKEK 326

Query: 209 TGKRYCINSAALKLKPK*EVSKGG 138
            G RYCINSA+L+  PK ++ + G
Sbjct: 327 GGLRYCINSASLRFIPKEKMKEEG 350



>gb:BX248358_762670 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 5/8.
          Length = 136

 Score =  120 bits (300), Expect = 4e-26
 Identities = 60/131 (45%), Positives = 83/131 (63%), Gaps = 3/131 (2%)
 Frame = -1

Query: 545 DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF 366
           +F  ++D EW++RL+ +++ + R+ GTE   TGEY +T T G Y C  C T LF S+ KF
Sbjct: 3   NFKLITDTEWRQRLSSEEYRVLREAGTEAPHTGEYTNTTTEGIYSCRACGTELFRSTEKF 62

Query: 365 DSGTGWPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRY 195
           +S  GWPS++ P+ G+ V  + D S   M R EV+CA C++HLGHVF  +    PT  RY
Sbjct: 63  NSHCGWPSFFSPLAGDKVIERTDTS-HGMVRTEVICANCESHLGHVFAGEGYDTPTDLRY 121

Query: 194 CINSAALKLKP 162
           CINS  L L P
Sbjct: 122 CINSVCLTLIP 132



>gb:BA000035_716574 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 137

 Score =  120 bits (300), Expect = 4e-26
 Identities = 60/132 (45%), Positives = 83/132 (62%), Gaps = 3/132 (2%)
 Frame = -1

Query: 545 DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF 366
           DF  ++D EW++RL  +++ + RQ GTE    GEY +T T G Y C  C   LF S+ KF
Sbjct: 3   DFKLITDAEWRERLNPEEYRVLRQAGTEAPHVGEYTNTTTEGVYSCRACGEELFRSTEKF 62

Query: 365 DSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDG--PEPTGKRY 195
           D+  GWPS++ P+  + +  K DLS+  M R EVLCA C +H+GHVF+      PT  RY
Sbjct: 63  DAHCGWPSFFSPLAKDKIIEKEDLSL-GMRRIEVLCANCGSHMGHVFEGEGFNTPTDLRY 121

Query: 194 CINSAALKLKPK 159
           CINS +L+L+ K
Sbjct: 122 CINSISLRLEEK 133



>gb:AE017333_448144 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857953 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 151

 Score =  120 bits (300), Expect = 4e-26
 Identities = 64/130 (49%), Positives = 79/130 (60%), Gaps = 1/130 (0%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           EE  K+LT  Q+ +T++ GTE  F  EYWD    G Y  +    PLF S  KFD+  GWP
Sbjct: 6   EERLKQLTRMQYEVTQKNGTEPPFQNEYWDLHEDGIYVDIVSGKPLFSSLDKFDAHCGWP 65

Query: 344 SYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           S+ KPV    ++ KLD S   M R EV   + D+HLGHVF DGP P G RYCINSAAL+ 
Sbjct: 66  SFTKPVDAGEIEEKLDTS-HGMIRTEVRSKSADSHLGHVFPDGPGPDGLRYCINSAALRF 124

Query: 167 KPK*EVSKGG 138
            PK ++ K G
Sbjct: 125 VPKDDLEKEG 134



>gb:AE017154_392716 Haemophilus ducreyi strain 35000HP section 4 of
           6 of the complete genome.>gb:AE017143_1026978
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 130

 Score =  120 bits (300), Expect = 4e-26
 Identities = 56/114 (49%), Positives = 71/114 (62%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           LT +Q  I    GTE  FTG++ +    GTY CV C   LF S TKFD+G GWPS+Y+ +
Sbjct: 7   LTKEQREILINHGTELPFTGKFLNEARTGTYRCVRCHHSLFRSDTKFDAGCGWPSFYEAI 66

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLK 165
                  +D   +  PR E+ CA CD+HLGHVF+DGP PTG R+C+NS AL  K
Sbjct: 67  SAEALRYVDDYRLSRPRTEIRCAHCDSHLGHVFNDGPPPTGLRFCLNSVALNFK 120



>gb:SME591783_184459 Sinorhizobium meliloti 1021 complete
           chromosome; segment 2/12.
          Length = 164

 Score =  119 bits (299), Expect = 5e-26
 Identities = 51/124 (41%), Positives = 77/124 (62%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           +D EW+  L   ++ + R++GTE  F+    + K  G +HC  C+ P++ S  K+DSGTG
Sbjct: 40  TDAEWRALLGEDRYRVLREEGTEPPFSSALDNEKRNGVFHCAGCELPVYSSDAKYDSGTG 99

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+++ +   + ++ D   +F+ R E  C  C  HLGH+FDDGP PTGKR+CIN  AL 
Sbjct: 100 WPSFWQALPGAIGTRED-DTLFVTRTECHCRRCGGHLGHIFDDGPPPTGKRHCINGLALS 158

Query: 170 LKPK 159
             P+
Sbjct: 159 FVPE 162



>gb:AY316747_609057 Rhizobium sp. NGR234 megaplasmid 2 contig 1,
           complete sequence.
          Length = 147

 Score =  118 bits (296), Expect = 1e-25
 Identities = 68/131 (51%), Positives = 81/131 (61%), Gaps = 2/131 (1%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           +E   +LT +Q+ +T+Q GTER FTGEY D K PG Y  +    PLF S+ KFDSG GWP
Sbjct: 7   DEAVSKLTPEQYRVTQQNGTERPFTGEYTDNKRPGIYVDIVSGEPLFASADKFDSGCGWP 66

Query: 344 SYYKP-VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-GKRYCINSAALK 171
           S+ KP V  NV    D S   M R EV     D+HLGHVF DGPE   G RYCINSAAL+
Sbjct: 67  SFTKPIVPANVNELRDAS-HGMIRTEVRSKHGDSHLGHVFPDGPEDRGGLRYCINSAALR 125

Query: 170 LKPK*EVSKGG 138
             P+ E+   G
Sbjct: 126 FIPREEMEAEG 136



>gb:AE014297_1138921 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003688_1220914 Drosophila melanogaster
           chromosome 3R, section 26 of 118 of the complete
           sequence.>gb:BT011487_1357969 Drosophila melanogaster
           LD07760 full insert cDNA.
          Length = 166

 Score =  118 bits (295), Expect = 2e-25
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 12/134 (8%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 9   TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 68

Query: 356 TGWPSYYKPVG-NNVKSKLDLSI--------IFMP---RQEVLCAACDAHLGHVFDDGPE 213
            GWP++   +    V    D SI        I  P   R EV CA C+AH+GHVF+DGP+
Sbjct: 69  CGWPAFNDVLDKGKVTLHRDASIPGGNILLLIAHPERIRTEVRCARCNAHMGHVFEDGPK 128

Query: 212 PTGKRYCINSAALK 171
           PT KRYCINSA+++
Sbjct: 129 PTRKRYCINSASIE 142



>gb:AE014297_1138918 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003688_1220911 Drosophila melanogaster
           chromosome 3R, section 26 of 118 of the complete
           sequence.
          Length = 208

 Score =  118 bits (295), Expect = 2e-25
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 12/134 (8%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 51  TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 110

Query: 356 TGWPSYYKPVG-NNVKSKLDLSI--------IFMP---RQEVLCAACDAHLGHVFDDGPE 213
            GWP++   +    V    D SI        I  P   R EV CA C+AH+GHVF+DGP+
Sbjct: 111 CGWPAFNDVLDKGKVTLHRDASIPGGNILLLIAHPERIRTEVRCARCNAHMGHVFEDGPK 170

Query: 212 PTGKRYCINSAALK 171
           PT KRYCINSA+++
Sbjct: 171 PTRKRYCINSASIE 184



>sp|Q8INK9|MSRB_DROME Methionine-R-sulfoxide reductase (EC 1.8.4.-)
           (Selenoprotein R).
          Length = 207

 Score =  118 bits (295), Expect = 2e-25
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 12/134 (8%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 50  TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 109

Query: 356 TGWPSYYKPVG-NNVKSKLDLSI--------IFMP---RQEVLCAACDAHLGHVFDDGPE 213
            GWP++   +    V    D SI        I  P   R EV CA C+AH+GHVF+DGP+
Sbjct: 110 CGWPAFNDVLDKGKVTLHRDASIPGGNILLLIAHPERIRTEVRCARCNAHMGHVFEDGPK 169

Query: 212 PTGKRYCINSAALK 171
           PT KRYCINSA+++
Sbjct: 170 PTRKRYCINSASIE 183



>gb:CR382134_1666984 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 129

 Score =  117 bits (294), Expect = 2e-25
 Identities = 59/126 (46%), Positives = 80/126 (63%), Gaps = 4/126 (3%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTP--GTYHCVCCDTPLFESSTKFDSG 357
           S+EEWK  L+ QQF + RQ+GTE  +TGEY        G Y CV C  PL++S TKFDS 
Sbjct: 4   SEEEWKAILSPQQFRVLRQQGTEAPYTGEYNSKPATKAGVYECVGCGNPLYKSLTKFDSN 63

Query: 356 TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINS 183
            GWP++Y+ + +++K   DLS   M R+E+ C  CD HLGH+F  +    PT +R+C+NS
Sbjct: 64  CGWPAFYEAIPDSLKILKDLS-HGMVREEMRCNKCDGHLGHIFRGEGYKNPTDERHCVNS 122

Query: 182 AALKLK 165
             LK K
Sbjct: 123 VCLKFK 128



>gb:AY458645_619842 Uncultured bacterium 577 clone EBAC080-L12H07
           genomic sequence.
          Length = 153

 Score =  117 bits (293), Expect = 3e-25
 Identities = 58/120 (48%), Positives = 74/120 (61%)
 Frame = -1

Query: 521 EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS 342
           E K +L+ +QF +T++ GTE  F   YW+   PG Y  V     LF S  K+DSGTGWPS
Sbjct: 11  ELKSKLSAEQFKVTQKGGTEEPFRNLYWNNSEPGLYVDVVSGESLFSSLDKYDSGTGWPS 70

Query: 341 YYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKP 162
           + +PV N+   +   +   M R EV     D+HLGHVF DGP PTGKRYCINSA+L+  P
Sbjct: 71  FTRPVQNSGIIEKKDNEYGMVRTEVRSGYADSHLGHVFTDGPSPTGKRYCINSASLRFIP 130



>sp|Q9KCX2|MSRB_BACHD Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|G83830|G83830 hypothetical protein
           BH1447 [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_655393 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 143

 Score =  117 bits (293), Expect = 3e-25
 Identities = 59/130 (45%), Positives = 77/130 (59%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +EE KK+LT  Q+ +T+  GTE  F  EY+D +  G Y  +    PLF S  K+D+G GW
Sbjct: 5   NEELKKKLTPLQYEVTQNNGTEPPFRNEYYDLEAEGIYVDIVSGKPLFSSKDKYDAGCGW 64

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKL 168
           PS+ KP+      + +     M R EV     D+HLGHVF DGP P G RYCINSAAL+ 
Sbjct: 65  PSFTKPIDEEEVIEKEDRSHGMFRTEVRSKQADSHLGHVFPDGPGPNGLRYCINSAALRF 124

Query: 167 KPK*EVSKGG 138
            PK ++ K G
Sbjct: 125 IPKADLEKEG 134



>gb:BX842648_823743 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 3/11.
          Length = 138

 Score =  116 bits (291), Expect = 5e-25
 Identities = 60/125 (48%), Positives = 77/125 (61%), Gaps = 1/125 (0%)
 Frame = -1

Query: 530 SDE-EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGT 354
           SDE E KK LT +Q+ I  + GTER F   YW+    G Y       PLF S  KFDSG+
Sbjct: 12  SDEGELKKILTPEQYRIMVENGTERPFQNAYWNHHEQGIYVDAISGVPLFSSDDKFDSGS 71

Query: 353 GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
           GWPS+ +P+  +   ++      M R EV  ++ ++HLGHVFDDGP PTG RYCINSA+L
Sbjct: 72  GWPSFTRPISADAVKEIADYSHGMTRIEVRASSSNSHLGHVFDDGPAPTGLRYCINSASL 131

Query: 173 KLKPK 159
           K  P+
Sbjct: 132 KFIPR 136



>gb:BT001854_1356627 Drosophila melanogaster RH61230 full insert
           cDNA.
          Length = 157

 Score =  115 bits (289), Expect = 8e-25
 Identities = 59/129 (45%), Positives = 78/129 (60%), Gaps = 8/129 (6%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           +V+ EE +KRLT  Q+ +T++ GTER FTG Y      G Y C+ C   LF S TK+DSG
Sbjct: 9   TVNKEELRKRLTPVQYQVTQEAGTERPFTGCYNKHYEKGVYQCIVCHQDLFSSETKYDSG 68

Query: 356 TGWPSYYKPVG-NNVKSKLDLSI-------IFMPRQEVLCAACDAHLGHVFDDGPEPTGK 201
            GWP++   +    V    D SI       + M R EV C+ C AH+GHVFDDGP P  +
Sbjct: 69  CGWPAFNDVLDKGKVTLHRDASIPVVISKTLGMVRTEVRCSRCSAHMGHVFDDGPPPKHR 128

Query: 200 RYCINSAAL 174
           R+CINSA++
Sbjct: 129 RFCINSASI 137



>sp|Q97IU0|MSRB_CLOAB Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|B97091|B97091 methionine sulfoxide
           reductase C-terminal domain related protein, YPPQ
           ortholog [imported] - Clostridium
           acetobutylicum>gb:AE007665_228878 Clostridium
           acetobutylicum ATCC 824 section 153 of 356 of the
           complete genome.>gb:AE001437_1091833 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 146

 Score =  115 bits (288), Expect = 1e-24
 Identities = 62/131 (47%), Positives = 79/131 (60%), Gaps = 2/131 (1%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           ++  K+LT  Q+ +T+   TE  F  EYWD K+ G Y  +    PLF S  KFDSG GWP
Sbjct: 4   DDLSKKLTPLQYEVTQNNATEPPFNNEYWDNKSEGIYVDIISGKPLFTSLDKFDSGCGWP 63

Query: 344 SYYKP-VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALK 171
           S+ KP V  N+K+  D S   M R E+     D+HLGHVFDDGP +  G RYCINSA+LK
Sbjct: 64  SFTKPIVKENIKANTDFS-YNMKRIEIRSKDSDSHLGHVFDDGPKDKGGLRYCINSASLK 122

Query: 170 LKPK*EVSKGG 138
             PK  + + G
Sbjct: 123 FIPKEALEEEG 133



>gb:AF053709_473680 Helicobacter pylori peptide methionine sulfoxide
           reductase (msrA) gene, complete cds.
          Length = 359

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/141 (43%), Positives = 84/141 (59%), Gaps = 1/141 (0%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           V +  ++  SDE  KK+LT  Q+ +T+ K TE+ F  EY++ +  G Y  +    PLF S
Sbjct: 196 VDSDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSS 255

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGK 201
           + K+DSG GWPS+ KP+  +V    D   +   R EVL     AHLGHVF+DGP E  G 
Sbjct: 256 ADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGL 315

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYCINSAAL+  P  ++ K G
Sbjct: 316 RYCINSAALRFIPLKDMEKEG 336



>sp|O25011|MSAB_HELPY Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].>pir|H64547|H64547
           peptide methionine sulfoxide reductase - Helicobacter
           pylori (strain 26695)>gb:AE000542_24401 Helicobacter
           pylori 26695 section 20 of 134 of the complete
           genome.>gb:AE000511_879840 Helicobacter pylori 26695
           complete genome.
          Length = 359

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/141 (43%), Positives = 84/141 (59%), Gaps = 1/141 (0%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           V +  ++  SDE  KK+LT  Q+ +T+ K TE+ F  EY++ +  G Y  +    PLF S
Sbjct: 196 VDDDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSS 255

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGK 201
           + K+DSG GWPS+ KP+  +V    D   +   R EVL     AHLGHVF+DGP E  G 
Sbjct: 256 ADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGL 315

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYCINSAAL+  P  ++ K G
Sbjct: 316 RYCINSAALRFIPLKDMEKEG 336



>sp|Q9ZMK8|MSAB_HELPJ Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].>pir|E71960|E71960
           probable peptide methionine sulfoxide reductase -
           Helicobacter pylori (strain J99)>gb:AE001459_35204
           Helicobacter pylori, strain J99 section 20 of 132 of the
           complete genome.>gb:AE001439_883974 Helicobacter pylori,
           strain J99 complete genome.
          Length = 359

 Score =  115 bits (287), Expect = 1e-24
 Identities = 62/141 (43%), Positives = 84/141 (59%), Gaps = 1/141 (0%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           V +  ++  SDE  KK+LT  Q+ +T+ K TE+ F  EY++ +  G Y  +    PLF S
Sbjct: 196 VDDDKYTKPSDEVLKKKLTKLQYEVTQNKHTEKPFENEYYNKEEEGIYVDITTGEPLFSS 255

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGK 201
           + K+DSG GWPS+ KP+  +V    D   +   R EVL     AHLGHVF+DGP E  G 
Sbjct: 256 ADKYDSGCGWPSFSKPINKDVVKYEDDESLNRKRIEVLSRIGKAHLGHVFNDGPKELGGL 315

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYCINSAAL+  P  ++ K G
Sbjct: 316 RYCINSAALRFIPLKDMEKEG 336



>pir|A97944|A97944 peptide methionine sulfoxide reductase homolog
           [imported] - Streptococcus pneumoniae (strain
           R6)>gb:AE008436_236898 Streptococcus pneumoniae R6
           section 52 of 184 of the complete
           genome.>gb:AE007317_943056 Streptococcus pneumoniae R6,
           complete genome.
          Length = 370

 Score =  114 bits (286), Expect = 2e-24
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 1/144 (0%)
 Frame = -1

Query: 566 YAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPL 387
           Y  +    +   SDEE KK L+ +++ +T++  TERAF+  YWD    G Y  +    PL
Sbjct: 218 YPVIDASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPL 277

Query: 386 FESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT 207
           F S  KF+SG GWPS+ +P+  +V +  +     M R EV     D+HLGHVF DGP+  
Sbjct: 278 FSSKDKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDK 337

Query: 206 -GKRYCINSAALKLKPK*EVSKGG 138
            G RYCINS +++  PK ++ + G
Sbjct: 338 GGLRYCINSLSIRFIPKDQMEEKG 361



>sp|Q97RX3|MAB2_STRPN Peptide methionine sulfoxide reductase
           msrA/msrB 2 (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].>pir|D95076|D95076
           peptide methionine sulfoxide reductase [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007375_225866 Streptococcus pneumoniae TIGR4
           section 58 of 194 of the complete
           genome.>gb:AE005672_1103634 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 311

 Score =  114 bits (286), Expect = 2e-24
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 1/144 (0%)
 Frame = -1

Query: 566 YAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPL 387
           Y  +    +   SDEE KK L+ +++ +T++  TERAF+  YWD    G Y  +    PL
Sbjct: 159 YPVIDASKYPKPSDEELKKTLSPEEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPL 218

Query: 386 FESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT 207
           F S  KF+SG GWPS+ +P+  +V +  +     M R EV     D+HLGHVF DGP+  
Sbjct: 219 FSSKDKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSRVGDSHLGHVFTDGPQDK 278

Query: 206 -GKRYCINSAALKLKPK*EVSKGG 138
            G RYCINS +++  PK ++ + G
Sbjct: 279 GGLRYCINSLSIRFIPKDQMEEKG 302



>gb:AE013598_294391 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 154

 Score =  114 bits (284), Expect = 3e-24
 Identities = 52/111 (46%), Positives = 70/111 (63%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           L+ ++  +  Q GTE  F G + D K  G Y C  C  PLF SS KF+SGTGWPS++ P 
Sbjct: 21  LSDEEQRVLLQHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPY 80

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
                 ++  +   M R E++CA CD+HLGHVF DGP PTG+R+C+NS +L
Sbjct: 81  DPAHVREIRDTSYGMIRTEIVCARCDSHLGHVFPDGPPPTGERHCLNSVSL 131



>gb:CR376602_93286 plasmid pFBAOT6 from Aeromonas punctata
           (Aeromonas caviae) HGB5, complete sequence.
          Length = 151

 Score =  114 bits (284), Expect = 3e-24
 Identities = 62/125 (49%), Positives = 78/125 (62%), Gaps = 1/125 (0%)
 Frame = -1

Query: 509 RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP 330
           RLT +Q  IT+  GTER FTGE+ D K PG Y  +    PLF S+ KFDSGTGWPS+ KP
Sbjct: 16  RLTPEQRRITQDSGTERPFTGEHNDNKEPGIYVDIVSGEPLFASTDKFDSGTGWPSFTKP 75

Query: 329 VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK*E 153
           +     +++  S   M R EV     D+HLGHVF DGP +  G RYCINSA+L+  P+ E
Sbjct: 76  IVPANVNEVRDSAHGMVRTEVRSVHADSHLGHVFPDGPSDRGGLRYCINSASLRFIPRDE 135

Query: 152 VSKGG 138
           +   G
Sbjct: 136 MESEG 140



>gb:AE017342_1755162 Cryptococcus neoformans var. neoformans JEC21
           chromosome 2, complete sequence.
          Length = 134

 Score =  113 bits (282), Expect = 5e-24
 Identities = 54/124 (43%), Positives = 73/124 (58%), Gaps = 2/124 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD+EW+  L+ +QF + RQKGTER  +  Y  +   G YHC  CD PL+ S+TKF SG G
Sbjct: 10  SDDEWRAILSPEQFRVLRQKGTERPGSHPYDHSNDKGVYHCAGCDAPLYTSNTKFQSGCG 69

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAA 177
           WP++Y  +   V    D +   M R E+ CA C  HLGHVF  +  P P  +R+C+N  +
Sbjct: 70  WPAFYDTIPGAVNRHEDRN-FGMTRTEITCANCGGHLGHVFKGEGFPNPVDERHCVNGIS 128

Query: 176 LKLK 165
           L  K
Sbjct: 129 LNFK 132



>pir|G85060|G85060 hypothetical protein AT4g04830 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV13_1544327 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           13.>gb:AY059946_1564790 Arabidopsis thaliana Unknown
           protein mRNA, complete cds.>gb:AY081609_1568869
           Arabidopsis thaliana unknown protein mRNA, complete
           cds.>gb:AY088697_1573712 Arabidopsis thaliana clone 9218
           mRNA, complete sequence.>gb:T4B21_1724079 Arabidopsis
           thaliana BAC T4B21.
          Length = 139

 Score =  113 bits (282), Expect = 5e-24
 Identities = 55/125 (44%), Positives = 78/125 (62%), Gaps = 2/125 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++EEW+  L+ +QF I RQKGTE+  TGEY      G + CV C TPL++S+TKFDSG G
Sbjct: 11  TEEEWRAVLSPEQFRILRQKGTEKPGTGEYDKFFEEGIFDCVGCKTPLYKSTTKFDSGCG 70

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAA 177
           WP++++ +   +    D       R E+ CAACD HLGHVF  +    PT +R+C+NS +
Sbjct: 71  WPAFFEGLPGAINRTPDPD---GRRTEITCAACDGHLGHVFKGEGYGNPTDERHCVNSVS 127

Query: 176 LKLKP 162
           +   P
Sbjct: 128 ISFNP 132



>gb:AE016819_1749544 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 146

 Score =  112 bits (281), Expect = 7e-24
 Identities = 53/130 (40%), Positives = 75/130 (57%), Gaps = 6/130 (4%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           S+   +W  +L+ +Q  + R +GTER  TG Y   K+ G YHC  CD PL+ SS KFDSG
Sbjct: 13  SMCASKWNPQLSAEQLRVLRDRGTERPHTGTYLYNKSTGIYHCANCDVPLYSSSAKFDSG 72

Query: 356 TGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDG------PEPTGKRY 195
            GWP++Y+ V       +  S + M R E+ C+ACD HLGHVF+          P   R+
Sbjct: 73  CGWPAFYQEVRPGALRYIRDSSLGMERVEIRCSACDGHLGHVFEGEGFAQRLGLPKDVRH 132

Query: 194 CINSAALKLK 165
           C+NS +L+ +
Sbjct: 133 CVNSCSLRFR 142



>gb:CP000009_862355 Gluconobacter oxydans 621H, complete genome.
          Length = 138

 Score =  112 bits (281), Expect = 7e-24
 Identities = 56/115 (48%), Positives = 70/115 (60%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           LT +Q  I  + GTER  +    D K  G Y C  C  PLF S TK+DSG+GWPS+++ +
Sbjct: 19  LTPEQRRILHEHGTERPGSSPLNDEKRAGIYACAACGRPLFASETKYDSGSGWPSFFQAL 78

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKP 162
            + V++  D S   M R EV CA C  HLGHVF DGP PTG RYC+N  AL  +P
Sbjct: 79  PDGVETTQD-SRYGMVRTEVHCANCKGHLGHVFPDGPPPTGLRYCMNGLALDFRP 132



>gb:AE017354_460463 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 173

 Score =  112 bits (280), Expect = 9e-24
 Identities = 62/157 (39%), Positives = 88/157 (56%), Gaps = 6/157 (3%)
 Frame = -1

Query: 590 VYDSLHFFYAEVSN------KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTK 429
           +   L FF+  V++      + +   SD   K++L+  Q+ +T+Q+GTE  F   YW+ +
Sbjct: 4   IIKGLLFFFMSVASLTAYAEQAYKRPSDAVIKQKLSTIQYNVTQQQGTESPFNNAYWNNE 63

Query: 428 TPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACD 249
             G Y  V    PLF S  K+DS TGWPS+ KP+        D S +F  R EV+     
Sbjct: 64  EQGIYVDVVTGEPLFISLDKYDSKTGWPSFTKPLEPGNIIYKDDSSMFTSRTEVISKHGK 123

Query: 248 AHLGHVFDDGPEPTGKRYCINSAALKLKPK*EVSKGG 138
           +HLGHVF DGP PT KR+C+NSAAL+  P  ++ K G
Sbjct: 124 SHLGHVFGDGPPPTNKRFCMNSAALEFIPVKDLQKRG 160



>pir|JC7624|JC7624 hypothetical 14.2K protein - yeast (Pichia
           pastoris)>gb:PPA302014_1701200 Pichia pastoris pdi gene
           for protein disulphide isomerase, ORF1 (partial) and
           ORF2 DNA for hypothetical proteins.
          Length = 127

 Score =  112 bits (280), Expect = 9e-24
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 2/120 (1%)
 Frame = -1

Query: 518 WKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSY 339
           WK  LT  Q+ + R  GTER +TG+Y + K  GTY C  C TPL++S TKFDS  GWP++
Sbjct: 4   WKAILTPAQYQVLRLGGTERPYTGQYVNFKKNGTYLCSGCQTPLYKSGTKFDSSCGWPAF 63

Query: 338 YKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDG--PEPTGKRYCINSAALKLK 165
           Y+ +   VK +++ + + M R E+ C+ CD HLGHVF+      PT  R+C+NS +LK +
Sbjct: 64  YEALPGAVK-RIEDNSLGMRRIEIRCSKCDGHLGHVFEGEGFDTPTDSRHCVNSISLKFQ 122



>gb:AY085655_1570723 Arabidopsis thaliana clone 16643 mRNA, complete
           sequence.
          Length = 202

 Score =  112 bits (279), Expect = 1e-23
 Identities = 57/125 (45%), Positives = 76/125 (60%), Gaps = 2/125 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +EEW+  L+ +QF I RQKGTE   TGEY      G Y C  C TPL++S+TKFDSG GW
Sbjct: 77  EEEWRTILSPEQFRILRQKGTEYPGTGEYNKVFDDGIYCCAGCGTPLYKSTTKFDSGCGW 136

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P+++  +   +    D       R E+ CAAC  HLGHVF  +  P PT +R+C+NS +L
Sbjct: 137 PAFFDGLPGAITRTPDPD---GRRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISL 193

Query: 173 KLKPK 159
           K  P+
Sbjct: 194 KFTPE 198



>gb:AY051078_1562550 Arabidopsis thaliana unknown protein
           (At4g21860) mRNA, complete cds.>gb:AF360341_1791287
           Arabidopsis thaliana unknown protein (At4g21860) mRNA,
           complete cds.
          Length = 202

 Score =  112 bits (279), Expect = 1e-23
 Identities = 57/125 (45%), Positives = 76/125 (60%), Gaps = 2/125 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           +EEW+  L+ +QF I RQKGTE   TGEY      G Y C  C TPL++S+TKFDSG GW
Sbjct: 77  EEEWRAILSPEQFRILRQKGTEYPGTGEYNKVFDDGIYCCAGCGTPLYKSTTKFDSGCGW 136

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P+++  +   +    D       R E+ CAAC  HLGHVF  +  P PT +R+C+NS +L
Sbjct: 137 PAFFDGLPGAITRTPDPD---GRRIEITCAACGGHLGHVFKGEGFPTPTDERHCVNSISL 193

Query: 173 KLKPK 159
           K  P+
Sbjct: 194 KFTPE 198



>gb:AE012019_278605 Xanthomonas axonopodis pv. citri str. 306,
           section 397 of 469 of the complete
           genome.>gb:AE008923_920380 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 154

 Score =  112 bits (279), Expect = 1e-23
 Identities = 51/111 (45%), Positives = 69/111 (62%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           L+ ++  +    GTE  F G + D K  G Y C  C  PLF SS KF+SGTGWPS++ P 
Sbjct: 21  LSDEEQRVLLHHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSSAKFESGTGWPSFFAPY 80

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
                 ++  +   M R E++CA CD+HLGHVF DGP PTG+R+C+NS +L
Sbjct: 81  DPAHVREIRDTSYGMIRTEIVCARCDSHLGHVFPDGPPPTGERHCLNSVSL 131



>sp|P34436|YL56_CAEEL Hypothetical 17.2 kDa protein F44E2.6 in
           chromosome III.>pir|S44820|S44820 F44E2.6 protein -
           Caenorhabditis elegans>gb:L23646_1386998 Caenorhabditis
           elegans cosmid F44E2, complete sequence.
          Length = 152

 Score =  112 bits (279), Expect = 1e-23
 Identities = 59/133 (44%), Positives = 77/133 (57%), Gaps = 3/133 (2%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K+   V   EWK  L  + + + R+ GTE   TG + D    G Y C+CC + LF S  K
Sbjct: 20  KNPKDVKQTEWKSVLPNEVYRVARESGTETPHTGGFNDHFEKGRYVCLCCGSELFNSDAK 79

Query: 368 FDSGTGWPSYYKPVGN--NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKR 198
           F +G GWP++ + VG   N+   +D S   M R EV C  CDAHLGHVF+DGP E TG+R
Sbjct: 80  FWAGCGWPAFSESVGQDANIVRIVDRS-HGMHRTEVRCKTCDAHLGHVFNDGPKETTGER 138

Query: 197 YCINSAALKLKPK 159
           YCINS  +  + K
Sbjct: 139 YCINSVCMAFEKK 151



>gb:AE016936_361867 Bacteroides thetaiotaomicron VPI-5482, section
           11 of 21 of the complete genome.>gb:AE015928_988355
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 342

 Score =  111 bits (278), Expect = 1e-23
 Identities = 57/136 (41%), Positives = 81/136 (59%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           F    D   +K+L+ +Q+ +T++  TE AF  E+W+   PG Y  +    PLF S+ KFD
Sbjct: 198 FQKPDDATLRKKLSAEQYAVTQKNATEPAFHNEFWNEHRPGIYVDITTGEPLFVSTDKFD 257

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCIN 186
           SG GWPS+ KP+   + ++   +   M R EV     DAHLGHVF DGP +  G RYCIN
Sbjct: 258 SGCGWPSFSKPIQKELIAEKKDTTHGMIRTEVRSKTGDAHLGHVFTDGPKDKGGLRYCIN 317

Query: 185 SAALKLKPK*EVSKGG 138
           SA+L+  PK ++ + G
Sbjct: 318 SASLRFIPKEKMKEEG 333



>gb:AE012486_282877 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 394 of 460 of the complete
           genome.>gb:AE008922_916159 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 154

 Score =  111 bits (278), Expect = 1e-23
 Identities = 51/111 (45%), Positives = 69/111 (62%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           L+ ++  +    GTE  F G + D K  G Y C  C  PLF S+ KFDSGTGWPS++ P 
Sbjct: 21  LSDEEQRVLLHHGTEAPFCGVFLDNKLDGVYTCRLCGLPLFRSNAKFDSGTGWPSFFAPY 80

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAAL 174
                 ++  +   M R E++CA CD+HLGHVF DGP PTG+R+C+NS +L
Sbjct: 81  DPAHVREIRDTGYGMIRTEIVCARCDSHLGHVFPDGPPPTGERHCLNSVSL 131



>gb:AY224463_1590665 Oryza sativa (japonica cultivar-group) isolate
           23523 unknown mRNA.
          Length = 168

 Score =  111 bits (277), Expect = 2e-23
 Identities = 56/125 (44%), Positives = 76/125 (60%), Gaps = 2/125 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SDEEW+  L+ +QF I R KGTE   TGEY      G Y+C  C TPL++S+TKFDSG G
Sbjct: 45  SDEEWRAVLSPEQFRILRLKGTELPGTGEYNKFYGDGVYNCAGCGTPLYKSTTKFDSGCG 104

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAA 177
           WP++++ +   +    D       R E+ CAAC  HLGHVF  +    PT +R+C+NS +
Sbjct: 105 WPAFFEGLPGAINRTPDPD---GRRVEITCAACGGHLGHVFKGEGFKTPTDERHCVNSVS 161

Query: 176 LKLKP 162
           +K  P
Sbjct: 162 IKFTP 166



>gb:AC120991_1740107 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0006J12, complete sequence.
          Length = 229

 Score =  110 bits (275), Expect = 3e-23
 Identities = 60/131 (45%), Positives = 77/131 (58%), Gaps = 2/131 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+EEW+  L+ +QF I R KGTE   TGEY      G Y C  C TPL++SSTKF+SG G
Sbjct: 101 SEEEWEAILSPEQFRILRLKGTEYPGTGEYDKLFAEGVYECAGCGTPLYKSSTKFNSGCG 160

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAA 177
           WP++Y+     +    D       R E+ CAAC  HLGHVF  +    PT +R+C+NS +
Sbjct: 161 WPAFYEGFPGAIARTPDPD---GRRIEITCAACGGHLGHVFKGEGFNTPTDERHCVNSIS 217

Query: 176 LKLKPK*EVSK 144
           LK  P  E SK
Sbjct: 218 LKFIPASEDSK 228



>gb:AE010590_264700 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 132 of 197 of the complete
           genome.>gb:AE009951_911868 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 473

 Score =  110 bits (275), Expect = 3e-23
 Identities = 59/143 (41%), Positives = 84/143 (58%), Gaps = 1/143 (0%)
 Frame = -1

Query: 563 AEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLF 384
           A +  K +   SDE  K++L+  ++ IT++  TERAFT EY+  +  G Y  +    PLF
Sbjct: 322 AIIDEKKYQKPSDEVLKEKLSTLEYQITQEAATERAFTHEYYKNQEDGIYVDITTGEPLF 381

Query: 383 ESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPT 207
            S  K+D+G GWPS+ KP+   V +    S   M R EV   A +AHLGHVF+DGP +  
Sbjct: 382 SSKDKYDAGCGWPSFTKPIATEVVNYKKDSSHGMNRVEVRSRAGEAHLGHVFEDGPRDRG 441

Query: 206 GKRYCINSAALKLKPK*EVSKGG 138
           G RYCIN A+L+  P  ++ + G
Sbjct: 442 GLRYCINGASLRFIPYDKMDEEG 464



>gb:T4B21_1724077 Arabidopsis thaliana BAC T4B21.
          Length = 281

 Score =  109 bits (273), Expect = 6e-23
 Identities = 54/124 (43%), Positives = 76/124 (61%), Gaps = 2/124 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DEEW+  L+ +QF I RQKGTE   TGEY +    G Y CV C+ PL++S+TKF++G GW
Sbjct: 11  DEEWRAILSPEQFRILRQKGTEYPGTGEYVNFDKEGVYGCVGCNAPLYKSTTKFNAGCGW 70

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P++++ +   +    D       R E+ CA C  HLGHVF  +    PT +R+C+NS +L
Sbjct: 71  PAFFEGIPGAITRTTDPD---GRRIEINCATCGGHLGHVFKGEGFATPTDERHCVNSVSL 127

Query: 173 KLKP 162
           K  P
Sbjct: 128 KFTP 131



 Score =  104 bits (260), Expect = 2e-21
 Identities = 55/142 (38%), Positives = 80/142 (56%), Gaps = 5/142 (3%)
 Frame = -1

Query: 572 FFYAEVSNKDFSSV---SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVC 402
           FF+  V   D  +V   ++EEW+  L+ +QF I RQKGTE   T EY      G + C+ 
Sbjct: 136 FFFVVVVMADLVTVVKKTEEEWRAVLSPEQFRILRQKGTETPGTEEYDKFFEEGIFSCIG 195

Query: 401 CDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF-- 228
           C TPL++S+TKFD+G GWP++++ +   +    D       R E+ CA CD HLGHV   
Sbjct: 196 CKTPLYKSTTKFDAGCGWPAFFEGLPGAINRAPDPD---GRRTEITCAVCDGHLGHVHKG 252

Query: 227 DDGPEPTGKRYCINSAALKLKP 162
           +    PT +R C+NS ++   P
Sbjct: 253 EGYSTPTDERLCVNSVSINFNP 274



>pir|D85060|D85060 hypothetical protein AT4g04800 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV13_1544324 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           13.>gb:AY070756_1566904 Arabidopsis thaliana
           AT4g04800/T4B21_6 mRNA, complete
           cds.>gb:AY087929_1572954 Arabidopsis thaliana clone
           39698 mRNA, complete sequence.>gb:AY097373_1576368
           Arabidopsis thaliana AT4g04800/T4B21_6 mRNA, complete
           cds.
          Length = 136

 Score =  109 bits (273), Expect = 6e-23
 Identities = 54/124 (43%), Positives = 76/124 (61%), Gaps = 2/124 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DEEW+  L+ +QF I RQKGTE   TGEY +    G Y CV C+ PL++S+TKF++G GW
Sbjct: 11  DEEWRAILSPEQFRILRQKGTEYPGTGEYVNFDKEGVYGCVGCNAPLYKSTTKFNAGCGW 70

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P++++ +   +    D       R E+ CA C  HLGHVF  +    PT +R+C+NS +L
Sbjct: 71  PAFFEGIPGAITRTTDPD---GRRIEINCATCGGHLGHVFKGEGFATPTDERHCVNSVSL 127

Query: 173 KLKP 162
           K  P
Sbjct: 128 KFTP 131



>sp|Q9A6B1|MSRB_CAUCR Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|F87519|F87519 PilB-related protein
           [imported] - Caulobacter crescentus>gb:AE005890_213317
           Caulobacter crescentus CB15 section 216 of 359 of the
           complete genome.>gb:AE005673_923216 Caulobacter
           crescentus CB15 complete genome.
          Length = 159

 Score =  109 bits (272), Expect = 7e-23
 Identities = 53/118 (44%), Positives = 67/118 (56%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           E  +  LT ++  +    GTE  F G     K+PG Y C  C  PLF+  TKF+SGTGWP
Sbjct: 23  ERLEANLTAEEARVLLHHGTEAPFCGGLLGEKSPGVYGCRLCGLPLFKHETKFESGTGWP 82

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           S+Y P   +    +  +   M R E  CA CD+H GHVF DGP PT  RYCINS +L+
Sbjct: 83  SFYAPFAEDHVVGVRDTSYGMVRIETRCARCDSHQGHVFPDGPAPTRLRYCINSVSLQ 140



>gb:BT004230_1637323 Arabidopsis thaliana clone RAFL16-01-H09
           (R50013) unknown protein (At4g21850) mRNA, complete
           cds.>gb:BT005691_1638631 Arabidopsis thaliana clone
           U50013 unknown protein (At4g21850) mRNA, complete cds.
          Length = 143

 Score =  108 bits (271), Expect = 1e-22
 Identities = 52/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           D++W+  L+ +QF + R+KGTE    GEY      G Y C  C TPL++S+TKFDSG GW
Sbjct: 19  DQDWRAILSPEQFRVLREKGTENRGKGEYTKLFDDGIYSCAGCATPLYKSTTKFDSGCGW 78

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           PS++  +   +K   +       R E+ CAACD HLGHV   +  P  T +R+C+NS +L
Sbjct: 79  PSFFDAIPGAIKQTPEAG---GRRMEITCAACDGHLGHVVKGEGFPTATDERHCVNSVSL 135

Query: 173 K 171
           K
Sbjct: 136 K 136



>gb:AY086368_1571417 Arabidopsis thaliana clone 24573 mRNA, complete
           sequence.
          Length = 143

 Score =  108 bits (271), Expect = 1e-22
 Identities = 52/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           D++W+  L+ +QF + R+KGTE    GEY      G Y C  C TPL++S+TKFDSG GW
Sbjct: 19  DQDWRAILSPEQFRVLREKGTENRGKGEYTKLFDDGIYSCAGCATPLYKSTTKFDSGCGW 78

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           PS++  +   +K   +       R E+ CAACD HLGHV   +  P  T +R+C+NS +L
Sbjct: 79  PSFFDAIPGAIKQTPEAG---GRRMEITCAACDGHLGHVVKGEGFPTATDERHCVNSVSL 135

Query: 173 K 171
           K
Sbjct: 136 K 136



>gb:AE010532_264095 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 74 of 197 of the complete
           genome.>gb:AE009951_911263 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 298

 Score =  108 bits (271), Expect = 1e-22
 Identities = 58/141 (41%), Positives = 82/141 (58%), Gaps = 1/141 (0%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           V  K +  +S++E + +L  +Q+ +T+   TERAF  +YWD    G Y  +    PLF S
Sbjct: 149 VDEKKYPKLSEKELRMKLNSKQYEVTQNGDTERAFQNDYWDFFDKGIYVDITTGEPLFSS 208

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGK 201
           + K+ S  GWPS+ KP+   V +  + +   M R EV   +  AHLGHVFDDGP +  GK
Sbjct: 209 TDKYASQCGWPSFVKPIVPEVVTYHNDTSFNMIRTEVRSRSGKAHLGHVFDDGPRDRGGK 268

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYCINSAA++  P  E+   G
Sbjct: 269 RYCINSAAIQFIPYAEMEAKG 289



>sp|Q9XB39|MSRB_ENTFA Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE016956_367099 Enterococcus faecalis
           V583, section 10 of 11 of the complete
           genome.>gb:AE016830_993587 Enterococcus faecalis V583,
           complete genome.
          Length = 145

 Score =  108 bits (271), Expect = 1e-22
 Identities = 61/133 (45%), Positives = 80/133 (60%), Gaps = 2/133 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++EE K+ LT  Q+ +T++  TER F+GEY D    G Y  +    PLF S  K+D+G G
Sbjct: 5   TEEELKQTLTDLQYAVTQENATERPFSGEYDDFYQDGIYVDIVSGEPLFSSLDKYDAGCG 64

Query: 350 WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAA 177
           WPS+ KP+    VK K D S   M R EV     D+HLGHVF DGP +  G RYCIN+AA
Sbjct: 65  WPSFTKPIEKRGVKEKADFS-HGMHRVEVRSQEADSHLGHVFTDGPLQEGGLRYCINAAA 123

Query: 176 LKLKPK*EVSKGG 138
           L+  P  ++ K G
Sbjct: 124 LRFVPVADLEKEG 136



>gb:AE004969_61695 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 522

 Score =  108 bits (270), Expect = 1e-22
 Identities = 58/136 (42%), Positives = 77/136 (56%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   SD E K+ LT +Q+ +T+   TE AF+ EY     PG Y  V    PLF S+ K+D
Sbjct: 378 YKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYD 437

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK-RYCIN 186
           SG GWPS+ +P+     ++ D     M R EV   A D+HLGHVF DGP   G+ RYCIN
Sbjct: 438 SGCGWPSFTRPIDAKSVTEHDDFSFNMRRTEVRSRAADSHLGHVFPDGPRDKGRLRYCIN 497

Query: 185 SAALKLKPK*EVSKGG 138
            A+LK  P  ++   G
Sbjct: 498 GASLKFIPLEQMDAAG 513



>gb:AP006878_575971 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 338

 Score =  108 bits (269), Expect = 2e-22
 Identities = 59/138 (42%), Positives = 78/138 (56%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           SD E K++LT  Q+ +T+   TE  F  EYW+    G Y  V    PLF    K+DSGTG
Sbjct: 200 SDAELKRQLTPLQYRVTQLGDTEEPFHNEYWNNHEEGIYVDVVSGEPLFSLLDKYDSGTG 259

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALK 171
           WPS+ KP+      +      F+  +EV      +HLGHVFD+ P PTGKRYCINSAAL+
Sbjct: 260 WPSFTKPLEEWAVVEAGECEGFLCGREVRSRFAGSHLGHVFDE-PTPTGKRYCINSAALR 318

Query: 170 LKPK*EVSKGGQEGCESV 117
             P+ E+ + G    E +
Sbjct: 319 FIPRDELRRYGYTAYEGI 336



>gb:CR382123_1655518 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 199

 Score =  107 bits (267), Expect = 3e-22
 Identities = 53/128 (41%), Positives = 74/128 (57%), Gaps = 6/128 (4%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S  +W   LT +Q  + R KGTER  TG Y   K  G Y C  CD P+++S TKFDSG G
Sbjct: 71  STGKWNPSLTSEQLRVLRDKGTERPNTGNYLHNKQTGIYSCANCDLPIYKSETKFDSGCG 130

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFD-DGPE-----PTGKRYCI 189
           WP++Y  +  ++    D S   M R E+ C+ C  H+GHVF+ +G +     PT +R+C+
Sbjct: 131 WPAFYDAIPGSLTFTRDES-FGMVRIEICCSRCGGHMGHVFEGEGWQKILNLPTDQRHCV 189

Query: 188 NSAALKLK 165
           NS +L  K
Sbjct: 190 NSCSLNFK 197



>gb:AY085310_1570382 Arabidopsis thaliana clone 14462 mRNA, complete
           sequence.
          Length = 141

 Score =  107 bits (267), Expect = 3e-22
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DEEW+  L+ +QF + R KGT++   GE+      GTY C  C T L++S+TKFDSG GW
Sbjct: 16  DEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGW 75

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P+++  +   +K   +       R E+ CA CD HLGHVF  +    PT +R+C+NS +L
Sbjct: 76  PAFFDAIPGAIKQTPEAG---GRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSL 132

Query: 173 K 171
           K
Sbjct: 133 K 133



>gb:AY072355_1567172 Arabidopsis thaliana putative protein
           (At4g21840) mRNA, complete cds.>gb:BT000415_1634693
           Arabidopsis thaliana putative protein (At4g21840) mRNA,
           complete cds.
          Length = 144

 Score =  107 bits (267), Expect = 3e-22
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DEEW+  L+ +QF + R KGT++   GE+      GTY C  C T L++S+TKFDSG GW
Sbjct: 19  DEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGW 78

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P+++  +   +K   +       R E+ CA CD HLGHVF  +    PT +R+C+NS +L
Sbjct: 79  PAFFDAIPGAIKQTPEAG---GRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSL 135

Query: 173 K 171
           K
Sbjct: 136 K 136



>gb:BA000028_696121 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 319

 Score =  107 bits (267), Expect = 3e-22
 Identities = 55/142 (38%), Positives = 85/142 (59%), Gaps = 2/142 (1%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           + N   +++   E K++LT  Q+++T++ GTER F  EYW+    G Y  +     LF S
Sbjct: 170 IKNNWQNTIDKNELKEKLTPIQYHVTQENGTERPFDNEYWNNTQEGIYVDIIKGNVLFSS 229

Query: 377 STKFDSGTGWPSYYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-G 204
             ++D+G GWPS+ KPV    ++ K+D     M R E+     D+HLGHVF+DGP+   G
Sbjct: 230 KEQYDAGCGWPSFTKPVDPYQIEDKVD-KTHGMVRTEIRSKQSDSHLGHVFEDGPQDKGG 288

Query: 203 KRYCINSAALKLKPK*EVSKGG 138
            RYC+NSAA++  PK ++ + G
Sbjct: 289 LRYCMNSAAMRFIPKEKMEEEG 310



>gb:AE017248_415759 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069355 Treponema
           denticola ATCC 35405, complete genome.
          Length = 317

 Score =  107 bits (267), Expect = 3e-22
 Identities = 60/136 (44%), Positives = 75/136 (55%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           F   S EE KK L   QF +T++K TER FT EY      G Y  +    PLF S  K+D
Sbjct: 168 FKVPSKEELKKSLKPIQFSVTQEKATERPFTSEYDKFDAEGIYVDITTGKPLFSSLNKYD 227

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCIN 186
           +G GWPS+ K +       L+   + M R EV+     AHLGHVFDDGP +  G RYCIN
Sbjct: 228 AGCGWPSFTKAITTQALQYLEDKSLGMNRTEVVSKTGGAHLGHVFDDGPADAGGLRYCIN 287

Query: 185 SAALKLKPK*EVSKGG 138
            AAL+  P  ++ K G
Sbjct: 288 GAALRFIPYDKMEKEG 303



>gb:EFA243482_135107 Enterococcus faecalis csrA gene.
          Length = 168

 Score =  107 bits (267), Expect = 3e-22
 Identities = 60/131 (45%), Positives = 79/131 (60%), Gaps = 2/131 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++EE K+ LT  Q+ +T++  TER F+GEY D    G Y  +    PLF S  K+D+G G
Sbjct: 5   TEEELKQTLTDLQYAVTQENATERPFSGEYDDFYQDGIYVDIVSGEPLFSSLDKYDAGCG 64

Query: 350 WPSYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAA 177
           WPS+ KP+    VK K D S   M R EV     D+HLGHVF DGP +  G RYCIN+AA
Sbjct: 65  WPSFTKPIEKRGVKEKADFS-HGMHRVEVRSQEADSHLGHVFTDGPLQEGGLRYCINAAA 123

Query: 176 LKLKPK*EVSK 144
           L+  P  ++ K
Sbjct: 124 LRFVPVADLEK 134



>pir|T05465|T05465 hypothetical protein T8O5.40 - Arabidopsis
           thaliana>gb:ATCHRIV56_1546020 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 56.>gb:ATT8O5_1556510
           Arabidopsis thaliana DNA chromosome 4, BAC clone T8O5
           (ESSAII project).>gb:AY085336_1570408 Arabidopsis
           thaliana clone 14645 mRNA, complete sequence.
          Length = 141

 Score =  107 bits (267), Expect = 3e-22
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DEEW+  L+ +QF + R KGT++   GE+      GTY C  C T L++S+TKFDSG GW
Sbjct: 16  DEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGW 75

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P+++  +   +K   +       R E+ CA CD HLGHVF  +    PT +R+C+NS +L
Sbjct: 76  PAFFDAIPGAIKQTPEAG---GRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSL 132

Query: 173 K 171
           K
Sbjct: 133 K 133



>pir|T05466|T05466 hypothetical protein T8O5.50 - Arabidopsis
           thaliana>gb:ATCHRIV56_1546021 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 56.>gb:ATT8O5_1556511
           Arabidopsis thaliana DNA chromosome 4, BAC clone T8O5
           (ESSAII project).
          Length = 143

 Score =  107 bits (267), Expect = 3e-22
 Identities = 51/121 (42%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           DEEW+  L+ +QF + R KGT++   GE+      GTY C  C T L++S+TKFDSG GW
Sbjct: 18  DEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGW 77

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAAL 174
           P+++  +   +K   +       R E+ CA CD HLGHVF  +    PT +R+C+NS +L
Sbjct: 78  PAFFDAIPGAIKQTPEAG---GRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSL 134

Query: 173 K 171
           K
Sbjct: 135 K 135



>sp|Q87AJ9|MSRB_XYLFT Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE012560_285206 Xylella fastidiosa
           Temecula1, section 8 of 9 of the complete
           genome.>gb:AE009442_961782 Xylella fastidiosa Temecula1,
           complete genome.
          Length = 155

 Score =  107 bits (267), Expect = 3e-22
 Identities = 52/115 (45%), Positives = 67/115 (58%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           L  ++  I  Q GTE  F     D    GTY C  C  PLF S+ KF SGTGWPS+++P 
Sbjct: 22  LNAEERRILLQHGTEAPFCNRLLDNNQLGTYTCRLCGLPLFHSNAKFKSGTGWPSFFEPY 81

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKP 162
            +    K   +   M R E+LCA C++HLGH+F DGP PT +RYC+NS +L   P
Sbjct: 82  THTHIRKQHDTSHGMIRTEILCARCNSHLGHLFPDGPPPTYERYCLNSVSLTFIP 136



>sp|Q9PF29|MSRB_XYLFA Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|D82755|D82755 conserved hypothetical
           protein XF0849 [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE003924_48488 Xylella fastidiosa 9a5c, section
           70 of 229 of the complete genome.>gb:AE003849_1115698
           Xylella fastidiosa 9a5c, complete genome.
          Length = 155

 Score =  107 bits (267), Expect = 3e-22
 Identities = 53/116 (45%), Positives = 71/116 (61%), Gaps = 1/116 (0%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           L  ++  I  Q GTE  F     D    GTY C  C  PLF S+ KF SGTGWPS+++P 
Sbjct: 22  LNAEEHRILLQHGTEAPFCNRLLDNNQLGTYTCRFCGLPLFHSNAKFKSGTGWPSFFEPY 81

Query: 326 GN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKP 162
            + +++ + D S   M R E+LCA C++HLGH+F DGP PT +RYC+NS +L   P
Sbjct: 82  THAHIRKQHDTS-HGMIRTEILCARCNSHLGHLFPDGPPPTYERYCLNSVSLTFIP 136



>sp|P14930|MSAB_NEIGO Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Thioredoxin; Peptide
           methionine sulfoxide reductase msrA
           (Protein-methionine-S-oxide reductase) (Peptide Met(O)
           reductase); Peptide methionine sulfoxide reductase
           msrB].>gb:AF482946_514629 Neisseria gonorrhoeae
           methionine sulfoxide reductase PilB (pilB) gene,
           complete cds.
          Length = 522

 Score =  107 bits (267), Expect = 3e-22
 Identities = 58/136 (42%), Positives = 77/136 (56%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   SD E K+ LT +Q+ +T+   TE AF+ EY     PG Y  V    PLF S+ K+D
Sbjct: 378 YKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYD 437

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCIN 186
           SG GWPS+ +P+     ++ D     M R EV   A D+HLGHVF DGP +  G RYCIN
Sbjct: 438 SGCGWPSFTRPIDAKSVTEHDDFSFNMRRTEVRSRAADSHLGHVFPDGPRDKGGLRYCIN 497

Query: 185 SAALKLKPK*EVSKGG 138
            A+LK  P  ++   G
Sbjct: 498 GASLKFIPLEQMDAAG 513



>sp|Q9JWM8|MSAB_NEIMA Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Thioredoxin; Peptide
           methionine sulfoxide reductase msrA
           (Protein-methionine-S-oxide reductase) (Peptide Met(O)
           reductase); Peptide methionine sulfoxide reductase
           msrB].>pir|E82024|E82024 peptide methionine sulfoxide
           reductase NMA0290 [imported] - Neisseria meningitidis
           (strain Z2491 serogroup A)>gb:NMA1Z2491_153246 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 1/7.
          Length = 522

 Score =  107 bits (266), Expect = 4e-22
 Identities = 59/142 (41%), Positives = 79/142 (55%), Gaps = 1/142 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   SD E K+ LT +Q+ +T+   TE AF+ EY     PG Y  V    PLF S+ K+D
Sbjct: 378 YKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYD 437

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCIN 186
           SG GWPS+ +P+     ++ D     M R EV   A D+HLGHVF DGP +  G RYCIN
Sbjct: 438 SGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYCIN 497

Query: 185 SAALKLKPK*EVSKGGQEGCES 120
            A+LK  P  ++   G    +S
Sbjct: 498 GASLKFIPLEQMDAAGYGALKS 519



>sp|Q9K1N8|MSAB_NEIMB Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Thioredoxin; Peptide
           methionine sulfoxide reductase msrA
           (Protein-methionine-S-oxide reductase) (Peptide Met(O)
           reductase); Peptide methionine sulfoxide reductase
           msrB].>pir|G81243|G81243 peptide methionine sulfoxide
           reductase NMB0044 [imported] - Neisseria meningitidis
           (strain MC58 serogroup B)>gb:AE002363_45538 Neisseria
           meningitidis serogroup B strain MC58 section 5 of 206 of
           the complete genome.>gb:AE002098_895651 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 522

 Score =  106 bits (265), Expect = 5e-22
 Identities = 58/136 (42%), Positives = 77/136 (56%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   SD E K+ LT +Q+ +T+   TE AF+ EY     PG Y  V    PLF S+ K+D
Sbjct: 378 YKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYD 437

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCIN 186
           SG GWPS+ +P+     ++ D     M R EV   A D+HLGHVF DGP +  G RYCIN
Sbjct: 438 SGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGHVFPDGPRDKGGLRYCIN 497

Query: 185 SAALKLKPK*EVSKGG 138
            A+LK  P  ++   G
Sbjct: 498 GASLKFIPLEQMDAAG 513



>gb:CP000003_861228 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 368

 Score =  105 bits (263), Expect = 8e-22
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 1/154 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +    +   S  E K++L+  ++ +T++  TE+AF+  YWD+   G 
Sbjct: 206 YCHIDINQATYPVIDESKYPKPSATEIKEKLSADEYRVTQKNETEKAFSNRYWDSFDAGI 265

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ +P+  +V    +     M R EV   + ++HLG
Sbjct: 266 YVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSGNSHLG 325

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           HVF DGP +  G RYCINS ++   PK ++   G
Sbjct: 326 HVFTDGPKDQGGLRYCINSLSITFIPKADMEAKG 359



>gb:AE010071_259022 Streptococcus pyogenes strain MGAS8232, section
           119 of 173 of the complete genome.>gb:AE009949_905404
           Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 368

 Score =  105 bits (263), Expect = 8e-22
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 1/154 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +    +   S  E K++L+  ++ +T++  TE+AF+  YWD+   G 
Sbjct: 206 YCHIDINQATYPVIDESKYPKPSATEIKEKLSADEYRVTQKNETEKAFSNRYWDSFDAGI 265

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ +P+  +V    +     M R EV   + ++HLG
Sbjct: 266 YVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSGNSHLG 325

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           HVF DGP +  G RYCINS ++   PK ++   G
Sbjct: 326 HVFTDGPKDQGGLRYCINSLSITFIPKADMEAKG 359



>gb:AE006588_220470 Streptococcus pyogenes M1 GAS, section 117 of
           167 of the complete genome.>gb:AE004092_1106316
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 368

 Score =  105 bits (263), Expect = 8e-22
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 1/154 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +    +   S  E K++L+  ++ +T++  TE+AF+  YWD+   G 
Sbjct: 206 YCHIDINQATYPVIDESKYPKPSATEIKEKLSADEYRVTQKNETEKAFSNRYWDSFDAGI 265

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ +P+  +V    +     M R EV   + ++HLG
Sbjct: 266 YVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSGNSHLG 325

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           HVF DGP +  G RYCINS ++   PK ++   G
Sbjct: 326 HVFTDGPKDQGGLRYCINSLSITFIPKADMEAKG 359



>sp|Q99YT1|MSAB_STRPY Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].
          Length = 309

 Score =  105 bits (263), Expect = 8e-22
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 1/154 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +    +   S  E K++L+  ++ +T++  TE+AF+  YWD+   G 
Sbjct: 147 YCHIDINQATYPVIDESKYPKPSATEIKEKLSADEYRVTQKNETEKAFSNRYWDSFDAGI 206

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ +P+  +V    +     M R EV   + ++HLG
Sbjct: 207 YVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSGNSHLG 266

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           HVF DGP +  G RYCINS ++   PK ++   G
Sbjct: 267 HVFTDGPKDQGGLRYCINSLSITFIPKADMEAKG 300



>sp|Q8P046|MSAB_STRP8 Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].
          Length = 309

 Score =  105 bits (263), Expect = 8e-22
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 1/154 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +    +   S  E K++L+  ++ +T++  TE+AF+  YWD+   G 
Sbjct: 147 YCHIDINQATYPVIDESKYPKPSATEIKEKLSADEYRVTQKNETEKAFSNRYWDSFDAGI 206

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ +P+  +V    +     M R EV   + ++HLG
Sbjct: 207 YVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSGNSHLG 266

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           HVF DGP +  G RYCINS ++   PK ++   G
Sbjct: 267 HVFTDGPKDQGGLRYCINSLSITFIPKADMEAKG 300



>gb:AE014160_304744 Streptococcus pyogenes MGAS315, section 25 of 37
           of the complete genome.>gb:BA000034_713520 Streptococcus
           pyogenes SSI-1 DNA, complete genome.>gb:AE014074_927923
           Streptococcus pyogenes MGAS315, complete
           genome.>gb:AY050245_1495879 Streptococcus pyogenes
           strain NIH1 putative methionine sulfoxide reductase
           gene, complete cds; and integrated temperate phage
           PhiNIH1.1, complete genome.
          Length = 368

 Score =  105 bits (261), Expect = 1e-21
 Identities = 55/154 (35%), Positives = 82/154 (53%), Gaps = 1/154 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +    +   S  E K +L+  ++ +T++  TE+AF+  YWD+   G 
Sbjct: 206 YCHIDINQATYPVIDESKYPKPSATEIKAKLSADEYRVTQKNETEKAFSNRYWDSFDAGI 265

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ +P+  +V    +     M R EV   + ++HLG
Sbjct: 266 YVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSGNSHLG 325

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           HVF DGP +  G RYCINS ++   PK ++   G
Sbjct: 326 HVFTDGPKDQGGLRYCINSLSITFIPKADMEAKG 359



>sp|Q938P0|MSAB_STRP3 Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].
          Length = 309

 Score =  105 bits (261), Expect = 1e-21
 Identities = 55/154 (35%), Positives = 82/154 (53%), Gaps = 1/154 (0%)
 Frame = -1

Query: 596 HCVYDSLHFFYAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGT 417
           +C  D     Y  +    +   S  E K +L+  ++ +T++  TE+AF+  YWD+   G 
Sbjct: 147 YCHIDINQATYPVIDESKYPKPSATEIKAKLSADEYRVTQKNETEKAFSNRYWDSFDAGI 206

Query: 416 YHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLG 237
           Y  V    PLF S  KF+SG GWPS+ +P+  +V    +     M R EV   + ++HLG
Sbjct: 207 YVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSGNSHLG 266

Query: 236 HVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
           HVF DGP +  G RYCINS ++   PK ++   G
Sbjct: 267 HVFTDGPKDQGGLRYCINSLSITFIPKADMEAKG 300



>gb:BX321861_774029 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 6/10.
          Length = 445

 Score =  104 bits (260), Expect = 2e-21
 Identities = 58/115 (50%), Positives = 69/115 (60%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           LT +Q  I  Q+GTER FT    D K PG +        LF S TKF+SGTGWPS+++PV
Sbjct: 331 LTPEQQKIAFQQGTERPFTASNLDEKRPGRFVDPITGATLFFSKTKFNSGTGWPSFFEPV 390

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCINSAALKLKP 162
             +V    D S  +M R EV  A+   HLGHVFDDGP P+ KRYCIN   LK  P
Sbjct: 391 EGSVTYHEDHS-GYMQRIEVRSASSGIHLGHVFDDGPPPSYKRYCINGNVLKFIP 444



>gb:AE016822_339827 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 155

 Score =  104 bits (260), Expect = 2e-21
 Identities = 58/126 (46%), Positives = 76/126 (60%), Gaps = 2/126 (1%)
 Frame = -1

Query: 509 RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP 330
           RLT  QF +T++  TE AF  E+W++   G Y  +    PLF S  K+DS +GWPS+  P
Sbjct: 14  RLTAAQFAVTQESATEPAFRNEFWNSHEAGLYVDIVSGEPLFASVDKYDSRSGWPSFTVP 73

Query: 329 V-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK* 156
           V   N+  K D S   + R EV  A  D+HLGH+FDDGP E  G RYC+NSAAL+  P  
Sbjct: 74  VEPGNIVEKTDRSFGTL-RTEVRSAHGDSHLGHLFDDGPAEAGGLRYCVNSAALRFVPLA 132

Query: 155 EVSKGG 138
           E+ + G
Sbjct: 133 ELDEQG 138



>sp|P25566|YCD3_YEAST Hypothetical 19.3 kDa protein in STE50
           5'region.>pir|S19361|S19361 hypothetical protein YCL033c
           - yeast (Saccharomyces cerevisiae)>gb:SCCHRIII_1706810
           S.cerevisiae chromosome III complete DNA sequence.
          Length = 168

 Score =  104 bits (260), Expect = 2e-21
 Identities = 55/140 (39%), Positives = 73/140 (52%), Gaps = 6/140 (4%)
 Frame = -1

Query: 566 YAEVSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPL 387
           Y   S K     +D +W   LT  Q  + R K TER  TG Y  T   G YHC  CD PL
Sbjct: 27  YWNKSKKMSDESNDVKWNDALTPLQLMVLRDKATERPNTGAYLHTNESGVYHCANCDRPL 86

Query: 386 FESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFD-DGPE- 213
           + S  KFD+  GWP++Y+ V     +    + +   R E+ CA C  HLGHVF+ +G + 
Sbjct: 87  YSSKAKFDARCGWPAFYEEVSPGAITYHRDNSLMPARVEICCARCGGHLGHVFEGEGWKQ 146

Query: 212 ----PTGKRYCINSAALKLK 165
               P   R+C+NSA+L LK
Sbjct: 147 LLNLPKDTRHCVNSASLNLK 166



>sp|Q8YBR7|MSRB_BRUME Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|AB3612|AB3612 transcription regulator
           [imported] - Brucella melitensis  (strain
           16M)>gb:AE009715_254798 Brucella melitensis 16M
           chromosome II, section 77 of 107 of the complete
           sequence.>gb:AE014292_310018 Brucella suis 1330
           chromosome II, complete sequence.>gb:AE008918_980710
           Brucella melitensis 16M chromosome II, complete
           sequence.
          Length = 146

 Score =  104 bits (260), Expect = 2e-21
 Identities = 58/119 (48%), Positives = 75/119 (63%), Gaps = 2/119 (1%)
 Frame = -1

Query: 509 RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP 330
           +L+ +Q+ +T++ GTER  TGEY   K PG Y  +    PLF SS K++S  GWPS+ KP
Sbjct: 12  KLSAEQYRVTQENGTERPGTGEYLYNKEPGIYVDIVSGEPLFASSDKYESHCGWPSFTKP 71

Query: 329 VGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK 159
           +   NV    D+S   M R EV  A  D+HLGHVF DGP +  G RYCINSA+L+  PK
Sbjct: 72  IERANVTELTDMS-HGMVRTEVRSAHGDSHLGHVFPDGPVDRGGLRYCINSASLRFVPK 129



>gb:BT005459_1638399 Arabidopsis thaliana clone U51274 unknown
           protein (At4g04840) mRNA, complete
           cds.>gb:AK118878_1816832 Arabidopsis thaliana At4g04840
           mRNA for unknown protein, complete cds, clone:
           RAFL21-20-P21.
          Length = 153

 Score =  104 bits (259), Expect = 2e-21
 Identities = 50/122 (40%), Positives = 74/122 (60%), Gaps = 2/122 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+EEW+  L+ +QF I R+K  E+  +GEY      G Y CV C  P+++S+TKFDSG G
Sbjct: 27  SNEEWRTVLSPEQFKILREKSIEKRGSGEYVKLFEEGIYCCVGCGNPVYKSTTKFDSGCG 86

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAA 177
           WP+++  +   +    + + +   R E+ C  CD HLGHV   +  P PT +R+C+NS A
Sbjct: 87  WPAFFDAIPGAINRTEERAGL---RYEITCTKCDGHLGHVLKNEGFPTPTDERHCVNSVA 143

Query: 176 LK 171
           LK
Sbjct: 144 LK 145



>pir|H85060|H85060 hypothetical protein AT4g04840 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV13_1544328 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 13.
          Length = 141

 Score =  104 bits (259), Expect = 2e-21
 Identities = 50/122 (40%), Positives = 74/122 (60%), Gaps = 2/122 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           S+EEW+  L+ +QF I R+K  E+  +GEY      G Y CV C  P+++S+TKFDSG G
Sbjct: 15  SNEEWRTVLSPEQFKILREKSIEKRGSGEYVKLFEEGIYCCVGCGNPVYKSTTKFDSGCG 74

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAA 177
           WP+++  +   +    + + +   R E+ C  CD HLGHV   +  P PT +R+C+NS A
Sbjct: 75  WPAFFDAIPGAINRTEERAGL---RYEITCTKCDGHLGHVLKNEGFPTPTDERHCVNSVA 131

Query: 176 LK 171
           LK
Sbjct: 132 LK 133



>gb:AY588242_630455 Lactobacillus sakei protein methionine sulfoxide
           reductase (selR) and protein methionine sulfoxide
           reductase (msrA) genes, complete cds.
          Length = 143

 Score =  103 bits (258), Expect = 3e-21
 Identities = 57/130 (43%), Positives = 79/130 (60%), Gaps = 1/130 (0%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           ++ +++LT +Q+ +T++  TE  F+GEY +   PG Y  V    PLF S  K+D+G GWP
Sbjct: 3   DDLRQQLTPEQYVVTQENATEMPFSGEYDEFDQPGIYVDVVSHEPLFSSLDKYDAGCGWP 62

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKL 168
           S+ +P+   +  K D +   M R EV     D+HLGHVF DGP E  G RYCINSAALK 
Sbjct: 63  SFTRPI-VKLNEKRDRT-HGMERVEVRSQNADSHLGHVFTDGPQEQGGLRYCINSAALKF 120

Query: 167 KPK*EVSKGG 138
            PK ++   G
Sbjct: 121 IPKDDLKAAG 130



>gb:CR380948_1649233 Candida glabrata strain CBS138 chromosome B
           complete sequence.
          Length = 163

 Score =  103 bits (257), Expect = 4e-21
 Identities = 53/131 (40%), Positives = 70/131 (53%), Gaps = 6/131 (4%)
 Frame = -1

Query: 539 SSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDS 360
           S    +EW   LT +Q ++ + KGTE   TG+Y      G Y C  CD PL+ S TKFDS
Sbjct: 31  SKTDKKEWNPELTSEQLHVLKDKGTEAPGTGKYLYNDRTGVYTCANCDAPLYRSETKFDS 90

Query: 359 GTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF-DDGPE-----PTGKR 198
           G GWP++   +   +K K D S   M R E++CA C  HLGH F  +G       P   R
Sbjct: 91  GCGWPAFNGEIKGALKYKKDFSHGMM-RTEIMCAKCGGHLGHEFKGEGWNKRLNLPNDSR 149

Query: 197 YCINSAALKLK 165
           +C+NS +L  K
Sbjct: 150 HCVNSLSLNFK 160



>gb:AE016969_369745 Mycoplasma gallisepticum strain R section 3 of 4
           of the complete genome.>gb:AE015450_1034394 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 164

 Score =  103 bits (257), Expect = 4e-21
 Identities = 60/151 (39%), Positives = 82/151 (54%), Gaps = 5/151 (3%)
 Frame = -1

Query: 569 FYAEVSNKD----FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVC 402
           F+ +  NKD    +     E  KK LT  QF +T+   TER +T EY      G Y  + 
Sbjct: 2   FHNQTYNKDKMKKYKKKPIEVLKKELTPLQFDVTQNSATERPYTNEYDQNFKKGIYVDIT 61

Query: 401 CDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDD 222
              PLF S+ K+DSG GWP++  P+  ++ +++      M R EV     D+HLGHVF D
Sbjct: 62  TGEPLFLSTDKYDSGCGWPAFSHPIAKSLINEVKDLSHNMVRVEVRAKNSDSHLGHVFTD 121

Query: 221 GP-EPTGKRYCINSAALKLKPK*EVSKGGQE 132
           GP +  G RYCINSA+LK  P  ++ K G E
Sbjct: 122 GPTDKGGLRYCINSASLKFIPYEDLKKAGYE 152



>gb:AE012887_286750 Chlorobium tepidum TLS section 108 of 194 of the
           complete genome.>gb:AE006470_933918 Chlorobium tepidum
           TLS complete genome.
          Length = 284

 Score =  102 bits (254), Expect = 9e-21
 Identities = 52/118 (44%), Positives = 69/118 (58%), Gaps = 1/118 (0%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           K LT ++  +   KGTER F+G+Y+ TK  G Y C  C   LF S  KFDSGTGWPS+  
Sbjct: 4   KTLTPEEKRVIIDKGTERPFSGKYYLTKEKGVYQCKQCGADLFRSDAKFDSGTGWPSFDD 63

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF-DDGPEPTGKRYCINSAALKLKP 162
            +   V+ + D   +   R E+LCA C  HLGHVF ++G      RYC+NS +L  +P
Sbjct: 64  AIPGAVRQETDRDGM---RIEILCANCGGHLGHVFYNEGFTSKNARYCVNSVSLSFEP 118



>gb:CP000003_860723 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 145

 Score =  102 bits (253), Expect = 1e-20
 Identities = 58/132 (43%), Positives = 73/132 (55%), Gaps = 1/132 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           + EE K+R+    + +T+   TE  FTGEY D    G Y  +     LF S  KF+SG G
Sbjct: 3   TSEELKQRIGDLSYEVTQHAATESPFTGEYDDFFEKGIYVDIVSGEVLFSSLDKFNSGCG 62

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAAL 174
           WP++ KP+ N +    D S   M R EV      +HLGHVF DGP E  G RYCINSAAL
Sbjct: 63  WPAFSKPIENRMVINHDDSSYGMRRVEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAAL 122

Query: 173 KLKPK*EVSKGG 138
           K  P  ++ K G
Sbjct: 123 KFIPYEQMEKEG 134



>pir|E85060|E85060 hypothetical protein AT4g04810 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV13_1544325 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 13.
          Length = 139

 Score =  102 bits (253), Expect = 1e-20
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 2/125 (1%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           ++EEW+  L+ +QF I RQKGTE   T EY      G + C+ C TPL++S+TKFD+G G
Sbjct: 11  TEEEWRAVLSPEQFRILRQKGTETPGTEEYDKFFEEGIFSCIGCKTPLYKSTTKFDAGCG 70

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSAA 177
           WP++++ +   +    D       R E+ CA CD HLGHV   +    PT +R C+NS +
Sbjct: 71  WPAFFEGLPGAINRAPDPD---GRRTEITCAVCDGHLGHVHKGEGYSTPTDERLCVNSVS 127

Query: 176 LKLKP 162
           +   P
Sbjct: 128 INFNP 132



>sp|Q8P172|MSRB_STRP8 Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE010030_258548 Streptococcus pyogenes
           strain MGAS8232, section 78 of 173 of the complete
           genome.>gb:AE009949_904930 Streptococcus pyogenes strain
           MGAS8232, complete genome.
          Length = 145

 Score =  102 bits (253), Expect = 1e-20
 Identities = 57/132 (43%), Positives = 74/132 (56%), Gaps = 1/132 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           + +E K+R+    + +T+   TE  FTGEY D    G Y  +     LF S  KF+SG G
Sbjct: 3   TSDELKQRIGDLSYEVTQHAATESPFTGEYDDFFEKGIYIDIVSGEVLFSSLDKFNSGCG 62

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAAL 174
           WP++ KP+ N + +  D S   M R EV      +HLGHVF DGP E  G RYCINSAAL
Sbjct: 63  WPAFSKPIENRMVTNHDDSSYGMRRVEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAAL 122

Query: 173 KLKPK*EVSKGG 138
           K  P  ++ K G
Sbjct: 123 KFIPYEQMEKEG 134



>sp|Q88W33|MSRB_LACPL Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AL935257_551584 Lactobacillus plantarum
           strain WCFS1 complete genome; segment 6/11.
          Length = 144

 Score =  102 bits (253), Expect = 1e-20
 Identities = 58/130 (44%), Positives = 77/130 (59%), Gaps = 2/130 (1%)
 Frame = -1

Query: 521 EWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPS 342
           E ++RLT +Q+ +T++  TER F+GEY +    G Y  V     LF S  K+D+G GWPS
Sbjct: 7   ELRQRLTPEQYAVTQEAATERPFSGEYDNFYQEGIYVDVVSGQALFSSRDKYDAGCGWPS 66

Query: 341 YYKPVG-NNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKL 168
           + KP+   N+    D S   M R EV     ++HLGHVF DGP +  G RYCINSAALK 
Sbjct: 67  FTKPIDQTNLNEHRDES-FGMHRTEVTSTQANSHLGHVFPDGPRDRGGLRYCINSAALKF 125

Query: 167 KPK*EVSKGG 138
            P  ++ K G
Sbjct: 126 IPVADLEKAG 135



>sp|Q8K7M6|MSRB_STRP3 Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE014151_304216 Streptococcus pyogenes
           MGAS315, section 16 of 37 of the complete
           genome.>gb:BA000034_713864 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:AE014074_927395 Streptococcus
           pyogenes MGAS315, complete genome.
          Length = 145

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/132 (43%), Positives = 74/132 (56%), Gaps = 1/132 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           + +E K+R+    + +T+   TE  FTGEY D    G Y  +     LF S  KF+SG G
Sbjct: 3   TSDELKQRIGELSYEVTQHAATESPFTGEYDDFFEKGIYVDIVSGEVLFSSLDKFNSGCG 62

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAAL 174
           WP++ KP+ N + +  D S   M R EV      +HLGHVF DGP E  G RYCINSAAL
Sbjct: 63  WPAFSKPIENRMVTNHDDSSYGMRRVEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAAL 122

Query: 173 KLKPK*EVSKGG 138
           K  P  ++ K G
Sbjct: 123 KFIPYDQMEKEG 134



>sp|Q9LAM9|MSAB_STRGC Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].>gb:AF128264_481530
           Streptococcus gordonii dihydroorotate dehydrogenase
           (pyrD) gene, partial cds; methionine sulfoxide reductase
           (msrA) gene, complete cds; and unknown gene.
          Length = 311

 Score =  101 bits (252), Expect = 2e-20
 Identities = 57/136 (41%), Positives = 76/136 (55%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   +D E K++LT +Q+ +T+   TER F   Y  T   G Y  V    PLF +  KF+
Sbjct: 167 YEKPTDAELKEQLTQEQYQVTQLSATERPFHNAYNATFEEGIYVDVTTGEPLFFAGDKFE 226

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-GKRYCIN 186
           SG GWPS+ +P+   V    +     M R EV   + +AHLGHVF DGPE   G RYCIN
Sbjct: 227 SGCGWPSFSRPIAREVLRYYEDKSHGMERIEVRSRSGNAHLGHVFTDGPESAGGLRYCIN 286

Query: 185 SAALKLKPK*EVSKGG 138
           SAAL+  PK ++   G
Sbjct: 287 SAALRFIPKEKMEAEG 302



>gb:CP000024_877131 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 340

 Score =  101 bits (251), Expect = 2e-20
 Identities = 55/141 (39%), Positives = 75/141 (53%), Gaps = 1/141 (0%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           + +  +   S EE K  L+ + + +T++  TERAFT   W+   PG Y  V    PLF S
Sbjct: 191 IDSSSYHKPSQEELKVSLSPEAYAVTQENRTERAFTSPLWNHFEPGIYVDVVTGEPLFSS 250

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGK 201
             KF S  GWPS+ +P+   V +  +     M R EV     D+HLGHVF DGP +  G 
Sbjct: 251 RDKFYSACGWPSFSRPISPEVANYKEDHSHNMDRIEVRSRVGDSHLGHVFPDGPSDKGGL 310

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYCIN  A +  PK ++ K G
Sbjct: 311 RYCINGVATRFVPKADMEKEG 331



>gb:AE017328_444308 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076664
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 145

 Score =  101 bits (251), Expect = 2e-20
 Identities = 55/134 (41%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           ++LT  Q+ +T++ GTER F  E++D +  G Y  +    PLF S+ ++D+G GWPS+ K
Sbjct: 11  QQLTDIQYNVTQKAGTERPFQNEFYDNEAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTK 70

Query: 332 PVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-GKRYCINSAALKLKPK 159
           P+    V    DL+   M R EV  A  D+HLGHVF DGP+   G RYCINSAAL+  P 
Sbjct: 71  PIDEAEVIEHRDLT-HGMIRTEVKSADADSHLGHVFPDGPQDKGGLRYCINSAALRFIPV 129

Query: 158 *EVSKGGQEGCESV 117
            ++ + G +  + +
Sbjct: 130 DKLEEEGYQAYKKI 143



>sp|Q8Y641|MSRB_LISMO Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|AC1307|AC1307 transcription regulator
           (PilB family) homolog lmo1859 [imported] - Listeria
           monocytogenes (strain EGD-e)>gb:AL591981_536350 Listeria
           monocytogenes strain EGD, complete genome, segment 9/12.
          Length = 145

 Score =  101 bits (251), Expect = 2e-20
 Identities = 55/134 (41%), Positives = 81/134 (60%), Gaps = 2/134 (1%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           ++LT  Q+ +T++ GTER F  E++D +  G Y  +    PLF S+ ++D+G GWPS+ K
Sbjct: 11  QQLTDIQYNVTQKAGTERPFQNEFYDNEVKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTK 70

Query: 332 PVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-GKRYCINSAALKLKPK 159
           P+    V    DL+   M R EV  A  D+HLGHVF DGP+   G RYCINSAAL+  P 
Sbjct: 71  PIDEAEVIEHRDLT-HGMIRTEVKSADADSHLGHVFPDGPQDKGGLRYCINSAALRFIPV 129

Query: 158 *EVSKGGQEGCESV 117
            ++ + G +  + +
Sbjct: 130 DKLEEEGYQAYKKI 143



>sp|Q93KF3|MSAB_CAMFE Peptide methionine sulfoxide reductase
           msrA/msrB (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase
           msrB].>gb:CFE312325_845913 Campylobacter fetus ciaB gene
           for putative campylobacter invasion antigen B and msrA
           gene for putative peptide methionine sulfoxide
           reductase.
          Length = 337

 Score =  101 bits (251), Expect = 2e-20
 Identities = 58/137 (42%), Positives = 79/137 (57%), Gaps = 2/137 (1%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           F + S +E K +L+  Q+ +T++K TER ++ EY      G Y  +    PLF SS KFD
Sbjct: 193 FKAPSKDELKAKLSDLQYSVTQEKATERPYSSEYDKFDKKGIYVDIVSKKPLFSSSDKFD 252

Query: 362 SGTGWPSYYKPVGNNVKS-KLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCI 189
           +G GWPS+ KP+  +      DLS   M R EV     ++HLGHVF DGP +  G RYCI
Sbjct: 253 AGCGWPSFTKPITTDALGYNRDLS-HGMERVEVTSNLANSHLGHVFTDGPKDKGGLRYCI 311

Query: 188 NSAALKLKPK*EVSKGG 138
           N A+LK  P  ++ K G
Sbjct: 312 NGASLKFIPLEDMEKEG 328



>gb:AY204469_597174 Myxococcus xanthus clone C1213 putative
           histidine kinase, sensor protein, MsrA-like protein,
           adventurous gliding motility protein R (aglR),
           adventurous gliding motility protein S (aglS), putative
           membrane protein, histidine kinase, hypothetical
           proteins, and NH3-dependent NAD+ synthetase genes,
           complete cds.
          Length = 407

 Score =  100 bits (249), Expect = 3e-20
 Identities = 56/136 (41%), Positives = 76/136 (55%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   SD + ++ L+   + +T++  TE AF    W+    G Y  V    PLF S  KFD
Sbjct: 85  YEKPSDADLRRTLSPLAYEVTQKGATEPAFRNPLWNHHEEGLYVDVVSGEPLFSSRDKFD 144

Query: 362 SGTGWPSYYKPVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGKRYCIN 186
           SGTGWPS+ +PV +  +  K D S   M R EV   A  +HLGH+F DGP P   RYCIN
Sbjct: 145 SGTGWPSFTRPVDSARIVEKRD-STQGMERVEVRSKAAGSHLGHLFGDGPAPAKTRYCIN 203

Query: 185 SAALKLKPK*EVSKGG 138
           SAAL+     +++K G
Sbjct: 204 SAALRFVAVNDLAKEG 219



>gb:AE017308_437854 Mycoplasma mobile 163K complete genome.
          Length = 146

 Score =  100 bits (249), Expect = 3e-20
 Identities = 56/135 (41%), Positives = 82/135 (60%), Gaps = 2/135 (1%)
 Frame = -1

Query: 536 SVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSG 357
           ++   E KKRLT  Q+ +T++ GTER +  E+ +    G Y  +   TPLF S  K++SG
Sbjct: 4   NIDKNELKKRLTDLQWKVTQENGTERPYNNEFDNHFEEGIYIDIVDGTPLFISKDKYNSG 63

Query: 356 TGWPSYYKPVGNNV-KSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINS 183
            GWP++ KP+   V + K+D +   M R E+     D+HLGHVF+DGP +  G R+CINS
Sbjct: 64  CGWPAFTKPIDPFVIEEKMDFT-SGMTRVEIRSKNADSHLGHVFNDGPRDKGGLRFCINS 122

Query: 182 AALKLKPK*EVSKGG 138
           A+LK   K ++ K G
Sbjct: 123 ASLKFIKKEDLEKEG 137



>gb:CP000023_875220 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 340

 Score =  100 bits (248), Expect = 4e-20
 Identities = 55/141 (39%), Positives = 74/141 (52%), Gaps = 1/141 (0%)
 Frame = -1

Query: 557 VSNKDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFES 378
           + +  +   S EE K  L+   + +T++  TERAFT   W+   PG Y  V    PLF S
Sbjct: 191 IDSSSYHKPSQEELKVSLSPAAYAVTQENRTERAFTSPLWNHFEPGIYVDVVTGEPLFSS 250

Query: 377 STKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGK 201
             KF S  GWPS+ +P+   V +  +     M R EV     D+HLGHVF DGP +  G 
Sbjct: 251 RDKFYSACGWPSFSRPISPEVANYKEDHSHNMDRIEVRSRVGDSHLGHVFPDGPSDKGGL 310

Query: 200 RYCINSAALKLKPK*EVSKGG 138
           RYCIN  A +  PK ++ K G
Sbjct: 311 RYCINGVATRFVPKADMEKEG 331



>sp|Q99ZV6|MSRB_STRPY Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AE006550_220067 Streptococcus pyogenes
           M1 GAS, section 79 of 167 of the complete
           genome.>gb:AE004092_1105913 Streptococcus pyogenes M1
           GAS, complete genome.
          Length = 145

 Score =  100 bits (248), Expect = 4e-20
 Identities = 56/132 (42%), Positives = 74/132 (56%), Gaps = 1/132 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           + +E K+R+    + +T+   TE  FTGEY +    G Y  +     LF S  KF+SG G
Sbjct: 3   TSDELKQRIGDLSYEVTQHAATESPFTGEYDNFFEKGIYVDIVSGEVLFSSLDKFNSGCG 62

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAAL 174
           WP++ KP+ N + +  D S   M R EV      +HLGHVF DGP E  G RYCINSAAL
Sbjct: 63  WPAFSKPIENRMVTNHDDSSYGMRRVEVKSREAGSHLGHVFSDGPKEAGGLRYCINSAAL 122

Query: 173 KLKPK*EVSKGG 138
           K  P  ++ K G
Sbjct: 123 KFIPYDQMEKEG 134



>sp|Q9ZNJ9|MSRB_CLOHI Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|T44354|T44354 hypothetical protein
           [imported] - Clostridium histolyticum>gb:AB014075_2255
           Clostridium histolyticum genes for hypoxanthine-guanine
           phosphoribosyl-transferase (HGPRTase), GTPase and 12
           ORFs, complete and partial cds.
          Length = 159

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 57/141 (40%), Positives = 81/141 (57%), Gaps = 2/141 (1%)
 Frame = -1

Query: 548 KDFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTK 369
           K++  +  E+ K+ LT  Q+ +T++  TE+ F  +Y      G Y  +    PLF S  K
Sbjct: 7   KEYKKLDTEKLKENLTELQYNVTQRNATEKPFLNKYDKHFEDGIYVDIVSGEPLFLSIDK 66

Query: 368 FDSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRY 195
           F+SG GWP++ KP+    +K + D S   M R EV     D+HLGHVF+DGP E  G RY
Sbjct: 67  FNSGCGWPAFSKPISRKYIKERADFS-HGMSRIEVRSKNADSHLGHVFNDGPIENGGMRY 125

Query: 194 CINSAALKLKPK*EVSKGGQE 132
           CINSA+LK   K ++ + G E
Sbjct: 126 CINSASLKFIAKDKLKEEGYE 146



>sp|Q92AE9|MSRB_LISIN Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|AC1679|AC1679 transcription regulator
           (PilB family) homolog lin1973 [imported] - Listeria
           innocua (strain Clip11262)>gb:AL596170_539317 Listeria
           innocua Clip11262 complete genome, segment 8/12.
          Length = 145

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 58/133 (43%), Positives = 78/133 (58%), Gaps = 2/133 (1%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           K+LT  Q+ +T++  TER F  E++D    G Y  +    PLF S+ ++D+G GWPS+ K
Sbjct: 11  KQLTDIQYNVTQKADTERPFQNEFYDNVAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTK 70

Query: 332 PVGN-NVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPT-GKRYCINSAALKLKPK 159
           P+    V    DLS   M R EV     D+HLGHVF DGP+   G RYCINSAAL+  P 
Sbjct: 71  PIDEAEVIEHRDLS-HGMIRTEVKSVEADSHLGHVFPDGPQDQGGLRYCINSAALRFIP- 128

Query: 158 *EVSKGGQEGCES 120
             V K  +EG ++
Sbjct: 129 --VDKLEEEGYQT 139



>gb:AE017204_404544 Lactobacillus johnsonii NCC 533, section 5 of 7
           of the complete genome.>gb:AE017198_1123031
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 142

 Score = 98.2 bits (243), Expect = 2e-19
 Identities = 56/130 (43%), Positives = 75/130 (57%), Gaps = 1/130 (0%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           +E  K+L  +Q+ +T+   TE  F+G+Y D    G Y  V    PLF S  K+D+G GWP
Sbjct: 5   KEALKKLNSEQYEVTQHAATEMPFSGKYNDFNQKGIYVDVVSGEPLFSSQDKYDAGCGWP 64

Query: 344 SYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKL 168
           S+ KP+   +  K D S   M R EV     D+HLGHVF DGP +  G RYCINSA+LK 
Sbjct: 65  SFTKPI-KKLSYKRDQS-HGMERTEVKSPIADSHLGHVFTDGPVDQGGLRYCINSASLKF 122

Query: 167 KPK*EVSKGG 138
            P  ++ + G
Sbjct: 123 IPYDKLEEEG 132



>gb:AY602216_635495 Lactobacillus reuteri methionine sulfoxide
           reductase (msrB) gene, complete cds.
          Length = 142

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 53/131 (40%), Positives = 75/131 (57%), Gaps = 1/131 (0%)
 Frame = -1

Query: 527 DEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGW 348
           D+   K+LT  Q+ +T+   TE+ ++G+Y     PG Y  V    PLF S  K+D+G GW
Sbjct: 2   DKNELKKLTPMQYAVTQMGVTEKPYSGKYDRFDEPGIYVDVVSGEPLFSSLDKYDAGCGW 61

Query: 347 PSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALK 171
           P++ KP+   V ++       M R EV     D+HLGHVF DGP +  G RYCINSAAL+
Sbjct: 62  PAFTKPIKKRVLTEKRDQSFGMERTEVRSKEADSHLGHVFTDGPTDRGGLRYCINSAALQ 121

Query: 170 LKPK*EVSKGG 138
             P  ++ + G
Sbjct: 122 FIPVDKLQEKG 132



>gb:AE017332_445802 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 142

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 57/121 (47%), Positives = 73/121 (60%), Gaps = 2/121 (1%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           LT  Q+ +T+Q  TE AF   Y +    G Y  +   TPLF S  K+DSG+GWPS+ KP+
Sbjct: 10  LTELQYKVTQQNFTEPAFDNLYNNNYQEGVYVDIVDGTPLFLSIYKYDSGSGWPSFSKPI 69

Query: 326 GNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEP-TGKRYCINSAALKLKPK*E 153
             N +   LD S   + R EV     D+HLGHVF DGP+   G+RYCINSA+LK  PK E
Sbjct: 70  DENLIVEVLDFS-ASLTRIEVRSKNADSHLGHVFSDGPKQFGGRRYCINSASLKFIPKSE 128

Query: 152 V 150
           +
Sbjct: 129 L 129



>gb:CP000031_87733 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 149

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 52/124 (41%), Positives = 75/124 (60%), Gaps = 1/124 (0%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           L+ ++F++T++ GTER  TG+    K PG Y  +    PLF SS K++SG GWPS+ KP+
Sbjct: 14  LSPEEFHVTQRSGTERPGTGKLLHNKEPGIYVDIVSGEPLFASSDKYESGCGWPSFTKPI 73

Query: 326 GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK*EV 150
                 +L+     M R EV     D+HLGHVF DGP +  G RYCINSA+L+   + ++
Sbjct: 74  ETTHVLELEDRTHGMIRTEVRSKHGDSHLGHVFPDGPRDRGGLRYCINSASLRFVHRDDM 133

Query: 149 SKGG 138
           +  G
Sbjct: 134 TAEG 137



>sp|P47686|MSRB_MYCGE Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|E64249|E64249 pilin repressor pilB
           homolog MG448 - Mycoplasma genitalium>gb:U39726_205865
           Mycoplasma genitalium G-37 section 48 of 51 of the
           complete genome.>gb:L43967_1101017 Mycoplasma genitalium
           G-37, complete genome.
          Length = 150

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 58/136 (42%), Positives = 74/136 (54%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   S+ E K+ LT  QF +T+   TE  +  EY      G Y  +    PLF S+ KF 
Sbjct: 4   YQKKSEAELKRTLTKLQFDVTQNAHTEPPYINEYNRNFEKGIYVDITSGEPLFISTDKFK 63

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCIN 186
           SG GWP++ KP+  N+ +        M R EV     D+HLGHVF+DGP E  G RYCIN
Sbjct: 64  SGCGWPAFSKPIDKNLIANYRDESHGMIRTEVRAKNSDSHLGHVFNDGPSELGGLRYCIN 123

Query: 185 SAALKLKPK*EVSKGG 138
           SAALK  P  E+ K G
Sbjct: 124 SAALKFIPFEEMEKLG 139



>gb:SAG766848_170448 Streptococcus agalactiae NEM316 complete
           genome, segment 6.>gb:AE014233_306230 Streptococcus
           agalactiae 2603V/R section 43 of 100 of the complete
           genome.>gb:AE009948_936343 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 144

 Score = 97.4 bits (241), Expect = 3e-19
 Identities = 54/132 (40%), Positives = 74/132 (56%), Gaps = 1/132 (0%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTG 351
           + EE ++R+    + +T+   TE AFTG+Y D    G Y  +     LF S  KF SG G
Sbjct: 4   TQEELRQRIGHTAYQVTQNSATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSGCG 63

Query: 350 WPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAAL 174
           WP++ KP+ N + +        M R EV     D+HLGHVF+DGP +  G RYCINSAAL
Sbjct: 64  WPAFSKPIENRMVTNHQDHSHGMHRIEVRSRQADSHLGHVFNDGPVDAGGLRYCINSAAL 123

Query: 173 KLKPK*EVSKGG 138
              P  +++K G
Sbjct: 124 DFIPYDQMAKRG 135



>gb:AJ749949_531562 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 284

 Score = 96.7 bits (239), Expect = 5e-19
 Identities = 52/118 (44%), Positives = 63/118 (53%), Gaps = 1/118 (0%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           K LT  ++ I   K TE+ FTG Y D    G Y C  C TPLF + +KF S  GWPSY  
Sbjct: 5   KSLTPHEYDIIINKATEKPFTGRYNDLDQKGVYICRNCGTPLFRADSKFISACGWPSYDI 64

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF-DDGPEPTGKRYCINSAALKLKP 162
            + NNVK   D       R E+LC  CD HLGH+F  +G      RYC+NSA +   P
Sbjct: 65  HIDNNVKQLPDAD---GRRTEILCNNCDGHLGHIFHGEGYTKLNTRYCVNSACVDFIP 119



>sp|Q9CJ17|MSRB_LACLA Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|E86648|E86648 reductase [imported] -
           Lactococcus lactis subsp. lactis  (strain
           IL1403)>gb:AE006256_217091 Lactococcus lactis subsp.
           lactis IL1403 section 18 of 218 of the complete
           genome.>gb:AE005176_1094164 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 142

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 55/123 (44%), Positives = 72/123 (58%), Gaps = 2/123 (1%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           E+ KK+L+   + +T++ GTE  F  E+ D    G Y  V     LF S  K+ SG GWP
Sbjct: 4   EKLKKKLSLLAYRVTQENGTEAPFANEFDDFFEQGLYVDVVSGEALFTSLDKYQSGCGWP 63

Query: 344 SYYKPVGNNV-KSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEPTGK-RYCINSAALK 171
           ++ +P+   V K K D S+ FM R EV  +  D+HLGHVF DGP   G  RYCINSAAL+
Sbjct: 64  AFTQPIDKGVVKEKRDKSL-FMERTEVRSSNADSHLGHVFTDGPLDKGDLRYCINSAALR 122

Query: 170 LKP 162
             P
Sbjct: 123 FVP 125



>gb:AE014295_311937 Bifidobacterium longum NCC2705, complete genome.
          Length = 327

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 53/125 (42%), Positives = 72/125 (57%), Gaps = 2/125 (1%)
 Frame = -1

Query: 506 LTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPV 327
           LT +QF +T+   TER F  EY +   PG Y  +    PLF S  KFDSG GWP++ +P+
Sbjct: 189 LTLEQFAVTQNAATERPFVNEYDEEFEPGIYVDIVSGEPLFSSQDKFDSGCGWPAFSRPI 248

Query: 326 -GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK*E 153
            G+ +    D  I    R EV  +    HLGHVF DGP +  G RYC+NSAAL+  P+  
Sbjct: 249 AGDLLTEHEDHRIPGRDRIEVRTSDTQIHLGHVFTDGPADRGGLRYCMNSAALRFVPRSR 308

Query: 152 VSKGG 138
           +++ G
Sbjct: 309 MAEEG 313



>sp|P75129|MSRB_MYCPN Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6) (K05_orf151).>pir|S73506|S73506 pilB
           homolog K05_orf151 - Mycoplasma pneumoniae (strain ATCC
           29342)>gb:AE000019_19073 Mycoplasma pneumoniae M129
           section 61 of 63 of the complete
           genome.>gb:U00089_1101702 Mycoplasma pneumoniae M129,
           complete genome.
          Length = 151

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 56/136 (41%), Positives = 73/136 (53%), Gaps = 1/136 (0%)
 Frame = -1

Query: 542 FSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFD 363
           +   SD E K+ LT  Q+ +T+   TE  +T EY      G Y  +    PLF S+ KF 
Sbjct: 4   YQKKSDGELKRTLTKLQYDVTQNAHTEPPYTNEYNRHYEKGIYVDITSGEPLFISTDKFK 63

Query: 362 SGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGPEP-TGKRYCIN 186
           SG GWP++ KP+  ++ +        M R EV     ++HLGHVF DGPE   G RYCIN
Sbjct: 64  SGCGWPAFTKPISQDLIANYRDESHGMIRTEVRAKNSNSHLGHVFRDGPEEHGGLRYCIN 123

Query: 185 SAALKLKPK*EVSKGG 138
           SAALK  P  E+   G
Sbjct: 124 SAALKFIPFAEMESAG 139



>gb:CP000033_89614 Lactobacillus acidophilus NCFM, complete genome.
          Length = 145

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 54/126 (42%), Positives = 75/126 (59%), Gaps = 1/126 (0%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           K+LT +++ +T+   TE  FTG+Y +    G Y  V    PLF S  K+D+G GWPS+ K
Sbjct: 13  KKLTQEEYDVTQNAATEYPFTGKYDNFYEKGIYVDVVSGEPLFSSQDKYDAGCGWPSFTK 72

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK* 156
           P+   ++   D S   M R EV+     +HLGHVF DGP +  G RYCINSAALK  P  
Sbjct: 73  PI-EKLQYHRDQS-HGMERTEVVSPEAQSHLGHVFTDGPVDRGGLRYCINSAALKFIPYD 130

Query: 155 EVSKGG 138
           ++++ G
Sbjct: 131 QLNEAG 136



>gb:T4B21_1724080 Arabidopsis thaliana BAC T4B21.
          Length = 155

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 50/136 (36%), Positives = 74/136 (54%), Gaps = 16/136 (11%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTE--------------RAFTGEYWDTKTPGTYHCVCCDT 393
           S+EEW+  L+ +QF I R+K  E              +  +GEY      G Y CV C  
Sbjct: 15  SNEEWRTVLSPEQFKILREKSIEFDDVFFLFSTDECRKRGSGEYVKLFEEGIYCCVGCGN 74

Query: 392 PLFESSTKFDSGTGWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDG 219
           P+++S+TKFDSG GWP+++  +   +    + + +   R E+ C  CD HLGHV   +  
Sbjct: 75  PVYKSTTKFDSGCGWPAFFDAIPGAINRTEERAGL---RYEITCTKCDGHLGHVLKNEGF 131

Query: 218 PEPTGKRYCINSAALK 171
           P PT +R+C+NS ALK
Sbjct: 132 PTPTDERHCVNSVALK 147



>pir|B90575|B90575 hypothetical protein MYPU_5060 [imported] -
           Mycoplasma pulmonis (strain UAB CTIP)>gb:MPULM02_150019
           Mycoplasma pulmonis (strain UAB CTIP) complete genome;
           segment 2/3.
          Length = 145

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 54/131 (41%), Positives = 77/131 (58%), Gaps = 2/131 (1%)
 Frame = -1

Query: 524 EEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWP 345
           E+  K LT  Q+ +T++  TE+AF  EY +    G Y  +   TPLF+S  K++SG+GWP
Sbjct: 6   EQRLKELTTLQYKVTQEGQTEKAFDNEYNNHYEEGIYVDIVDGTPLFKSQDKYNSGSGWP 65

Query: 344 SYYKPV-GNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALK 171
           ++  P+  + +    D S   + R EV      +HLGHVF DGP +  G RYCINSAAL+
Sbjct: 66  AFTSPIKKDEIVENADFS-YGLRRVEVKSKNAQSHLGHVFTDGPKDKGGLRYCINSAALR 124

Query: 170 LKPK*EVSKGG 138
             PK ++ K G
Sbjct: 125 FIPKKDLEKEG 135



>pir|T39910|T39910 conserved hypothetical protein SPBC216.04c -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC216_1719526 S.pombe chromosome II cosmid
           c216.
          Length = 138

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 48/123 (39%), Positives = 74/123 (60%), Gaps = 3/123 (2%)
 Frame = -1

Query: 530 SDEEWKKRLTGQQFYITRQKGTERAFTGEYWDT-KTPGTYHCVCCDTPLFESSTKFDSGT 354
           S++EWKK L  +++ I RQKGTE    G +       G + C  C   L+++STKF+S  
Sbjct: 8   SEDEWKKELGPEKYRIMRQKGTEHPGAGRFTHQFPKQGVFVCAACKELLYKASTKFESHC 67

Query: 353 GWPSYYKPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF--DDGPEPTGKRYCINSA 180
           GWP+++  +   VK +++ +   M R E +CA C  HLGH+F  +    PT +R+CINSA
Sbjct: 68  GWPAFFDNLPGKVK-RIEDNSYGMHRVEAVCANCGGHLGHIFKGEGYSNPTDERHCINSA 126

Query: 179 ALK 171
           +L+
Sbjct: 127 SLE 129



>gb:BX294136_766180 Pirellula sp. strain 1 complete genome; segment
           4/24.
          Length = 282

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 49/118 (41%), Positives = 67/118 (56%), Gaps = 1/118 (0%)
 Frame = -1

Query: 509 RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP 330
           +LT  + Y+   KGTE    G Y  TK PGTY C  C+TPL+ +  KF S  GWPS+   
Sbjct: 136 KLTEAEAYVILHKGTEPPGDGGYTLTKDPGTYICKRCNTPLYHAKDKFISHCGWPSFDDE 195

Query: 329 VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVF-DDGPEPTGKRYCINSAALKLKPK 159
           +   VK + D       R E++CA CD HLGHVF  +   P  +R+C+NS ++K  P+
Sbjct: 196 IEGAVKRQRDAD---GRRIEIVCANCDGHLGHVFHGERLTPKNERHCVNSISMKFIPE 250



>gb:AY248842_602256 Staphylococcus sp. MRCNS378
           trimethoprim-resistant dihydrofolate reductase (dfrA)
           gene, complete cds; and unknown genes.
          Length = 163

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 49/119 (41%), Positives = 67/119 (56%), Gaps = 1/119 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K+ L   ++ +T++ GTE  F  EYW+    G Y       PLF S  KF+S  GWPS+ 
Sbjct: 27  KEELNDMEYLVTQENGTEPPFQNEYWNHFEKGIYVDKLSGKPLFTSEDKFESNCGWPSFS 86

Query: 335 KPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKP 162
           K + ++   +L      M R EV     ++HLGHVF+DGP E  G RYCINSAA++  P
Sbjct: 87  KALNDDEIVELVDKSFGMIRTEVRSEKANSHLGHVFNDGPKEKGGLRYCINSAAIQFIP 145



>sp|Q8CSK6|MSRB_STAEP Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:CP000029_81604 Staphylococcus
           epidermidis RP62A, complete genome.>gb:AE016747_322766
           Staphylococcus epidermidis ATCC 12228, section 4 of 9 of
           the complete genome.>gb:AE015929_1147435 Staphylococcus
           epidermidis ATCC 12228, complete genome.
          Length = 142

 Score = 92.4 bits (228), Expect = 9e-18
 Identities = 49/119 (41%), Positives = 67/119 (56%), Gaps = 1/119 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K+ L   ++ +T++ GTE  F  EYW+    G Y       PLF S  KF+S  GWPS+ 
Sbjct: 6   KEELNDMEYLVTQENGTEPPFQNEYWNHFEKGIYVDKLSGKPLFTSEDKFESNCGWPSFS 65

Query: 335 KPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKP 162
           K + ++   +L      M R EV     ++HLGHVF+DGP E  G RYCINSAA++  P
Sbjct: 66  KALNDDEIVELVDKSFGMIRTEVRSEKANSHLGHVFNDGPKEKGGLRYCINSAAIQFIP 124



>gb:SPU41735_189536 Streptococcus pneumoniae peptide methionine
           sulfoxide reductase (msrA) and homoserine kinase homolog
           (thrB) genes, complete cds.
          Length = 312

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 56/138 (40%), Positives = 74/138 (53%), Gaps = 2/138 (1%)
 Frame = -1

Query: 545 DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF 366
           ++   S E  K  L+ + + +T++  TE  FT  Y  T   G Y  +    PLF +  KF
Sbjct: 166 NYEKPSQEVLKASLSEESYRVTQEAATEAPFTNAYDQTFEEGIYVDITTGEPLFFAKDKF 225

Query: 365 DSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYC 192
            SG GWPS+ +P+    +    DLS   M R EV   +  AHLGHVF DGP E  G RYC
Sbjct: 226 ASGCGWPSFSRPISKELIHYYKDLS-HGMERIEVRSRSGSAHLGHVFTDGPRELGGLRYC 284

Query: 191 INSAALKLKPK*EVSKGG 138
           INSA+L+   K E+ K G
Sbjct: 285 INSASLRFVAKDEMEKAG 302



>sp|P35593|MAB1_STRPN Peptide methionine sulfoxide reductase
           msrA/msrB 1 (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrA (Protein- methionine-S-oxide
           reductase) (Peptide Met(O) reductase); Peptide
           methionine sulfoxide reductase msrB].>pir|H95157|H95157
           peptide methionine sulfoxide reductase [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>pir|H98023|H98023 peptide methionine sulfoxide
           reductase [imported] - Streptococcus pneumoniae (strain
           R6)>gb:AE007433_226518 Streptococcus pneumoniae TIGR4
           section 116 of 194 of the complete
           genome.>gb:AE008493_237537 Streptococcus pneumoniae R6
           section 109 of 184 of the complete
           genome.>gb:AE007317_943695 Streptococcus pneumoniae R6,
           complete genome.>gb:AE005672_1104286 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 312

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 56/138 (40%), Positives = 74/138 (53%), Gaps = 2/138 (1%)
 Frame = -1

Query: 545 DFSSVSDEEWKKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKF 366
           ++   S E  K  L+ + + +T++  TE  FT  Y  T   G Y  +    PLF +  KF
Sbjct: 166 NYEKPSQEVLKASLSEESYRVTQEAATEAPFTNAYDQTFEEGIYVDITTGEPLFFAKDKF 225

Query: 365 DSGTGWPSYYKPVGNN-VKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYC 192
            SG GWPS+ +P+    +    DLS   M R EV   +  AHLGHVF DGP E  G RYC
Sbjct: 226 ASGCGWPSFSRPISKELIHYYKDLS-HGMERIEVRSRSGSAHLGHVFTDGPRELGGLRYC 284

Query: 191 INSAALKLKPK*EVSKGG 138
           INSA+L+   K E+ K G
Sbjct: 285 INSASLRFVAKDEMEKAG 302



>pir|S02018|S02018 regulatory protein pilB - Neisseria
           gonorrhoeae>gb:NG17PILB_152318 Neisseria gonorrhoeae
           pilB gene.
          Length = 521

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 50/115 (43%), Positives = 64/115 (55%), Gaps = 1/115 (0%)
 Frame = -1

Query: 479 RQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKSKLD 300
           +   TE AF+ EY     PG Y  V    PLF S+ K+DSG GWPS+ +P+     ++ D
Sbjct: 398 QNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHD 457

Query: 299 LSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKPK*EVSKGG 138
                M R EV   A D+HLGHVF DGP +  G RYCIN A+LK  P  ++   G
Sbjct: 458 DFSFNMRRTEVRSRAADSHLGHVFPDGPRDKGGLRYCINGASLKFIPLEQMDAAG 512



>sp|Q99U64|MSRB_STAAM Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>pir|G89919|G89919 conserved hypothetical
           protein SA1256 [imported] - Staphylococcus aureus
           (strain N315)>gb:BA000017_677112 Staphylococcus aureus
           subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_679698 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BX571856_780877 Staphylococcus aureus subsp.
           aureus strain MRSA252, complete genome.
          Length = 142

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 50/119 (42%), Positives = 66/119 (55%), Gaps = 1/119 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K  LT  ++ +T++ GTE  F  EYW+    G Y       PLF S  KF S  GWPS+ 
Sbjct: 6   KSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFS 65

Query: 335 KPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKP 162
           K + ++   +L      M R EV     ++HLGHVF+DGP E  G RYCINSAA++  P
Sbjct: 66  KALDDDEIIELVDKSFGMVRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIP 124



>sp|Q93P62|MSRB_STAAW Peptide methionine sulfoxide reductase msrB
           (EC 1.8.4.6).>gb:AF349112_503830 Staphylococcus aureus
           putative methionine sulfoxide reductase locus, complete
           sequence.>gb:BA000033_711605 Staphylococcus aureus
           subsp. aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571857_783586 Staphylococcus aureus
           strain MSSA476, complete genome.
          Length = 142

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 50/119 (42%), Positives = 66/119 (55%), Gaps = 1/119 (0%)
 Frame = -1

Query: 515 KKRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYY 336
           K  LT  ++ +T++ GTE  F  EYW+    G Y       PLF S  KF S  GWPS+ 
Sbjct: 6   KSELTDIEYIVTQENGTEPPFMNEYWNHFAKGIYVDKISGKPLFTSEEKFHSECGWPSFS 65

Query: 335 KPVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDGP-EPTGKRYCINSAALKLKP 162
           K + ++   +L      M R EV     ++HLGHVF+DGP E  G RYCINSAA++  P
Sbjct: 66  KALDDDEIIELVDKSFGMLRTEVRSEESNSHLGHVFNDGPKESGGLRYCINSAAIQFIP 124



>sp|O83641|MSAB_TREPA Peptide methionine sulfoxide reductase
           msrB/msrA (EC 1.8.4.6) [Includes: Peptide methionine
           sulfoxide reductase msrB; Peptide methionine sulfoxide
           reductase msrA (Protein-methionine-S-oxide reductase)
           (Peptide Met(O) reductase)].>pir|G71300|G71300 probable
           protein-methionine-S-oxide reductase (msrA) - syphilis
           spirochete>gb:AE001238_33457 Treponema pallidum subsp.
           pallidum str. Nichols section 54 of 87 of the complete
           genome.>gb:AE000520_1049685 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 291

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 53/130 (40%), Positives = 69/130 (53%), Gaps = 1/130 (0%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           + L+  Q+ +T+Q  TE  F  E+W++  PG Y  V     LF S  KFDSG GWPS+  
Sbjct: 6   QHLSDIQYRVTQQSATETPFKNEFWNSYQPGFYLDVVSGELLFLSEDKFDSGCGWPSFSA 65

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFDDG-PEPTGKRYCINSAALKLKPK* 156
           P       + +     M R EV     ++HLGHVF DG PE  G RYCINSAAL+   + 
Sbjct: 66  PAYARAVIEKEDRTHNMLRTEVRSRNANSHLGHVFKDGPPERGGLRYCINSAALRFVARE 125

Query: 155 EVSKGGQEGC 126
           E +     GC
Sbjct: 126 EGTALFAAGC 135



>gb:AE015700_316957 Shewanella oneidensis MR-1 section 249 of 457 of
           the complete genome.>gb:AE014299_952554 Shewanella
           oneidensis MR-1 complete genome.
          Length = 301

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 48/143 (33%), Positives = 73/143 (51%), Gaps = 1/143 (0%)
 Frame = -1

Query: 509 RLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKP 330
           +LT  + Y+  +KGTER F+G+Y+     G Y C  C TPL+ S  KF++  GWP++   
Sbjct: 3   KLTDFERYVIEEKGTERPFSGQYYQHDAKGVYLCKKCHTPLYRSEDKFNAHCGWPAFDDE 62

Query: 329 VGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFD-DGPEPTGKRYCINSAALKLKPK*E 153
           +   V   +D       R E++C+ C  HLGHVF+ +   P   R+C+NS ++  K    
Sbjct: 63  IPGAVSRHIDAD---GRRTEIVCSQCGGHLGHVFEGEFLTPKNIRHCVNSVSMLFK---- 115

Query: 152 VSKGGQEGCESVALKMYACNFPA 84
                Q+  E +A K     F A
Sbjct: 116 ----AQDEAEDIAPKHAFATFGA 134



>gb:AE016964_368502 Coxiella burnetii strain RSA 493, section 5 of 7
           of the complete genome.>gb:AE016828_1009238 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 284

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 46/106 (43%), Positives = 56/106 (52%), Gaps = 1/106 (0%)
 Frame = -1

Query: 488 YITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYKPVGNNVKS 309
           +IT  + TE AF GEY D K  G Y C  C   LF S  KF SG GWPS+   +   +K 
Sbjct: 13  HITCDQMTEPAFQGEYTDLKETGRYLCRQCGIALFRSQDKFHSGCGWPSFDATIAGTIKR 72

Query: 308 KLDLSIIFMPRQEVLCAACDAHLGHVFD-DGPEPTGKRYCINSAAL 174
             D       R E+ C  C AHLGHVF+ +   P   RYC+NS +L
Sbjct: 73  LPDPD---GQRIEIRCERCGAHLGHVFEGEALTPKNTRYCVNSLSL 115



>gb:CP000025_878996 Campylobacter jejuni RM1221, complete genome.
          Length = 119

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 45/115 (39%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = -1

Query: 512 KRLTGQQFYITRQKGTERAFTGEYWDTKTPGTYHCVCCDTPLFESSTKFDSGTGWPSYYK 333
           K L  ++  +   KGTE  F+G+Y D    G Y C  C   L++S  KF SG GWPS+  
Sbjct: 2   KELNEEEKKVILNKGTEAPFSGKYNDFYEKGIYQCKQCGASLYKSEDKFKSGCGWPSFDD 61

Query: 332 PVGNNVKSKLDLSIIFMPRQEVLCAACDAHLGHVFD-DGPEPTGKRYCINSAALK 171
            +   VK   D   I   R E++CA C+ HLGHVF+ +G      R+C+NS +L+
Sbjct: 62  EIKGAVKRIPDKDGI---RTEIVCANCNGHLGHVFEGEGFSAKNVRHCVNSISLE 113


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 864,910,570
Number of Sequences: 1806583
Number of extensions: 17765333
Number of successful extensions: 39754
Number of sequences better than 10.0: 276
Number of HSP's better than 10.0 without gapping: 38280
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39463
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 56114489496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)