BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12597
         (957 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY227203_1591057 Lotus corniculatus aldehyde dehydrogenase 1 ...   398   e-114   
pir|T02301|T02301 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2A p...   386   e-111   Nicotiana tabacum [American tobacco]
gb:AY035139_1559908 Arabidopsis thaliana putative aldehyde dehyd...   387   e-110   
pir|C86372|C86372 hypothetical protein F5O8.35 [imported] - Arab...   387   e-110   Arabidopsis thaliana [mouse-ear cress]
pir|T06683|T06683 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) T17F...   384   e-109   Arabidopsis thaliana [mouse-ear cress]
gb:AB084898_1524393 Sorghum bicolor ALDH2b mRNA for mitochondria...   380   e-108   
gb:AB084896_1524391 Secale cereale ALDH2b mRNA for mitochondrial...   377   e-108   
gb:AB055519_1521494 Hordeum vulgare mRNA for mitochondrial aldeh...   379   e-107   
pir|T03983|T03983 rf2 nuclear restorer protein - maize>gb:ZMU430...   377   e-107   Zea mays [maize]
gb:AB084897_1524392 Sorghum bicolor ALDH2a mRNA for mitochondria...   374   e-107   
gb:AF269064_1782056 Zea mays T-cytoplasm male sterility restorer...   377   e-106   
gb:AF348417_1790094 Zea mays mitochondrial aldehyde dehydrogenas...   371   e-106   
gb:AF348416_1790093 Arabidopsis thaliana mitochondrial aldehyde ...   383   e-105   
gb:AF162665_1773537 Oryza sativa aldehyde dehydrogenase (Aldh) m...   370   e-105   
gb:AB044537_1520244 Oryza sativa (japonica cultivar-group) mRNA ...   370   e-105   
gb:AB030939_1518582 Oryza sativa (japonica cultivar-group) mRNA ...   362   e-103   
gb:AP004888_1846660 Oryza sativa (japonica cultivar-group) genom...   362   e-103   
gb:AF465822S2_1802178 Allium cepa aldehyde dehydrogenase mRNA, p...   373   e-102   
gb:PSP417789_1702306 Polytomella sp. 'Pringsheim 198.80' mRNA fo...   311   3e-85   
gb:AY398308_2531838 Danio rerio clone RK063A3D05 mitochondrial a...   299   1e-82   
gb:BC067563_2554740 Danio rerio aldehyde dehydrogenase 2, mRNA (...   299   1e-82   
sp|P11884|DHAM_RAT|DHAM_RAT Aldehyde dehydrogenase, mitochondrial precurs...   299   2e-82   Rattus norvegicus [brown rat]
gb:AY566469_2086589 Rattus norvegicus mitochondrial aldehyde deh...   299   2e-82   
gb:AY566468_2086588 Rattus norvegicus mitochondrial aldehyde deh...   299   2e-82   
gb:AY566467_2086587 Rattus norvegicus mitochondrial aldehyde deh...   299   2e-82   
sp|P81178|DHAM_MESAU|DHAM_MESAU Aldehyde dehydrogenase, mitochondrial (EC 1...   299   2e-82   Mesocricetus auratus [Syrian golden hamster]
gb:AF529165_2067592 Rattus norvegicus mitochondrial aldehyde deh...   299   2e-82   
gb:AY034137_2074207 Rattus norvegicus aldehyde dehydrogenase gen...   299   2e-82   
sp|P47738|DHAM_MOUSE|DHAM_MOUSE Aldehyde dehydrogenase, mitochondrial precu...   298   5e-82   Mus musculus [mouse]
gb:BC077908_2560555 Xenopus laevis MGC80785 protein, mRNA (cDNA ...   294   1e-81   
gb:BC055244_2551323 Danio rerio zgc:63786, mRNA (cDNA clone MGC:...   298   1e-81   
gb:BT007942_2150874 Synthetic construct Homo sapiens aldehyde de...   296   2e-81   
gb:HUMALDH13_2029124 Human nucleus-encoded mitochondrial aldehyd...   296   2e-81   
gb:AY621070_1957710 Homo sapiens mitochondrial aldehyde dehydrog...   296   2e-81   
sp|P05091|DHAM_HUMAN|DHAM_HUMAN Aldehyde dehydrogenase, mitochondrial precu...   296   2e-81   Homo sapiens [man]
gb:AF260121_2483050 Danio rerio aldehyde dehydrogenase 2 precurs...   297   2e-81   
gb:CR456991_1993198 Homo sapiens full open reading frame cDNA cl...   295   2e-81   
gb:CR857362_1181605 Pongo pygmaeus mRNA; cDNA DKFZp469J1332 (fro...   294   7e-81   
sp|P20000|DHAM_BOVIN|DHAM_BOVIN Aldehyde dehydrogenase, mitochondrial precu...   292   9e-81   Bos taurus [bovine]
gb:HSALDHIR_2010484 Human mRNA for mitochondrial aldehyde dehydr...   293   1e-80   
gb:HSALDHI1_2010483 Human RNA for mitochondrial aldehyde dehydro...   293   1e-80   
pir|S00364|S00364 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2, m...   292   1e-80   Equus caballus [domestic horse]
sp|P12762|DHAM_HORSE|DHAM_HORSE Aldehyde dehydrogenase, mitochondrial (EC 1...   292   1e-80   Equus caballus [domestic horse]
gb:HUMALDH2_2029127 Human aldehyde dehydrogenase 2 mRNA.>gb:HUMA...   293   1e-80   
gb:BC075335_2558439 Xenopus tropicalis MGC89020 protein, mRNA (c...   290   3e-80   
gb:AF348412_1790089 Zea mays cytosolic aldehyde dehydrogenase RF...   289   5e-80   
gb:S71509_2139106 Mus sp. aldehyde dehydrogenase AHD-M1 mRNA, co...   289   2e-79   
gb:AF348413_1790090 Zea mays cytosolic aldehyde dehydrogenase RF...   285   9e-79   
gb:BC077256_2559972 Xenopus laevis aldehyde dehydrogenase class ...   284   1e-78   
gb:AB016718_2460746 Xenopus laevis mRNA for aldehyde dehydrogena...   284   1e-78   
gb:BC076716_2559463 Xenopus laevis aldehyde dehydrogenase class ...   284   2e-78   
gb:AB016717_2460745 Xenopus laevis mRNA for aldehyde dehydrogena...   284   2e-78   
gb:AF061833_2471352 Xenopus laevis aldehyde dehydrogenase (ALDH1...   283   4e-78   
sp|P27463|DHA1_CHICK|DHA1_CHICK Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   283   6e-78   Gallus gallus [bantam]
gb:AE014134_1128355 Drosophila melanogaster chromosome 2L, compl...   285   9e-78   
gb:AB037421_1519138 Oryza sativa (japonica cultivar-group) ALDH1...   278   2e-77   
gb:AE014297_1141634 Drosophila melanogaster chromosome 3R, compl...   279   5e-76   
gb:BOVALDHYDA_1435150 Bos taurus aldehyde dehydrogenase mRNA, co...   277   7e-76   
pir|S78582|S14752 aldehyde dehydrogenase (NAD) (EC 1.2.1.3), cyt...   277   7e-76   
sp|P51977|DHA1_SHEEP|DHA1_SHEEP Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   277   7e-76   Ovis aries [domestic sheep]
sp|P48644|DHA1_BOVIN|DHA1_BOVIN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   277   7e-76   Bos taurus [bovine]
gb:BT007808_2150740 Synthetic construct Homo sapiens aldehyde de...   274   2e-75   
gb:AF003341_1875821 Homo sapiens aldehyde dehydrogenase 1 (ALDH1...   274   2e-75   
gb:CR860845_1184893 Pongo pygmaeus mRNA; cDNA DKFZp469B0514 (fro...   274   2e-75   
pir|A33371|DEHUE1 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1, c...   274   2e-75   
sp|P00352|DHA1_HUMAN|DHA1_HUMAN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   274   2e-75   Homo sapiens [man]
gb:HUMALDH1Z_2029126 Human aldehyde dehydrogenase I (ALDH-1) mRN...   274   2e-75   
sp|P15437|DHA1_HORSE|DHA1_HORSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   271   3e-75   Equus caballus [domestic horse]
gb:AF542418_1906474 Macaca fascicularis retinal dehydrogenase 1 ...   272   6e-75   
sp|Q8HYE4|DHA1_MACFA|DHA1_MACFA Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   272   6e-75   Macaca fascicularis [crab eating macaque]
sp|Q8MI17|DHA1_RABIT|DHA1_RABIT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   271   1e-74   Oryctolagus cuniculus [domestic rabbit]
sp|Q29491|DHAN_MACPR|DHAN_MACPR Aldehyde dehydrogenase, cytosolic 2 (EC 1.2...   273   4e-74   Macroscelides proboscideus
gb:AF348415_1790092 Zea mays cytosolic aldehyde dehydrogenase RF...   270   1e-73   
gb:AF348414_1790091 Zea mays cytosolic aldehyde dehydrogenase RF...   270   1e-73   
gb:AP003617_1831493 Oryza sativa (japonica cultivar-group) genom...   263   2e-73   
gb:AF246711_2060468 Mus musculus retinaldehyde dehydrogenase 3 m...   270   2e-73   
pir|JC5553|JC5553 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - ra...   267   2e-73   Rattus norvegicus [brown rat]
pir|JC4524|JC4524 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) -...   267   2e-73   Rattus norvegicus [brown rat]
sp|P51647|DHA1_RAT|DHA1_RAT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Alde...   267   2e-73   Rattus norvegicus [brown rat]
gb:AB176450_1411042 Oryctolagus cuniculus aldDH mRNA for aldehyd...   267   2e-73   
gb:BC030589_1979857 Homo sapiens aldehyde dehydrogenase 1 family...   268   2e-73   
gb:AF310252_2486808 Xenopus laevis RALDH2 mRNA, complete cds.         268   3e-73   
gb:AB015226_1864682 Homo sapiens mRNA for RALDH2, complete cds.       268   3e-73   
sp|O93344|DHAS_CHICK|DHAS_CHICK Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   268   3e-73   Gallus gallus [bantam]
sp|O94788|DHA2_HUMAN|DHA2_HUMAN Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   268   3e-73   Homo sapiens [man]
gb:AB015227_1864683 Homo sapiens mRNA for RALDH2-T, complete cds...   268   3e-73   
gb:AF434845_2065705 Rattus norvegicus aldehyde dehydrogenase 6 m...   269   5e-73   
gb:BC069274_1987897 Homo sapiens aldehyde dehydrogenase 1 family...   268   7e-73   
sp|P47895|DHA6_HUMAN|DHA6_HUMAN Aldehyde dehydrogenase 6 (EC 1.2.1.5).>pir|...   268   7e-73   Homo sapiens [man]
gb:HSM806186_2018223 Homo sapiens mRNA; cDNA DKFZp686G1675 (from...   268   7e-73   
gb:BC075704_2106719 Mus musculus aldehyde dehydrogenase family 1...   266   9e-73   
gb:AF152359_2056754 Mus musculus aldehyde dehydrogenase-6 (Aldh6...   267   9e-73   
gb:BC087227_2565084 Xenopus laevis hypothetical LOC496110, mRNA ...   266   9e-73   
sp|Q62148|DHA2_MOUSE|DHA2_MOUSE Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   266   9e-73   Mus musculus [mouse]
gb:AF152358_2477321 Gallus gallus aldehyde dehydrogenase-6 (ALDH...   266   1e-72   
gb:BC044729_2099010 Mus musculus aldehyde dehydrogenase family 1...   265   1e-72   
gb:AF253409_2060655 Mus musculus retinaldehyde dehydrogenase 3 m...   267   1e-72   
gb:AP003048_1824454 Oryza sativa (japonica cultivar-group) genom...   267   1e-72   
sp|Q63639|DHA2_RAT|DHA2_RAT Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Reti...   266   1e-72   Rattus norvegicus [brown rat]
gb:S75713_2139306 ahd-2=acetaldehyde dehydrogenase [mice, BALB/c...   265   1e-72   
gb:BC054386_2101670 Mus musculus aldehyde dehydrogenase family 1...   265   1e-72   
pir|JQ1004|JQ1004 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1 pr...   265   1e-72   Mus musculus [mouse]
sp|P24549|DHA1_MOUSE|DHA1_MOUSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   265   1e-72   Mus musculus [mouse]
gb:AF106575_1241652 Caenorhabditis elegans cosmid K04F1, complet...   265   5e-72   
pir|D88956|D88956 protein K04F1.15 [imported] - Caenorhabditis e...   265   6e-72   Caenorhabditis elegans [roundworm]
pir|D88449|D88449 protein F54D8.3 [imported] - Caenorhabditis el...   263   1e-71   Caenorhabditis elegans [roundworm]
gb:BC081884_2108130 Rattus norvegicus aldehyde dehydrogenase 1 f...   263   1e-71   
gb:U12966_1401766 Caenorhabditis elegans cosmid F54D8, complete ...   263   1e-71   
sp|Q27640|DHAL_ENCBU|DHAL_ENCBU Aldehyde dehydrogenase (EC 1.2.1.3) (Aldehy...   262   1e-71   Enchytraeus buchholzi
gb:U12966_1401767 Caenorhabditis elegans cosmid F54D8, complete ...   263   1e-71   
pir|A32616|A32616 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) PB, ...   260   2e-71   Rattus norvegicus [brown rat]
sp|P13601|DHAC_RAT|DHAC_RAT Aldehyde dehydrogenase, cytosolic 1 (EC 1.2.1...   260   2e-71   Rattus norvegicus [brown rat]
sp|P41751|DHAL_ASPNG|DHAL_ASPNG Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   260   2e-71   Aspergillus niger
gb:AB020746_1514614 Arabidopsis thaliana genomic DNA, chromosome...   263   3e-71   
gb:BT007781_2150713 Synthetic construct Homo sapiens aldehyde de...   261   6e-71   
gb:BC001619_1967717 Homo sapiens aldehyde dehydrogenase 1 family...   261   6e-71   
gb:AL135785_1918684 Human DNA sequence from clone RP11-113O24 on...   261   6e-71   
pir|A40872|A40872 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 5 pr...   261   6e-71   Homo sapiens [man]
sp|P30837|DHA5_HUMAN|DHA5_HUMAN Aldehyde dehydrogenase X, mitochondrial pre...   261   6e-71   Homo sapiens [man]
gb:AK012213_1156839 Mus musculus 11 days embryo whole body cDNA,...   260   8e-71   
gb:BC046315_2099162 Mus musculus aldehyde dehydrogenase family 1...   258   8e-71   
gb:MMU96401_2124157 Mus musculus aldehyde dehydrogenase Ahd-2-li...   258   8e-71   
gb:AF148508_1245135 Placopecten magellanicus aldehyde dehydrogen...   260   1e-70   
gb:BX294151_770628 Pirellula sp. strain 1 complete genome; segme...   265   2e-70   
gb:CSA549290_1673847 Crocus sativus mRNA for aldehyde dehydrogen...   261   3e-70   
gb:AF162770_2477781 Taeniopygia guttata class I aldehyde dehydro...   257   4e-70   
gb:CR860576_1184640 Pongo pygmaeus mRNA; cDNA DKFZp459D157 (from...   258   5e-70   
sp|P08157|DHAL_EMENI|DHAL_EMENI Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   254   9e-70   Aspergillus nidulans
sp|Q29490|DHAE_MACPR|DHAE_MACPR Aldehyde dehydrogenase, cytosolic 1 (EC 1.2...   257   2e-69   Macroscelides proboscideus
sp|Q28399|DHAE_ELEED|DHAE_ELEED Aldehyde dehydrogenase, cytosolic 1 (EC 1.2...   256   3e-69   Elephantulus edwardii [Cape long-eared elephant shrew]
gb:AF260123_1781463 Aspergillus nidulans aldehyde dehydrogenase ...   252   4e-69   
gb:AF260124_1781464 Aspergillus nidulans aldehyde dehydrogenase ...   251   1e-68   
gb:HSM800910_1185982 Homo sapiens mRNA; cDNA DKFZp434N221 (from ...   261   1e-68   
gb:AF339837_2488543 Danio rerio retinaldehyde dehydrogenase type...   251   2e-68   
gb:AF288764_2485043 Danio rerio retinaldehyde dehydrogenase 2 (r...   251   2e-68   
gb:AF260125_1781465 Aspergillus nidulans aldehyde dehydrogenase ...   250   2e-68   
gb:AF315691_2487173 Danio rerio aldehyde dehydrogenase 1A2 mRNA,...   250   3e-68   
sp|P40108|DHAL_CLAHE|DHAL_CLAHE Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   249   1e-67   Cladosporium herbarum
sp|O74187|DHAL_AGABI|DHAL_AGABI Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   246   5e-67   Agaricus bisporus [button mushroom]
gb:OMMOMEGCRY_1391246 Ommastrephes sloanei omega-crystallin gene...   254   2e-66   
sp|P30842|CROM_OMMSL|CROM_OMMSL Omega-crystallin.                                254   2e-66   Nototodarus sloanii [arrow squid]
gb:NCB11B23_1688984 Neurospora crassa DNA linkage group II BAC c...   244   2e-66   
sp|O14293|YF19_SCHPO|YF19_SCHPO Hypothetical aldehyde-dehydrogenase like pr...   244   3e-66   Schizosaccharomyces pombe
sp|P42041|DHAL_ALTAL|DHAL_ALTAL Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   244   4e-66   Alternaria alternata
pir|T43153|T43153 probable aldehyde dehydrogenase (NAD) (EC 1.2....   243   7e-66   Schizosaccharomyces pombe
gb:AF275347_1782534 Cladosporium fulvum aldehyde dehydrogenase (...   242   2e-65   
gb:BOR548846_1633873 Bixa orellana mRNA for aldehyde dehydrogena...   240   2e-64   
gb:UMU74468_1726880 Ustilago maydis cytosolic indole-3-acetaldeh...   239   2e-64   
gb:CR382131_1663463 Yarrowia lipolytica chromosome E of strain C...   239   6e-64   
sp|P46367|DHA4_YEAST|DHA4_YEAST Potassium-activated aldehyde dehydrogenase,...   239   1e-63   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382126_1658362 Kluyveromyces lactis strain NRRL Y-1140 chro...   237   1e-63   
gb:CR382123_1655809 Kluyveromyces lactis strain NRRL Y-1140 chro...   239   3e-63   
gb:HUMALDH16_2029125 Human aldehyde dehydrogenase I mRNA, partia...   234   5e-63   
gb:AE016816_1746648 Ashbya gossypii (= Eremothecium gossypii) AT...   237   2e-62   
gb:CR382139_1672150 Debaryomyces hansenii chromosome G of strain...   229   1e-61   
sp|Q25417|DHAM_LEITA|DHAM_LEITA Aldehyde dehydrogenase, mitochondrial precu...   234   2e-61   Leishmania tarentolae
gb:CR380956_1652119 Candida glabrata strain CBS138 chromosome J ...   233   2e-61   
gb:CR382138_1670689 Debaryomyces hansenii chromosome F of strain...   228   2e-61   
gb:CR382129_1661437 Yarrowia lipolytica chromosome C of strain C...   230   2e-61   
gb:CR380950_1649933 Candida glabrata strain CBS138 chromosome D ...   232   3e-61   
pir|A46725|A46725 omega-crystallin - giant octopus>gb:OCTOMEGCRY...   236   3e-61   Enteroctopus dofleini [giant octopus]
sp|P30841|CROM_OCTDO|CROM_OCTDO Omega-crystallin.                                236   3e-61   
gb:BST458323_751290 Geobacillus stearothermophilus partial aldh ...   231   5e-61   
sp|P40047|DHA5_YEAST|DHA5_YEAST Aldehyde dehydrogenase, mitochondrial precu...   231   1e-60   Saccharomyces cerevisiae [brewer's yeast]
gb:AE016817_1747800 Ashbya gossypii (= Eremothecium gossypii) AT...   231   1e-60   
gb:AE017346_1757528 Cryptococcus neoformans var. neoformans JEC2...   226   3e-60   
pir|S50576|S50576 probable aldehyde dehydrogenase (NAD) (EC 1.2....   228   7e-60   Saccharomyces cerevisiae [brewer's yeast]
sp|P32872|DHAY_YEAST|DHAY_YEAST Aldehyde dehydrogenase 2, mitochondrial pre...   218   6e-59   Saccharomyces cerevisiae [brewer's yeast]
gb:AY829749_1180148 Lonomia obliqua hypothetical protein 10 mRNA...   228   1e-58   
gb:AY550122_1613293 Saussurea medusa cytosolic aldehyde dehydrog...   228   1e-58   
pir|H69614|H69614 aldehyde dehydrogenase dhaS - Bacillus subtili...   223   2e-58   Bacillus subtilis
gb:AE017344_1756162 Cryptococcus neoformans var. neoformans JEC2...   220   3e-58   
gb:AE017007_377739 Bacillus cereus ATCC 14579 section 10 of 18 o...   223   4e-58   
gb:AE017333_448092 Bacillus licheniformis DSM 13, complete genom...   220   2e-57   
gb:CR382132_1665124 Yarrowia lipolytica chromosome F of strain C...   216   7e-57   
gb:AP006627_562374 Bacillus clausii KSM-K16 DNA, complete genome.     216   1e-56   
gb:AE017033_382905 Bacillus anthracis str. Ames section 10 of 18...   217   2e-56   
gb:CP000001_853165 Bacillus cereus ZK, complete genome.               217   2e-56   
gb:BA000040_735867 Bradyrhizobium japonicum USDA 110 DNA, comple...   215   3e-56   
pir|AH3424|AH3424 betaine aldehyde dehydrogenase (EC 1.2.1.8) [i...   216   3e-56   Brucella melitensis
pir|C83717|C83717 NADP-dependent aldehyde dehydrogenase dhaS [im...   215   3e-56   Bacillus halodurans
gb:AE014291_307995 Brucella suis 1330 chromosome I, complete seq...   216   3e-56   
gb:AE017355_463892 Bacillus thuringiensis serovar konkukian str....   216   4e-56   
gb:AE017275_424773 Bacillus cereus ATCC 10987, section 12 of 18 ...   215   4e-56   
gb:AE017035_383607 Bacillus anthracis str. Ames section 12 of 18...   214   4e-56   
gb:AB047106_7074 Bacillus thermoleovorans Bt-adh, Bt-aldh, ORF-X...   215   6e-56   
gb:AE017273_424071 Bacillus cereus ATCC 10987, section 10 of 18 ...   215   8e-56   
gb:AE017009_378445 Bacillus cereus ATCC 14579 section 12 of 18 o...   214   8e-56   
gb:BA000040_734582 Bradyrhizobium japonicum USDA 110 DNA, comple...   213   1e-55   
gb:BA000043_739349 Geobacillus kaustophilus HTA426 DNA, complete...   213   2e-55   
gb:PAU40996_1698911 Hansenula polymorpha aldehyde dehydrogenase ...   211   3e-55   
gb:CR382125_1658255 Kluyveromyces lactis strain NRRL Y-1140 chro...   206   4e-54   
gb:PPU24215_159570 Pseudomonas putida p-cymene catabolism (cym) ...   206   5e-54   
gb:AE017352_1759755 Cryptococcus neoformans var. neoformans JEC2...   203   7e-54   
gb:CR382139_1673028 Debaryomyces hansenii chromosome G of strain...   204   1e-53   
gb:BA000038_724595 Vibrio vulnificus YJ016 DNA, chromosome II, c...   202   3e-53   
gb:AE016813_339333 Vibrio vulnificus CMCP6 chromosome II section...   202   3e-53   
gb:BA000043_736776 Geobacillus kaustophilus HTA426 DNA, complete...   205   6e-53   
gb:BC048941_2099885 Mus musculus aldehyde dehydrogenase family 1...   209   8e-53   
gb:AY249529_602362 Rhodococcus ruber aldh6-adh6 operon, complete...   203   1e-52   
pir|B97460|B97460 betaine aldehyde dehydrogenase (badh) [importe...   204   1e-52   Agrobacterium fabrum str. C58
gb:CR382135_1667771 Debaryomyces hansenii chromosome C of strain...   197   2e-52   
gb:SCU56604_1710509 Saccharomyces cerevisiae cytosolic aldehyde ...   200   4e-52   
pir|S60929|S60929 probable aldehyde dehydrogenase (NAD) (EC 1.2....   200   4e-52   Saccharomyces cerevisiae [brewer's yeast]
sp|P54115|DHA6_YEAST|DHA6_YEAST Magnesium-activated aldehyde dehydrogenase,...   200   4e-52   Saccharomyces cerevisiae [brewer's yeast]
gb:BA000012_667762 Mesorhizobium loti MAFF303099 DNA, complete g...   201   4e-52   
gb:BX571871_788594 Photorhabdus luminescens subsp. laumondii TTO...   206   4e-52   
gb:BA000040_732036 Bradyrhizobium japonicum USDA 110 DNA, comple...   205   5e-52   
gb:AY437859_617604 Brachymonas petroleovorans cyclohexanone gene...   203   5e-52   
gb:AB024945_4167 Alcaligenes faecalis phenanthrene degradative g...   204   1e-51   
sp|P54114|DHA3_YEAST|DHA3_YEAST Aldehyde dehydrogenase [NAD(P)+] 2 (EC 1.2....   197   2e-51   Saccharomyces cerevisiae [brewer's yeast]
gb:PSP296087_161296 Pseudonocardia sp. K1 ORF y, thmS gene, thma...   198   2e-51   
sp|P54222|DHAB_RHIME|DHAB_RHIME Betaine aldehyde dehydrogenase (EC 1.2.1.8)...   200   2e-51   Sinorhizobium meliloti
gb:AE006189_216418 Pasteurella multocida subsp. multocida str. P...   201   2e-51   
gb:BA000032_709653 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   200   2e-51   
gb:AE016947_364380 Enterococcus faecalis V583, section 1 of 11 o...   203   2e-51   
gb:BC034531_2097679 Mus musculus RIKEN cDNA D330038I09 gene, mRN...   196   3e-51   
gb:AY351634_1601688 Brassica napus betaine aldehyde dehydrogenas...   198   3e-51   
gb:BC082822_2562898 Xenopus tropicalis hypothetical LOC496436, m...   203   4e-51   
gb:AE016787_332879 Pseudomonas putida KT2440 section 14 of 21 of...   199   4e-51   
gb:DDU70317_1377411 Dictyostelium discoideum HydA (hydA) gene, p...   202   6e-51   
gb:CR543861_102996 Acinetobacter sp. ADP1 complete genome.            196   7e-51   
sp|P47771|DHA2_YEAST|DHA2_YEAST Aldehyde dehydrogenase [NAD(P)+] 1 (EC 1.2....   194   9e-51   Saccharomyces cerevisiae [brewer's yeast]
gb:BX640417_806704 Bordetella pertussis strain Tohama I, complet...   197   9e-51   
sp|P28237|DHAB_BETVU|DHAB_BETVU Betaine-aldehyde dehydrogenase, chloroplast...   194   1e-50   Beta vulgaris [beet]
gb:BX640430_810674 Bordetella parapertussis strain 12822, comple...   197   1e-50   
gb:RMU39940_166496 Sinorhizobium meliloti bet operon, complete s...   197   1e-50   
gb:AY596297_631726 Haloarcula marismortui ATCC 43049 chromosome ...   199   1e-50   
pir|T31265|T31265 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - Sp...   199   2e-50   Novosphingobium aromaticivorans
gb:BVBADHD_1643071 B.vulgaris mRNA for salt-inducible betaine al...   194   2e-50   
pir|T51172|T51172 betaine-aldehyde dehydrogenase (EC 1.2.1.8) [i...   194   2e-50   Amaranthus hypochondriacus [prince's feather]
gb:BT011186_1357793 Drosophila melanogaster RE12154 full insert ...   195   3e-50   
gb:AE014134_1130036 Drosophila melanogaster chromosome 2L, compl...   195   3e-50   
pir|T50272|T50272 probable aldehyde dehydrogenase [imported] - f...   190   3e-50   Schizosaccharomyces pombe
gb:BA000012_671964 Mesorhizobium loti MAFF303099 DNA, complete g...   196   3e-50   
gb:CR857124_1181376 Pongo pygmaeus mRNA; cDNA DKFZp469I2021 (fro...   193   4e-50   
gb:CR858605_1182772 Pongo pygmaeus mRNA; cDNA DKFZp469C068 (from...   193   4e-50   
gb:AE016793_334442 Pseudomonas putida KT2440 section 20 of 21 of...   193   6e-50   
pir|S70189|S54615 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) 2...   191   7e-50   
gb:BC089101_2110709 Rattus norvegicus formyltetrahydrofolate deh...   192   9e-50   
pir|A23709|A60560 formyltetrahydrofolate dehydrogenase (EC 1.5.1...   192   9e-50   
sp|P28037|FTDH_RAT|FTDH_RAT 10-formyltetrahydrofolate dehydrogenase (EC 1...   192   9e-50   Rattus norvegicus [brown rat]
sp|O75891|FTDH_HUMAN|FTDH_HUMAN 10-formyltetrahydrofolate dehydrogenase (EC...   191   9e-50   Homo sapiens [man]
gb:CR380952_1650556 Candida glabrata strain CBS138 chromosome F ...   190   1e-49   
gb:AF170094_1774243 Avicennia marina betaine aldehyde dehydrogen...   191   1e-49   
gb:CR380954_1651278 Candida glabrata strain CBS138 chromosome H ...   192   1e-49   
gb:BC024055_2094353 Mus musculus formyltetrahydrofolate dehydrog...   192   1e-49   
sp|Q8R0Y6|FTDH_MOUSE|FTDH_MOUSE 10-formyltetrahydrofolate dehydrogenase (EC...   191   2e-49   Mus musculus [mouse]
gb:AB043539_1520004 Avicennia marina mRNA for betaine aldehyde d...   191   2e-49   
sp|P42757|DHAB_ATRHO|DHAB_ATRHO Betaine-aldehyde dehydrogenase, chloroplast...   191   2e-49   Atriplex hortensis
gb:CR749807_1181269 Homo sapiens mRNA; cDNA DKFZp781N0997 (from ...   191   2e-49   
pir|T13006|T13006 betaine aldehyde dehydrogenase homolog T24C20....   192   2e-49   Arabidopsis thaliana [mouse-ear cress]
pir|H83131|H83131 5-carboxy-2-hydroxymuconate semialdehyde dehyd...   196   2e-49   Pseudomonas aeruginosa
gb:AX358538_1466223 Sequence 1 from Patent WO0200863.>gb:AX35854...   197   3e-49   
gb:AF359282_1791009 Suaeda liaotungensis betaine aldehyde dehydr...   190   3e-49   
gb:BX950851_840487 Erwinia carotovora subsp. atroseptica SCRI104...   191   3e-49   
sp|Q9S795|DHAB_ARATH|DHAB_ARATH Betaine-aldehyde dehydrogenase, chloroplast...   192   4e-49   Arabidopsis thaliana [mouse-ear cress]
gb:AY256971_1593228 Atriplex triangularis betaine aldehyde dehyd...   189   4e-49   
gb:AY083902_1569264 Atriplex prostrata betaine aldehyde dehydrog...   189   4e-49   
gb:ECU73857_134515 Escherichia coli chromosome minutes 6-8.           190   4e-49   
pir|S15181|S15181 betaine-aldehyde dehydrogenase (EC 1.2.1.8) - ...   190   4e-49   Escherichia coli K-12
sp|P17445|DHAB_ECOLI|DHAB_ECOLI Betaine aldehyde dehydrogenase (EC 1.2.1.8)...   190   4e-49   Escherichia coli [E. coli]
gb:AY083903_1569265 Atriplex prostrata betaine aldehyde dehydrog...   189   4e-49   
gb:AY156694_1585396 Spinacia oleracea betaine aldehyde dehydroge...   189   5e-49   
sp|P17202|DHAB_SPIOL|DHAB_SPIOL Betaine-aldehyde dehydrogenase, chloroplast...   189   5e-49   Spinacia oleracea
gb:BC074019_2106657 Rattus norvegicus aldehyde dehydrogenase fam...   189   6e-49   
gb:AF170918_2057678 Rattus norvegicus 4-trimethylaminobutyraldeh...   189   6e-49   
pir|F82973|F82973 betaine aldehyde dehydrogenase PA5373 [importe...   189   8e-49   Pseudomonas aeruginosa
gb:BX571966_794613 Burkholderia pseudomallei strain K96243, chro...   189   8e-49   
gb:SSU65001_191881 Sphingomonas sp. putative insertion sequence ...   193   1e-48   
gb:AY804192_1628642 Chorispora bungeana betaine-aldehyde dehydro...   190   1e-48   
gb:AY093682_1575361 Atriplex centralasiatica betaine aldehyde de...   188   1e-48   
pir|T51173|T51173 betaine-aldehyde dehydrogenase (EC 1.2.1.8) [i...   188   1e-48   Spinacia oleracea
gb:AE016857_349897 Pseudomonas syringae pv. tomato str. DC3000 s...   189   1e-48   
gb:AE016756_324482 Escherichia coli CFT073 section 2 of 18 of th...   188   1e-48   
gb:AY249530_602364 Rhodococcus ruber aldh7-adh7 operon, partial ...   187   1e-48   
gb:AY461804_1607488 Gossypium hirsutum betaine-aldehyde dehydrog...   189   2e-48   
gb:CP000011_868215 Burkholderia mallei ATCC 23344 chromosome 2, ...   188   2e-48   
gb:BC073490_2557326 Xenopus laevis MGC81015 protein, mRNA (cDNA ...   194   2e-48   
sp|O04895|DHAB_AMAHP|DHAB_AMAHP Betaine-aldehyde dehydrogenase, chloroplast...   187   2e-48   
gb:ECOBETB_128179 E.coli betaine aldehyde dehydrogenase (betB) g...   187   2e-48   
gb:ECOBETB_128178 E.coli betaine aldehyde dehydrogenase (betB) g...   187   2e-48   
pir|F90673|F90673 NAD+-dependent betaine aldehyde dehydrogenase ...   187   2e-48   
gb:HEL238780_136883 Halomonas elongata betI, betB and betA genes...   188   2e-48   
pir|B85524|B85524 NAD+-dependent betaine aldehyde dehydrogenase ...   187   3e-48   
gb:AB126616_15479 Geobacillus stearothermophilus genomic DNA, cl...   190   3e-48   
gb:AE010557_264351 Fusobacterium nucleatum subsp. nucleatum ATCC...   192   4e-48   
gb:BX571966_793717 Burkholderia pseudomallei strain K96243, chro...   186   5e-48   
gb:AY310913_1598154 Panax ginseng betaine aldehyde dehydrogenase...   185   7e-48   
gb:CP000031_84156 Silicibacter pomeroyi DSS-3, complete genome.       189   7e-48   
gb:AY596298_634759 Haloarcula marismortui ATCC 43049 chromosome ...   189   9e-48   
gb:AF170919_2057679 Mus musculus 4-trimethylaminobutyraldehyde d...   185   9e-48   
gb:AE016917_356980 Chromobacterium violaceum ATCC 12472 section ...   187   9e-48   
pir|E75574|E75574 aldehyde dehydrogenase - Deinococcus radiodura...   192   1e-47   
gb:AL451074_1928161 Human DNA sequence from clone RP11-466F5 on ...   183   2e-47   
gb:CR859849_1183951 Pongo pygmaeus mRNA; cDNA DKFZp469P0834 (fro...   183   2e-47   
gb:AB161708_1528570 Zoysia tenuifolia mRNA for betaine aldehyde ...   185   2e-47   
gb:AE016783_331913 Pseudomonas putida KT2440 section 10 of 21 of...   190   2e-47   
gb:AF172093_1887609 Homo sapiens 4-trimethylaminobutyraldehyde d...   183   2e-47   
sp|P49189|DHAG_HUMAN|DHAG_HUMAN Aldehyde dehydrogenase, E3 isozyme (EC 1.2....   183   2e-47   
gb:HSU50203_2024634 Human aldehyde dehydrogenase E3' mRNA, parti...   183   2e-47   
gb:HSALDH_2010482 H.sapiens mRNA for aldehyde dehydrogenase (usi...   183   2e-47   
pir|T20866|T20866 hypothetical protein F36H1.6 - Caenorhabditis ...   182   2e-47   
gb:BX571857_782354 Staphylococcus aureus strain MSSA476, complet...   189   2e-47   
gb:BX571856_779640 Staphylococcus aureus subsp. aureus strain MR...   189   2e-47   
pir|C89778|C89778 hypothetical protein aldA [imported] - Staphyl...   189   2e-47   
gb:BC066668_2554508 Danio rerio aldehyde dehydrogenase 9 family,...   190   3e-47   
gb:BC045932_2549446 Danio rerio aldehyde dehydrogenase 9 family,...   190   3e-47   
gb:AB063179_1522204 Hordeum vulgare BBD1 mRNA for betaine aldehy...   184   3e-47   
gb:AY093684_1575363 Atriplex centralasiatica betaine aldehyde de...   183   3e-47   
gb:AB183715_1529317 Leymus chinensis LcBADH1 mRNA for betaine al...   184   4e-47   
gb:CR382130_1662634 Yarrowia lipolytica chromosome D of strain C...   189   5e-47   
gb:AB063178_1522203 Hordeum vulgare BBD2 mRNA for betaine aldehy...   182   6e-47   
gb:AF416331_509260 Ruegeria sp. PR1b plasmid pSD25, complete seq...   186   6e-47   
pir|B95411|B95411 probable aldehyde [imported] - Sinorhizobium m...   186   6e-47   
gb:AP006618_557598 Nocardia farcinica IFM 10152 DNA, complete ge...   180   7e-47   
gb:AY050316_1562095 Triticum aestivum betaine-aldehyde dehydroge...   182   7e-47   
sp|Q9ZA11|DHAL_RHORU|DHAL_RHORU Aldehyde dehydrogenase (EC 1.2.1.3).>gb:AB0...   181   9e-47   
gb:PSA315852_1701971 Pisum sativum mRNA for aminoaldehyde dehydr...   183   9e-47   
gb:AB161711_1528573 Zoysia tenuifolia mRNA for betaine aldehyde ...   183   9e-47   
gb:AB161706_1528568 Zoysia tenuifolia mRNA for betaine aldehyde ...   183   9e-47   
gb:AB161702_1528564 Zoysia tenuifolia mRNA for betaine aldehyde ...   183   9e-47   
gb:AB043540_1520005 Avicennia marina mRNA for betaine aldehyde d...   181   9e-47   
gb:CP000046_90333 Staphylococcus aureus subsp. aureus COL, compl...   187   9e-47   
gb:AY596298_634762 Haloarcula marismortui ATCC 43049 chromosome ...   186   1e-46   
gb:AB161704_1528566 Zoysia tenuifolia mRNA for betaine aldehyde ...   182   1e-46   
gb:AB161703_1528565 Zoysia tenuifolia mRNA for betaine aldehyde ...   182   1e-46   
gb:BA000043_739775 Geobacillus kaustophilus HTA426 DNA, complete...   181   2e-46   
gb:AF073359_476369 Pseudomonas sp. DJ77 4-hydroxy-2-ketovalerate...   186   2e-46   
gb:AE011702_275679 Xanthomonas axonopodis pv. citri str. 306, se...   181   2e-46   
gb:AY829763_1180162 Lonomia obliqua hypothetical protein 9 mRNA,...   187   2e-46   
gb:BX640445_815294 Bordetella bronchiseptica strain RB50, comple...   183   2e-46   
gb:BX640427_809823 Bordetella parapertussis strain 12822, comple...   182   3e-46   
gb:AP006627_563303 Bacillus clausii KSM-K16 DNA, complete genome.     183   3e-46   
gb:BX640439_813390 Bordetella bronchiseptica strain RB50, comple...   181   3e-46   
gb:AB161709_1528571 Zoysia tenuifolia mRNA for betaine aldehyde ...   181   3e-46   
gb:AE017233_412363 Mycobacterium avium subsp. paratuberculosis s...   179   4e-46   
gb:AB161712_1528574 Zoysia tenuifolia mRNA for betaine aldehyde ...   181   4e-46   
gb:BA000012_668319 Mesorhizobium loti MAFF303099 DNA, complete g...   186   4e-46   
gb:AB183716_1529318 Leymus chinensis LcBADH2 mRNA for betaine al...   182   5e-46   
gb:CP000002_858867 Bacillus licheniformis ATCC 14580, complete g...   183   5e-46   
gb:AE016819_1748637 Ashbya gossypii (= Eremothecium gossypii) AT...   179   5e-46   
gb:AE017333_449068 Bacillus licheniformis DSM 13, complete genome.    183   5e-46   
gb:AY188952_1588372 Hordeum brevisubulatum betaine aldehyde dehy...   180   6e-46   
sp|P71016|DHAB_BACSU|DHAB_BACSU Betaine aldehyde dehydrogenase (EC 1.2.1.8)...   183   6e-46   
gb:AF031161_470949 Pseudomonas sp. VLB120 styrene degradation ge...   186   8e-46   
gb:PSSTYCATA_161537 Pseudomonas sp. Y2 DNA for styrene catabolis...   186   8e-46   
gb:PFSTYABCD_158058 P.fluorescens styA, styB, styC and styD genes.    186   8e-46   
pir|AD0143|AD0143 betaine aldehyde dehydrogenase (EC 1.2.1.8) [i...   179   8e-46   
gb:AE012458_282629 Xanthomonas campestris pv. campestris str. AT...   179   8e-46   
gb:EC4HPADNA_124770 E.coli hpa[G,R,E,D,F,H,I,X,A,B,C] genes.          182   8e-46   
gb:AE015880_318784 Shewanella oneidensis MR-1 section 429 of 457...   182   1e-45   
pir|A83735|A83735 aldehyde dehydrogenase aldA [imported] - Bacil...   177   1e-45   
gb:PSA315853_1701972 Pisum sativum mRNA for putative aminoaldehy...   179   1e-45   
gb:AE015786_317828 Shewanella oneidensis MR-1 section 335 of 457...   181   1e-45   
gb:CP000026_76552 Salmonella enterica subsp. enterica serovar Pa...   181   1e-45   
gb:BA000043_738577 Geobacillus kaustophilus HTA426 DNA, complete...   180   1e-45   
pir|C83675|C83675 glycine betaine aldehyde dehydrogenase gbsA [i...   180   1e-45   
gb:CR382124_1656769 Kluyveromyces lactis strain NRRL Y-1140 chro...   177   2e-45   
gb:AB161707_1528569 Zoysia tenuifolia mRNA for betaine aldehyde ...   178   2e-45   
sp|O24174|DHAB_ORYSA|DHAB_ORYSA Betaine-aldehyde dehydrogenase (EC 1.2.1.8)...   178   2e-45   
pir|H83136|H83136 probable aldehyde dehydrogenase PA4073 [import...   183   2e-45   
gb:BX936398_835841 Yersinia pseudotuberculosis IP32953 genome, c...   178   2e-45   
gb:AK124908_1915760 Homo sapiens cDNA FLJ42918 fis, clone BRHIP3...   177   3e-45   
gb:BA000030_701233 Streptomyces avermitilis MA-4680 genomic DNA,...   183   4e-45   
gb:SCO939121_178585 Streptomyces coelicolor A3(2) complete genom...   183   4e-45   
gb:CP000010_866804 Burkholderia mallei ATCC 23344 chromosome 1, ...   182   4e-45   
gb:BX571965_789822 Burkholderia pseudomallei strain K96243, chro...   182   4e-45   
gb:AE016827_343180 Mannheimia succiniciproducens MBEL55E, comple...   183   4e-45   
pir|A82276|A82276 aldehyde dehydrogenase VC0819 [imported] - Vib...   178   5e-45   
gb:BA000045_741579 Gloeobacter violaceus PCC 7421 DNA, complete ...   176   5e-45   
sp|P23240|DHAL_VIBCH|DHAL_VIBCH Aldehyde dehydrogenase (EC 1.2.1.3).>pir|T0...   178   5e-45   
gb:AP006618_559391 Nocardia farcinica IFM 10152 DNA, complete ge...   176   5e-45   
gb:AB096083_1525453 Oryza sativa (japonica cultivar-group) BADH2...   177   5e-45   
gb:CP000029_82668 Staphylococcus epidermidis RP62A, complete gen...   182   6e-45   
gb:AE005674_73967 Shigella flexneri 2a str. 301, complete genome...   179   6e-45   
gb:AP006627_564137 Bacillus clausii KSM-K16 DNA, complete genome.     173   8e-45   
gb:AE016914_356183 Chromobacterium violaceum ATCC 12472 section ...   173   8e-45   
gb:AE017271_423374 Bacillus cereus ATCC 10987, section 8 of 18 o...   179   8e-45   
gb:CP000011_868407 Burkholderia mallei ATCC 23344 chromosome 2, ...   178   8e-45   
sp|P56533|DHAB_GADCA|DHAB_GADCA Betaine aldehyde dehydrogenase (EC 1.2.1.8)...   182   8e-45   
gb:AB023640_3973 Petroleum-degrading bacterium HD-1 gene for ald...   174   1e-44   
gb:AY596296_631510 Haloarcula marismortui ATCC 43049 plasmid pNG...   176   1e-44   
pir|C87638|C87638 aldehyde dehydrogenase [imported] - Caulobacte...   173   1e-44   
gb:BA000028_696921 Oceanobacillus iheyensis HTE831 DNA, complete...   174   2e-44   
gb:BX571966_793942 Burkholderia pseudomallei strain K96243, chro...   177   2e-44   
gb:AB011837_1851 Bacillus halodurans C-125 genomic DNA, clone AL...   176   2e-44   
pir|E97626|E97626 chloroacetaldehyde dehydrogenase (AF029733) [i...   178   3e-44   
gb:BC044080_2548475 Xenopus laevis similar to aldehyde dehydroge...   172   3e-44   
pir|AG2849|AG2849 aldehyde dehydrogenase aldA [imported] - Agrob...   178   3e-44   
gb:BA000043_737307 Geobacillus kaustophilus HTA426 DNA, complete...   173   3e-44   
gb:AE016793_334657 Pseudomonas putida KT2440 section 20 of 21 of...   177   3e-44   
gb:CR628337_113487 Legionella pneumophila str. Lens complete gen...   176   3e-44   
gb:BA000012_671178 Mesorhizobium loti MAFF303099 DNA, complete g...   172   4e-44   
gb:AY328003S2_609759 Symbiont bacterium of Paederus fuscipes put...   176   4e-44   
pir|C83617|C83617 probable aldehyde dehydrogenase PA0219 [import...   174   4e-44   
gb:BA000031_707163 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   175   5e-44   
gb:AE017354_458631 Legionella pneumophila subsp. pneumophila str...   175   5e-44   
gb:BX936398_836283 Yersinia pseudotuberculosis IP32953 genome, c...   174   5e-44   
sp|Q9RYG9|DHAL_DEIRA|DHAL_DEIRA Aldehyde dehydrogenase (EC 1.2.1.3).>pir|H7...   171   7e-44   
gb:D86622_120853 Gluconobacter oxydans DNA for L-sorbosone dehyd...   175   7e-44   
gb:BA000040_732136 Bradyrhizobium japonicum USDA 110 DNA, comple...   179   7e-44   
gb:BA000012_669648 Mesorhizobium loti MAFF303099 DNA, complete g...   178   9e-44   
gb:AE016865_352087 Pseudomonas syringae pv. tomato str. DC3000 s...   177   9e-44   
gb:BX571862_785847 Photorhabdus luminescens subsp. laumondii TTO...   176   9e-44   
sp|Q40024|DHAB_HORVU|DHAB_HORVU Betaine-aldehyde dehydrogenase (EC 1.2.1.8)...   172   1e-43   
gb:AF346500_503282 Photorhabdus luminescens strain W14 toxin com...   176   1e-43   
gb:CR628336_110420 Legionella pneumophila str. Paris complete ge...   174   1e-43   
gb:BA000012_670479 Mesorhizobium loti MAFF303099 DNA, complete g...   178   1e-43   
pir|F95358|F95358 probable aldehyde [imported] - Sinorhizobium m...   175   2e-43   
pir|B82981|B82981 probable aldehyde dehydrogenase PA5312 [import...   174   2e-43   
gb:KPAJ0054_139232 Klebsiella pneumoniae hpaC, hpaB, hpaD, hpaE ...   174   2e-43   
gb:MLO672115_148736 Mesorhizobium loti R7A symbiosis island; seg...   177   2e-43   
sp|P46368|DHA2_ALCEU|DHA2_ALCEU Acetaldehyde dehydrogenase II (EC 1.2.1.3) ...   169   3e-43   
gb:AE016783_332011 Pseudomonas putida KT2440 section 10 of 21 of...   172   3e-43   
gb:CP000032_87994 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...   173   3e-43   
gb:AE012104_279376 Xanthomonas campestris pv. campestris str. AT...   169   4e-43   
gb:AE017241_414657 Mycobacterium avium subsp. paratuberculosis s...   169   4e-43   
gb:BC075121_2558235 Xenopus tropicalis aldehyde dehydrogenase 9 ...   168   4e-43   
gb:BX640444_815037 Bordetella bronchiseptica strain RB50, comple...   171   6e-43   
gb:BA000038_725429 Vibrio vulnificus YJ016 DNA, chromosome II, c...   173   6e-43   
gb:AE016811_338581 Vibrio vulnificus CMCP6 chromosome II section...   173   6e-43   
gb:AE016911_355354 Chromobacterium violaceum ATCC 12472 section ...   168   6e-43   
gb:AE016787_333060 Pseudomonas putida KT2440 section 14 of 21 of...   175   6e-43   
gb:AE011636_275092 Xanthomonas axonopodis pv. citri str. 306, se...   168   8e-43   
gb:AE008870_245311 Salmonella typhimurium LT2, section 174 of 22...   168   1e-42   
gb:AE016856_349558 Pseudomonas syringae pv. tomato str. DC3000 s...   171   1e-42   
gb:AY651063_1620163 Musa acuminata betaine-aldehyde dehydrogenas...   169   1e-42   
gb:BX640427_809577 Bordetella parapertussis strain 12822, comple...   171   1e-42   
gb:CP000026_78219 Salmonella enterica subsp. enterica serovar Pa...   168   1e-42   
gb:BA000043_739605 Geobacillus kaustophilus HTA426 DNA, complete...   173   1e-42   
gb:AF029733_470670 Xanthobacter autotrophicus linear plasmid pXA...   167   2e-42   
gb:AF440524_511253 Pseudomonas aeruginosa strain SG17M genomic s...   167   2e-42   
gb:BX571965_793170 Burkholderia pseudomallei strain K96243, chro...   166   2e-42   
sp|Q9RJZ6|DHAL_STRCO|DHAL_STRCO Probable aldehyde dehydrogenase (EC 1.2.1.3...   164   2e-42   
gb:CR382124_1656770 Kluyveromyces lactis strain NRRL Y-1140 chro...   168   2e-42   
pir|C95948|C95948 probable succinate-semialdehyde dehydrogenase ...   172   2e-42   
gb:BX572594_800077 Rhodopseudomonas palustris CGA009 complete ge...   174   2e-42   
pir|AF0977|AF0977 lactaldehyde dehydrogenase (EC 1.2.1.22) - Sal...   167   3e-42   
gb:BA000043_738614 Geobacillus kaustophilus HTA426 DNA, complete...   169   3e-42   
gb:AE014291_307661 Brucella suis 1330 chromosome I, complete seq...   166   3e-42   
gb:AE016999_375353 Bacillus cereus ATCC 14579 section 2 of 18 of...   171   3e-42   
gb:BX950851_838851 Erwinia carotovora subsp. atroseptica SCRI104...   166   4e-42   
pir|AE3470|AE3470 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) [imp...   166   4e-42   
gb:BC047176_2549840 Danio rerio aldehyde dehydrogenase 9 family,...   169   5e-42   
gb:BX640417_806563 Bordetella pertussis strain Tohama I, complet...   168   5e-42   
gb:AY596486_1616751 Helicosporidium sp. ex Simulium jonesii plas...   173   5e-42   
gb:AE017235_413043 Mycobacterium avium subsp. paratuberculosis s...   172   6e-42   
sp|P55653|GABD_RHISN|GABD_RHISN Probable succinate-semialdehyde dehydrogena...   172   6e-42   
gb:SME591793_187320 Sinorhizobium meliloti 1021 complete chromos...   169   8e-42   
gb:CR555306_108026 Azoarcus sp. EbN1 complete genome.                 164   8e-42   
gb:BX571966_794154 Burkholderia pseudomallei strain K96243, chro...   168   8e-42   
gb:AF144422_483031 Salmonella dublin 4-hydroxyphenylacetate cata...   172   9e-42   
gb:CR555306_106642 Azoarcus sp. EbN1 complete genome.                 165   1e-41   
gb:AB042203_6669 Acinetobacter sp. M-1 ald1 gene for aldehyde de...   165   1e-41   
pir|F98134|F98134 hypothetical protein AGR_L_75 [imported] - Agr...   168   1e-41   
pir|AE3153|AE3153 NADP-dependent aldehyde dehydrogenase Atu4849 ...   168   1e-41   
gb:AE017303_436233 Thermus thermophilus HB27 section 3 of 7 of t...   171   1e-41   
pir|D85913|D85913 succinate-semialdehyde dehydrogenase [imported...   169   1e-41   
gb:BA000037_722415 Vibrio vulnificus YJ016 DNA, chromosome I, co...   169   1e-41   
sp|Q94688|DHA9_POLMI|DHA9_POLMI Aldehyde dehydrogenase 9 (EC 1.2.1.3) (PM-A...   162   1e-41   
gb:AE014291_309449 Brucella suis 1330 chromosome I, complete seq...   168   2e-41   
pir|AC3255|AC3255 l-sorbosone dehydrogenase, NAD(P) dependent (E...   168   2e-41   
gb:CP000011_868558 Burkholderia mallei ATCC 23344 chromosome 2, ...   167   2e-41   
pir|T16352|T16352 hypothetical protein F42G9.5 - Caenorhabditis ...   163   2e-41   
gb:AF029734_470673 Xanthobacter autotrophicus transcriptional ac...   163   2e-41   
gb:U00051_1401533 Caenorhabditis elegans cosmid F42G9, complete ...   163   2e-41   
gb:SME591790_186369 Sinorhizobium meliloti 1021 complete chromos...   163   2e-41   
gb:CP000002_859555 Bacillus licheniformis ATCC 14580, complete g...   171   2e-41   
gb:AE017333_449769 Bacillus licheniformis DSM 13, complete genome.    171   2e-41   
gb:AE013224_290378 Methanosarcina mazei strain Goe1, section 6 o...   169   2e-41   
sp|O53743|DHAL_MYCTU|DHAL_MYCTU Probable aldehyde dehydrogenase (EC 1.2.1.3...   162   3e-41   
gb:AP006618_559173 Nocardia farcinica IFM 10152 DNA, complete ge...   168   3e-41   
gb:AB085823_11261 Cytophaga sp. KUC-1 alddh gene for aldehyde de...   163   3e-41   
gb:AE015571_315682 Shewanella oneidensis MR-1 section 120 of 457...   168   3e-41   
gb:CP000001_850928 Bacillus cereus ZK, complete genome.               168   3e-41   
gb:AE016768_328382 Escherichia coli CFT073 section 14 of 18 of t...   163   4e-41   
gb:BA000028_697256 Oceanobacillus iheyensis HTE831 DNA, complete...   169   4e-41   
pir|F82152|F82152 aldehyde dehydrogenase VC1819 [imported] - Vib...   167   5e-41   
gb:BX572596_800821 Rhodopseudomonas palustris CGA009 complete ge...   163   5e-41   
gb:BA000040_733044 Bradyrhizobium japonicum USDA 110 DNA, comple...   162   5e-41   
sp|P25526|GABD_ECOLI|GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP+...   167   5e-41   
gb:BA000033_712338 Staphylococcus aureus subsp. aureus MW2 DNA, ...   166   5e-41   
gb:D90890_123964 E.coli genomic DNA, Kohara clone #443(59.8-60.2...   167   5e-41   
gb:CR543861_102985 Acinetobacter sp. ADP1 complete genome.            169   6e-41   
gb:PSP311159_161316 Pseudomonas sp. KIE171 species isopropylamin...   160   7e-41   
gb:CP000032_88154 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...   168   7e-41   
gb:AE016765_327203 Escherichia coli CFT073 section 11 of 18 of t...   166   7e-41   
gb:BX571856_781635 Staphylococcus aureus subsp. aureus strain MR...   165   7e-41   
pir|G90005|G90005 hypothetical protein SA1924 [imported] - Staph...   165   7e-41   
pir|E95276|E95276 probable aldehyde [imported] - Sinorhizobium m...   169   7e-41   
gb:AE005674_73210 Shigella flexneri 2a str. 301, complete genome...   162   9e-41   
pir|G86033|G86033 aldehyde dehydrogenase B [similarity] - Escher...   162   9e-41   
pir|S47809|S47809 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) aldB...   162   9e-41   
sp|P37685|ALDB_ECOLI|ALDB_ECOLI Aldehyde dehydrogenase B (EC 1.2.1.22) (Lac...   162   9e-41   
gb:AF284553_495613 Halomonas salina NAD+-dependent aldehyde dehy...   165   9e-41   
gb:AE017025_380602 Bacillus anthracis str. Ames section 2 of 18 ...   166   9e-41   
gb:AE016776_329986 Pseudomonas putida KT2440 section 3 of 21 of ...   164   1e-40   
gb:BA000030_705064 Streptomyces avermitilis MA-4680 genomic DNA,...   160   1e-40   
gb:AB112922_13821 Gordonia sp. TY-5 adh3 genes for alcohol dehyd...   160   2e-40   


>gb:AY227203_1591057 Lotus corniculatus aldehyde dehydrogenase 1
            precursor (Aldh1) mRNA, complete cds; nuclear gene for
            mitochondrial product.
          Length = 542

 Score =  398 bits (1023), Expect(2) = e-114
 Identities = 182/231 (78%), Positives = 215/231 (93%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEF+EK+K RA+RRV
Sbjct: 312  GKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFLEKSKKRALRRV 371

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPFKKGVEQGPQID+EQFEK+LRYI+SG ES ATLECGGDR+GSKG+++QPT+FS+V+
Sbjct: 372  VGDPFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKGFYVQPTVFSNVQ 431

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            +DM+IAQDEIFGPVQ + KFK+IDEVI+RAN+T YGLAAGV+T ++  ANTL R LRAGT
Sbjct: 432  DDMLIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLATANTLMRALRAGT 491

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VWINC+DVFDA IPFGGYKMSGIGREKG+YSL+NYLQVKAVVTPLKNPAW+
Sbjct: 492  VWINCFDVFDAAIPFGGYKMSGIGREKGIYSLHNYLQVKAVVTPLKNPAWL 542



 Score = 38.1 bits (87), Expect(2) = e-114
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPF 886
           KSNLKPVTLELGGKSPF
Sbjct: 300 KSNLKPVTLELGGKSPF 316



>pir|T02301|T02301 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2A
            precursor, mitochondrial - common
            tobacco>gb:NTALDEDEH_1691460 N.tabacum mRNA for aldehyde
            dehydrogenase.
          Length = 542

 Score =  386 bits (992), Expect(2) = e-111
 Identities = 175/231 (75%), Positives = 208/231 (90%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FI+C+DA+ID AVE AHFALFFNQGQCCCAGSRT+VHE++YDEF+EKAKARA++R 
Sbjct: 312  GKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTFVHEKVYDEFLEKAKARALKRT 371

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPFK G EQGPQIDS+QF+K++ YIRSG +SGATLE GG+R+G +GY+I+PT+FS+VK
Sbjct: 372  VGDPFKSGTEQGPQIDSKQFDKIMNYIRSGIDSGATLETGGERLGERGYYIKPTVFSNVK 431

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            +DM+IAQDEIFGPVQ +LKFKD+D+VI+RANN+ YGLAAGV+T +ID ANTL R LR GT
Sbjct: 432  DDMLIAQDEIFGPVQSILKFKDVDDVIRRANNSRYGLAAGVFTQNIDTANTLTRALRVGT 491

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NC+D FDATIPFGGYKMSG GREKG YSL NYLQVKAVVTPLKNPAW+
Sbjct: 492  VWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL 542



 Score = 38.1 bits (87), Expect(2) = e-111
 Identities = 17/17 (100%), Positives = 17/17 (100%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPF 886
           KSNLKPVTLELGGKSPF
Sbjct: 300 KSNLKPVTLELGGKSPF 316



>gb:AY035139_1559908 Arabidopsis thaliana putative aldehyde
           dehydrogenase (At1g23800) mRNA, complete
           cds.>gb:AY113912_1578323 Arabidopsis thaliana putative
           aldehyde dehydrogenase (At1g23800) mRNA, complete cds.
          Length = 534

 Score =  387 bits (995), Expect(2) = e-110
 Identities = 177/231 (76%), Positives = 209/231 (90%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G   FI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct: 304 GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRN 363

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct: 364 VGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVK 423

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GT
Sbjct: 424 DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGT 483

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           VWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct: 484 VWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL 534



 Score = 35.0 bits (79), Expect(2) = e-110
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPF 886
           KSNLK VTLELGGKSPF
Sbjct: 292 KSNLKAVTLELGGKSPF 308



>pir|C86372|C86372 hypothetical protein F5O8.35 [imported] -
           Arabidopsis thaliana>gb:AE005172_891331 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F5O8_1678445 Arabidopsis thaliana
           chromosome 1 BAC F5O8 sequence, complete sequence.
          Length = 519

 Score =  387 bits (995), Expect(2) = e-110
 Identities = 177/231 (76%), Positives = 209/231 (90%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G   FI+C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R 
Sbjct: 289 GKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRN 348

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPFK G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK
Sbjct: 349 VGDPFKSGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVK 408

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           +DM+IA DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GT
Sbjct: 409 DDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGT 468

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           VWINC+DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct: 469 VWINCFDVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL 519



 Score = 35.0 bits (79), Expect(2) = e-110
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPF 886
           KSNLK VTLELGGKSPF
Sbjct: 277 KSNLKAVTLELGGKSPF 293



>pir|T06683|T06683 aldehyde dehydrogenase (NAD) (EC 1.2.1.3)
            T17F15.130 - Arabidopsis thaliana>gb:AB030820_1518540
            Arabidopsis thaliana ALDH2 mRNA for aldehyde
            dehydrogenase, complete cds.>gb:ATT17F15_1554704
            Arabidopsis thaliana DNA chromosome 3, BAC clone
            T17F15.>gb:AY090443_1574132 Arabidopsis thaliana
            AT3g48000/T17F15_130 mRNA, complete
            cds.>gb:BT000752_1635024 Arabidopsis thaliana clone
            RAFL09-59-P10 (R19157) putative aldehyde dehydrogenase
            (NAD+) (At3g48000) mRNA, complete
            cds.>gb:BT006371_1639258 Arabidopsis thaliana
            At3g48000/T17F15_130 gene, complete
            cds.>gb:AF327426_1786795 Arabidopsis thaliana putative
            (NAD+) aldehyde dehydrogenase (At3g48000) mRNA, complete
            cds.>gb:AF349447_1790191 Arabidopsis thaliana aldehyde
            dehydrogenase AtALDH2a mRNA, complete
            cds.>gb:AF349522_1790208 Arabidopsis thaliana putative
            aldehyde dehydrogenase (NAD+) (At3g48000) mRNA, complete
            cds.>gb:AF372911_1792626 Arabidopsis thaliana
            AT3g48000/T17F15_130 mRNA, complete cds.
          Length = 538

 Score =  384 bits (986), Expect(2) = e-109
 Identities = 176/231 (76%), Positives = 209/231 (90%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FI+ +DA+ID+AVE AHFALFFNQGQCCCAGSRT+VHE++YDEFVEK+KARA++RV
Sbjct: 308  GKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKARALKRV 367

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+KG+EQGPQID +QFEKV++YI+SG ES ATLECGGD+IG KGYFIQPT+FS+VK
Sbjct: 368  VGDPFRKGIEQGPQIDLKQFEKVMKYIKSGIESNATLECGGDQIGDKGYFIQPTVFSNVK 427

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            +DM+IAQDEIFGPVQ +LKF D+DEVIKRAN T YGLAAGV+T ++D AN ++R L+AGT
Sbjct: 428  DDMLIAQDEIFGPVQSILKFSDVDEVIKRANETKYGLAAGVFTKNLDTANRVSRALKAGT 487

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NC+DVFDA IPFGGYKMSG GREKG+YSLNNYLQ+KAVVT L  PAWI
Sbjct: 488  VWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQIKAVVTALNKPAWI 538



 Score = 36.2 bits (82), Expect(2) = e-109
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSPF 886
           SNLKPVTLELGGKSPF
Sbjct: 297 SNLKPVTLELGGKSPF 312



>gb:AB084898_1524393 Sorghum bicolor ALDH2b mRNA for mitochondrial
            aldehyde dehydrogenase, complete cds.
          Length = 547

 Score =  380 bits (976), Expect(2) = e-108
 Identities = 180/231 (77%), Positives = 205/231 (88%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FII DDA+ID AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct: 317  GKSPFIIMDDADIDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV 376

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+KGVEQGPQID EQF K+LRYIRSG +SGA L  GGDR+G KGY+IQPTIFSDV+
Sbjct: 377  VGDPFRKGVEQGPQIDDEQFNKILRYIRSGVDSGANLVTGGDRLGEKGYYIQPTIFSDVQ 436

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            + M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGT
Sbjct: 437  DGMKIAQEEIFGPVQSILKFKDLNEVIKRANASPYGLAAGVFTNSLDTANTLTRALRAGT 496

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VWINC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct: 497  VWINCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL 547



 Score = 34.3 bits (77), Expect(2) = e-108
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLK VTLELGGKSPF  M
Sbjct: 305 RSNLKTVTLELGGKSPFIIM 324



>gb:AB084896_1524391 Secale cereale ALDH2b mRNA for mitochondrial
            aldehyde dehydrogenase, complete cds.
          Length = 549

 Score =  377 bits (967), Expect(2) = e-108
 Identities = 174/231 (75%), Positives = 207/231 (89%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct: 319  GKSPFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV 378

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV+
Sbjct: 379  VGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQ 438

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            + M IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT
Sbjct: 439  DGMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGT 498

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            +W+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct: 499  IWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL 549



 Score = 37.4 bits (85), Expect(2) = e-108
 Identities = 17/20 (85%), Positives = 18/20 (90%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLKPVTLELGGKSPF  M
Sbjct: 307 RSNLKPVTLELGGKSPFIVM 326



>gb:AB055519_1521494 Hordeum vulgare mRNA for mitochondrial aldehyde
            dehydrogenase ALDH2, complete cds.
          Length = 549

 Score =  379 bits (974), Expect(2) = e-107
 Identities = 175/231 (75%), Positives = 208/231 (90%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FI+ DDA+ID+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct: 319  GKSPFIVMDDADIDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV 378

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+KGVEQGPQID EQF+K+LRYI+SG +SGATL  GGD++G KGY+IQPTIFSDV+
Sbjct: 379  VGDPFRKGVEQGPQIDDEQFKKILRYIKSGVDSGATLVTGGDKLGDKGYYIQPTIFSDVQ 438

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            +DM IAQ+EIFGPVQ + KF D++EVIKRAN + YGLAAGV+T+++D ANTL R LRAGT
Sbjct: 439  DDMKIAQEEIFGPVQSIFKFNDLNEVIKRANASQYGLAAGVFTNNLDTANTLTRALRAGT 498

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            +W+NC+D+FDA IPFGGYKMSGIGREKG+ SL NYLQVKAVVT LKNPAW+
Sbjct: 499  IWVNCFDIFDAAIPFGGYKMSGIGREKGIDSLKNYLQVKAVVTALKNPAWL 549



 Score = 34.3 bits (77), Expect(2) = e-107
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLK VTLELGGKSPF  M
Sbjct: 307 RSNLKAVTLELGGKSPFIVM 326



>pir|T03983|T03983 rf2 nuclear restorer protein -
            maize>gb:ZMU43082_1732147 Zea mays T cytoplasm male
            sterility restorer factor 2 (rf2) mRNA, complete
            cds.>gb:AF215823_1777950 Zea mays T cytoplasm male
            sterility restorer factor 2 (rf2a) gene, rf2a-B73 allele,
            complete cds.
          Length = 549

 Score =  377 bits (969), Expect(2) = e-107
 Identities = 178/231 (77%), Positives = 204/231 (88%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct: 319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV 378

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+KGVEQGPQID EQF K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV+
Sbjct: 379  VGDPFRKGVEQGPQIDDEQFNKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQ 438

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            + M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGT
Sbjct: 439  DGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGT 498

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NC+DVFDA IPFGGYKMSGIGREKGV SL NYLQVKAVVTP+KN AW+
Sbjct: 499  VWVNCFDVFDAAIPFGGYKMSGIGREKGVDSLKNYLQVKAVVTPIKNAAWL 549



 Score = 35.4 bits (80), Expect(2) = e-107
 Identities = 17/20 (85%), Positives = 17/20 (85%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           KSNLK VTLELGGKSPF  M
Sbjct: 307 KSNLKTVTLELGGKSPFIIM 326



>gb:AB084897_1524392 Sorghum bicolor ALDH2a mRNA for mitochondrial
            aldehyde dehydrogenase, complete cds.
          Length = 551

 Score =  374 bits (961), Expect(2) = e-107
 Identities = 168/231 (72%), Positives = 207/231 (89%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   F++ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct: 321  GKSPFVVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV 380

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+ GVEQGPQID +QF K+LRY++SG +SGATL  GGDR+GS+G++IQPT+F+D K
Sbjct: 381  VGDPFRNGVEQGPQIDGDQFNKILRYVQSGVDSGATLVTGGDRVGSRGFYIQPTVFADAK 440

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            +DM IA++EIFGPVQ +LKF  ++EVI+RAN THYGLAAGV+T  +D ANTL+R LRAGT
Sbjct: 441  DDMKIAREEIFGPVQTILKFSGMEEVIRRANATHYGLAAGVFTRSLDAANTLSRALRAGT 500

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NCYDVFDATIPFGGYKMSG+GREKGVY+L NYLQ KAVVTP+K+PAW+
Sbjct: 501  VWVNCYDVFDATIPFGGYKMSGVGREKGVYALRNYLQTKAVVTPIKDPAWL 551



 Score = 37.4 bits (85), Expect(2) = e-107
 Identities = 17/20 (85%), Positives = 18/20 (90%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLKPVTLELGGKSPF  M
Sbjct: 309 RSNLKPVTLELGGKSPFVVM 328



>gb:AF269064_1782056 Zea mays T-cytoplasm male sterility restorer
            factor 2 (rf2) mRNA, rf2-R213 allele, complete cds;
            nuclear gene for mitochondrial product.
          Length = 549

 Score =  377 bits (968), Expect(2) = e-106
 Identities = 177/231 (76%), Positives = 205/231 (88%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++RV
Sbjct: 319  GKSSFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRV 378

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+KGVEQGPQID EQF+K+LRYIR G + GATL  GGDR+G KG++IQPTIFSDV+
Sbjct: 379  VGDPFRKGVEQGPQIDDEQFKKILRYIRYGVDGGATLVTGGDRLGDKGFYIQPTIFSDVQ 438

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            + M IAQ+EIFGPVQ +LKFKD++EVIKRAN + YGLAAGV+T+ +D ANTL R LRAGT
Sbjct: 439  DGMKIAQEEIFGPVQSILKFKDLNEVIKRANASQYGLAAGVFTNSLDTANTLTRALRAGT 498

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NC+DVFDA IPFGGYKMSG+GREKGV SL NYLQVKAVVTP+KN AW+
Sbjct: 499  VWVNCFDVFDAAIPFGGYKMSGMGREKGVDSLKNYLQVKAVVTPIKNAAWL 549



 Score = 32.3 bits (72), Expect(2) = e-106
 Identities = 16/20 (80%), Positives = 16/20 (80%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           KSNLK VTLELGGKS F  M
Sbjct: 307 KSNLKTVTLELGGKSSFIIM 326



>gb:AF348417_1790094 Zea mays mitochondrial aldehyde dehydrogenase
            RF2B (rf2b) mRNA, complete cds; nuclear gene for
            mitochondrial product.>gb:AF348418_1790095 Zea mays
            mitochondrial aldehyde dehydrogenase RF2B (rf2b) gene,
            complete cds; nuclear gene for mitochondrial product.
          Length = 550

 Score =  371 bits (953), Expect(2) = e-106
 Identities = 167/231 (72%), Positives = 205/231 (88%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FI+ DDA++D+AVE AH A+FFNQGQCCCAGSRT+VHER+YDEFVEK+KARA++RV
Sbjct: 320  GKSPFIVMDDADVDQAVELAHQAVFFNQGQCCCAGSRTFVHERVYDEFVEKSKARALKRV 379

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+ GVEQGPQID EQF K+LRY++SG +SGATL  GGDR+G +G++IQPT+F+D K
Sbjct: 380  VGDPFRDGVEQGPQIDGEQFNKILRYVQSGVDSGATLVAGGDRVGDRGFYIQPTVFADAK 439

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            ++M IA++EIFGPVQ +LKF  ++EVI+RAN T YGLAAGV+T  +D ANTL+R LRAGT
Sbjct: 440  DEMKIAREEIFGPVQTILKFSGVEEVIRRANATPYGLAAGVFTRSLDAANTLSRALRAGT 499

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NCYDVFDATIPFGGYKMSG+GREKG+Y+L NYLQ KAVVTP+KNPAW+
Sbjct: 500  VWVNCYDVFDATIPFGGYKMSGVGREKGIYALRNYLQTKAVVTPIKNPAWL 550



 Score = 37.4 bits (85), Expect(2) = e-106
 Identities = 17/20 (85%), Positives = 18/20 (90%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLKPVTLELGGKSPF  M
Sbjct: 308 RSNLKPVTLELGGKSPFIVM 327



>gb:AF348416_1790093 Arabidopsis thaliana mitochondrial aldehyde
           dehydrogenase (ALDH3) mRNA, complete cds; nuclear gene
           for mitochondrial product.
          Length = 534

 Score =  383 bits (983), Expect = e-105
 Identities = 174/225 (77%), Positives = 206/225 (91%)
 Frame = -2

Query: 881 ICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFK 702
           +C+DA++D+AVE AHFALFFNQGQCCCAGSRT+VHER+YDEFVEKAKARA++R VGDPFK
Sbjct: 310 VCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARALKRNVGDPFK 369

Query: 701 KGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIA 522
            G+EQGPQ+DSEQF K+L+YI+ G E+GATL+ GGDR+GSKGY+IQPT+FSDVK+DM+IA
Sbjct: 370 SGIEQGPQVDSEQFNKILKYIKHGVEAGATLQAGGDRLGSKGYYIQPTVFSDVKDDMLIA 429

Query: 521 QDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCY 342
            DEIFGPVQ +LKFKD+DEVI RANN+ YGLAAGV+T ++D A+ L R LR GTVWINC+
Sbjct: 430 TDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTAHRLMRALRVGTVWINCF 489

Query: 341 DVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           DV DA+IPFGGYKMSGIGREKG+YSLNNYLQVKAVVT LKNPAW+
Sbjct: 490 DVLDASIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTSLKNPAWL 534



>gb:AF162665_1773537 Oryza sativa aldehyde dehydrogenase (Aldh) mRNA,
            complete cds; nuclear gene for mitochondrial product.
          Length = 549

 Score =  370 bits (950), Expect(2) = e-105
 Identities = 174/231 (75%), Positives = 202/231 (87%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RV
Sbjct: 319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRV 378

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+
Sbjct: 379  VGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQ 438

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            ++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GT
Sbjct: 439  DNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGT 498

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct: 499  VWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL 549



 Score = 34.3 bits (77), Expect(2) = e-105
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLK VTLELGGKSPF  M
Sbjct: 307 RSNLKSVTLELGGKSPFIIM 326



>gb:AB044537_1520244 Oryza sativa (japonica cultivar-group) mRNA for
            aldehyde dehydrogenase ALDH2b, complete
            cds.>gb:AP005387_1850860 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 6, BAC
            clone:OSJNBa0084K06.
          Length = 549

 Score =  370 bits (950), Expect(2) = e-105
 Identities = 174/231 (75%), Positives = 202/231 (87%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FII DDA++D AVE AHFALFFNQGQCCCAGSRT+VHERIYDEFVEKAKARA++RV
Sbjct: 319  GKSPFIIMDDADVDHAVELAHFALFFNQGQCCCAGSRTFVHERIYDEFVEKAKARALKRV 378

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPFK GVEQGPQID EQF K+LRYI+ G +SGA L  GGDR+G KGY+IQPTIFSDV+
Sbjct: 379  VGDPFKNGVEQGPQIDDEQFNKILRYIKYGVDSGANLVTGGDRLGDKGYYIQPTIFSDVQ 438

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            ++M IAQ+EIFGPVQ +LKF D++EVIKRAN + YGLAAGV+T++++ ANTL R LR GT
Sbjct: 439  DNMRIAQEEIFGPVQSILKFNDLNEVIKRANASQYGLAAGVFTNNLNTANTLTRALRVGT 498

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+NC+DVFDA IPFGGYK SGIGREKG+ SL NYLQVKAVVTP+KN AW+
Sbjct: 499  VWVNCFDVFDAAIPFGGYKQSGIGREKGIDSLKNYLQVKAVVTPIKNAAWL 549



 Score = 34.3 bits (77), Expect(2) = e-105
 Identities = 16/20 (80%), Positives = 17/20 (85%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLK VTLELGGKSPF  M
Sbjct: 307 RSNLKSVTLELGGKSPFIIM 326



>gb:AB030939_1518582 Oryza sativa (japonica cultivar-group) mRNA for
            mitochondrial aldehyde dehydrogenase ALDH2a, complete
            cds.>gb:AP004888_1846659 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0617A09.>gb:AP005751_1857172 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0072H09.
          Length = 553

 Score =  362 bits (929), Expect(2) = e-103
 Identities = 165/231 (71%), Positives = 203/231 (87%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RV
Sbjct: 323  GKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRV 382

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+
Sbjct: 383  VGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVE 442

Query: 539  EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            ++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GT
Sbjct: 443  DEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGT 502

Query: 359  VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            VW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct: 503  VWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL 553



 Score = 37.4 bits (85), Expect(2) = e-103
 Identities = 17/20 (85%), Positives = 18/20 (90%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLKPVTLELGGKSPF  M
Sbjct: 311 RSNLKPVTLELGGKSPFIVM 330



>gb:AP004888_1846660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005751_1857173 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0072H09.
          Length = 421

 Score =  362 bits (929), Expect(2) = e-103
 Identities = 165/231 (71%), Positives = 203/231 (87%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G   FI+ DDA++D+AVE AH ALFFNQGQCCCAGSRT+VHER+YDEFVEKA+ARA++RV
Sbjct: 191 GKSPFIVMDDADVDQAVELAHRALFFNQGQCCCAGSRTFVHERVYDEFVEKARARALQRV 250

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF+ GVEQGPQID EQF+K+L+Y++SG +SGATL  GGDR GS+G++IQPT+F+DV+
Sbjct: 251 VGDPFRTGVEQGPQIDGEQFKKILQYVKSGVDSGATLVAGGDRAGSRGFYIQPTVFADVE 310

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IAQ+EIFGPVQ +LKF  ++EV++RAN T YGLAAGV+T  +D ANTLAR LR GT
Sbjct: 311 DEMKIAQEEIFGPVQSILKFSTVEEVVRRANATPYGLAAGVFTQRLDAANTLARALRVGT 370

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           VW+N YDVFDA +PFGGYKMSG+GREKGVYSL NYLQ KAVVTP+K+ AW+
Sbjct: 371 VWVNTYDVFDAAVPFGGYKMSGVGREKGVYSLRNYLQTKAVVTPIKDAAWL 421



 Score = 37.4 bits (85), Expect(2) = e-103
 Identities = 17/20 (85%), Positives = 18/20 (90%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYM 877
           +SNLKPVTLELGGKSPF  M
Sbjct: 179 RSNLKPVTLELGGKSPFIVM 198



>gb:AF465822S2_1802178 Allium cepa aldehyde dehydrogenase mRNA,
           partial cds.
          Length = 230

 Score =  373 bits (958), Expect = e-102
 Identities = 178/226 (78%), Positives = 202/226 (89%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II DDA+ID+AVE AHFALFFNQGQCCCA S T+VHE+IYDEFVEKAKARAMRRVVGDPF
Sbjct: 5   IILDDADIDQAVELAHFALFFNQGQCCCACSPTFVHEKIYDEFVEKAKARAMRRVVGDPF 64

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           KKGVEQGPQID EQF K+LRYI+ G + GA+L  GG+RIGSKGY+IQPTIFSDVK+DMVI
Sbjct: 65  KKGVEQGPQIDDEQFNKILRYIKLGVDGGASLVTGGERIGSKGYYIQPTIFSDVKDDMVI 124

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +LKF D++EVI+RAN + YGLAAGV+TS+IDKANTL R LR GTVW+NC
Sbjct: 125 AKEEIFGPVQSILKFNDLNEVIRRANASRYGLAAGVFTSNIDKANTLTRALRVGTVWVNC 184

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           +DVFDA IPFGGYKMSG GREKG+ SL  YLQ KAVVTPLKNPAW+
Sbjct: 185 FDVFDAAIPFGGYKMSGQGREKGIDSLKGYLQTKAVVTPLKNPAWL 230



>gb:PSP417789_1702306 Polytomella sp. 'Pringsheim 198.80' mRNA for
           aldehyde dehydrogenase (aldh gene).
          Length = 523

 Score =  311 bits (796), Expect(2) = 3e-85
 Identities = 140/230 (60%), Positives = 176/230 (76%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C D ++DRAV DAH ALFFN GQCC AGSR YVHE+IYDEFVEKA   A    
Sbjct: 293 GKSPIIVCPDVDVDRAVADAHMALFFNHGQCCAAGSRVYVHEKIYDEFVEKATKAAANHS 352

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    +QGPQ+D+ QF K+L Y+  GK  GA L  GG R+G+KGY++ PT+FS+V 
Sbjct: 353 VGDPFSGQYDQGPQVDNAQFSKILSYVEHGKAEGAKLNVGGCRVGNKGYYVAPTVFSNVT 412

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LK+   DEVI+RAN + YGLA+GV++ D+D  NTL RGL AGT
Sbjct: 413 DNMKIAREEIFGPVQSILKYSTFDEVIRRANASDYGLASGVFSKDLDTVNTLVRGLHAGT 472

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           VW+NCY++FD+ +PFGG+K SGIGREKG Y+L+NY +VKAV  PL NPAW
Sbjct: 473 VWVNCYNLFDSAVPFGGFKTSGIGREKGEYALSNYTKVKAVYMPLVNPAW 522



 Score = 28.1 bits (61), Expect(2) = 3e-85
 Identities = 12/18 (66%), Positives = 13/18 (72%)
 Frame = -1

Query: 942 LQKSNLKPVTLELGGKSP 889
           L    +KP TLELGGKSP
Sbjct: 279 LAAEQIKPCTLELGGKSP 296



>gb:AY398308_2531838 Danio rerio clone RK063A3D05 mitochondrial
           aldehyde dehydrogenase 2 family (ALDH2) mRNA, complete
           cds.
          Length = 516

 Score =  299 bits (766), Expect(2) = 1e-82
 Identities = 142/224 (63%), Positives = 170/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DAN++ AVE +H ALFFNQGQCCCAG+RT+V E IYDEFVE++  RA  R+VGDPF
Sbjct: 292 IILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPF 351

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ++ +QF+KVL YI SGK  GA L CGG     +GYFIQPT+F DVK+DM I
Sbjct: 352 DLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTI 411

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK ++EVI+RAN++ YGLA  V+T DIDKAN ++ GLRAGTVWINC
Sbjct: 412 AREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINC 471

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+VF    PFGGYK SGIGRE G Y L NY +VK V    P KN
Sbjct: 472 YNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKN 515



 Score = 30.8 bits (68), Expect(2) = 1e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 276 SNLKKVTLELGGKSP 290



>gb:BC067563_2554740 Danio rerio aldehyde dehydrogenase 2, mRNA
           (cDNA clone MGC:85659 IMAGE:6959916), complete cds.
          Length = 422

 Score =  299 bits (766), Expect(2) = 1e-82
 Identities = 142/224 (63%), Positives = 170/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DAN++ AVE +H ALFFNQGQCCCAG+RT+V E IYDEFVE++  RA  R+VGDPF
Sbjct: 198 IILSDANMEEAVEQSHIALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPF 257

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ++ +QF+KVL YI SGK  GA L CGG     +GYFIQPT+F DVK+DM I
Sbjct: 258 DLNTEQGPQVNEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTI 317

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK ++EVI+RAN++ YGLA  V+T DIDKAN ++ GLRAGTVWINC
Sbjct: 318 AREEIFGPVMQILKFKSLEEVIERANDSKYGLAGAVFTQDIDKANYISHGLRAGTVWINC 377

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+VF    PFGGYK SGIGRE G Y L NY +VK V    P KN
Sbjct: 378 YNVFGVQAPFGGYKASGIGREMGEYGLENYTEVKTVTIKVPEKN 421



 Score = 30.8 bits (68), Expect(2) = 1e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 182 SNLKKVTLELGGKSP 196



>sp|P11884|DHAM_RAT Aldehyde dehydrogenase, mitochondrial precursor
           (EC 1.2.1.3) (ALDH class 2) (ALDH1)
           (ALDH-E2).>pir|S03564|S03564 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial -
           rat>gb:BC062081_2104853 Rattus norvegicus aldehyde
           dehydrogenase 2, mRNA (cDNA clone MGC:72375
           IMAGE:5621229), complete cds.>gb:RNADR_2134366 Rat mRNA
           for liver mitochondrial aldehyde dehydrogenase.
          Length = 519

 Score =  299 bits (765), Expect(2) = 2e-82
 Identities = 144/224 (64%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 295 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPF 354

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 355 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 414

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 415 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 474

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 475 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 518



 Score = 30.4 bits (67), Expect(2) = 2e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 279 SNLKRVTLELGGKSP 293



>gb:AY566469_2086589 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase precursor (Aldh2) mRNA, Aldh2*3 allele,
           partial cds; nuclear gene for mitochondrial product.
          Length = 510

 Score =  299 bits (765), Expect(2) = 2e-82
 Identities = 144/224 (64%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 286 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPF 345

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 346 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 405

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 406 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 465

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 466 YDVFGAQSPFGGYKMSGSGRELGKYGLQAYTEVKTVTVKVPQKN 509



 Score = 30.4 bits (67), Expect(2) = 2e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 270 SNLKRVTLELGGKSP 284



>gb:AY566468_2086588 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase precursor (Aldh2) mRNA, Aldh2*2 allele,
           partial cds; nuclear gene for mitochondrial product.
          Length = 510

 Score =  299 bits (765), Expect(2) = 2e-82
 Identities = 144/224 (64%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 286 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPF 345

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 346 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 405

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 406 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 465

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 466 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 509



 Score = 30.4 bits (67), Expect(2) = 2e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 270 SNLKRVTLELGGKSP 284



>gb:AY566467_2086587 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase precursor (Aldh2) mRNA, Aldh2*1 allele,
           partial cds; nuclear gene for mitochondrial product.
          Length = 510

 Score =  299 bits (765), Expect(2) = 2e-82
 Identities = 144/224 (64%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 286 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPF 345

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 346 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 405

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 406 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 465

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 466 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 509



 Score = 30.4 bits (67), Expect(2) = 2e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 270 SNLKRVTLELGGKSP 284



>sp|P81178|DHAM_MESAU Aldehyde dehydrogenase, mitochondrial (EC
           1.2.1.3) (ALDH class 2) (ALDH1) (ALDH-E2).
          Length = 500

 Score =  299 bits (765), Expect(2) = 2e-82
 Identities = 144/224 (64%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 276 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPF 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 336 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 396 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 456 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTIKVPQKN 499



 Score = 30.4 bits (67), Expect(2) = 2e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 260 SNLKRVTLELGGKSP 274



>gb:AF529165_2067592 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase (Aldh2) mRNA, partial cds; nuclear gene
           for mitochondrial product.
          Length = 488

 Score =  299 bits (765), Expect(2) = 2e-82
 Identities = 144/224 (64%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 264 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPF 323

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 324 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 383

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 384 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 443

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 444 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 487



 Score = 30.4 bits (67), Expect(2) = 2e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 248 SNLKRVTLELGGKSP 262



>gb:AY034137_2074207 Rattus norvegicus aldehyde dehydrogenase gene,
           exons 3 through 13 and partial cds; nuclear gene for
           mitochondrial product.
          Length = 443

 Score =  299 bits (765), Expect(2) = 2e-82
 Identities = 144/224 (64%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 219 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYDEFVERSVARAKSRVVGNPF 278

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 279 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 338

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 339 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 398

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 399 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 442



 Score = 30.4 bits (67), Expect(2) = 2e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 203 SNLKRVTLELGGKSP 217



>sp|P47738|DHAM_MOUSE Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI)
           (ALDH-E2).>pir|I48966|I48966 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial -
           mouse>gb:AK035145_1164004 Mus musculus 12 days embryo
           embryonic body between diaphragm region and neck cDNA,
           RIKEN full-length enriched library, clone:9430093D07
           product:aldehyde dehydrogenase 2, mitochondrial, full
           insert sequence.>gb:AK042326_1166271 Mus musculus 3 days
           neonate thymus cDNA, RIKEN full-length enriched library,
           clone:A630082J17 product:aldehyde dehydrogenase 2,
           mitochondrial, full insert sequence.>gb:AK079602_1172748
           Mus musculus adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330064L07
           product:aldehyde dehydrogenase 2, mitochondrial, full
           insert sequence.>gb:BC005476_2089907 Mus musculus
           aldehyde dehydrogenase 2, mitochondrial, mRNA (cDNA
           clone MGC:6764 IMAGE:3600875), complete
           cds.>gb:MMU07235_2118114 Mus musculus aldehyde
           dehydrogenase (ALDH2) mRNA, nuclear gene encoding
           mitochondrial protein, complete cds.
          Length = 519

 Score =  298 bits (762), Expect(2) = 5e-82
 Identities = 143/224 (63%), Positives = 172/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ ARA  RVVG+PF
Sbjct: 295 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAKSRVVGNPF 354

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI+SG++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 355 DSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 414

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RAN++ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 415 AKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 474

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 475 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 518



 Score = 30.4 bits (67), Expect(2) = 5e-82
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 279 SNLKRVTLELGGKSP 293



>gb:BC077908_2560555 Xenopus laevis MGC80785 protein, mRNA (cDNA
           clone MGC:80785 IMAGE:5513343), complete cds.
          Length = 521

 Score =  294 bits (753), Expect(2) = 1e-81
 Identities = 145/229 (63%), Positives = 172/229 (75%), Gaps = 2/229 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II  DA++D AVE AHFALFFNQGQCCCAGSRTYV E IY+EFVE++  RA  R+
Sbjct: 292 GKSPIIIFSDADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRI 351

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VG+PF    EQGPQ+D EQF K+L YI+SGK+ GA L  GG+    +GYFIQPT+F DV 
Sbjct: 352 VGNPFDFKTEQGPQVDEEQFNKILGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVT 411

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPV  +LKFK I+EVI RANN+ YGLAA V+T DIDKA+T ++ +RAGT
Sbjct: 412 DNMTIAREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHTFSQSVRAGT 471

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           VWINCYDVF A  PFGGYK SGIGRE G Y L  Y +VK V    P KN
Sbjct: 472 VWINCYDVFGAQAPFGGYKASGIGRELGEYGLEAYTEVKNVTIKIPQKN 520



 Score = 32.7 bits (73), Expect(2) = 1e-81
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 280 KSNLKKVTLELGGKSP 295



>gb:BC055244_2551323 Danio rerio zgc:63786, mRNA (cDNA clone
           MGC:63786 IMAGE:2644084), complete cds.
          Length = 516

 Score =  298 bits (763), Expect(2) = 1e-81
 Identities = 143/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DAN++ AVE AH ALFFNQGQCCCAG+RT+V E IYDEFVE++  RA  R+VGDPF
Sbjct: 292 IILSDANMEEAVEQAHSALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPF 351

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D +QF+KVL YI SGK  GA L CGG     +GYFIQPT+F DVK+DM I
Sbjct: 352 DLNTEQGPQVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMTI 411

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK ++EVI+RAN++ YGLAA V+T +IDKAN ++ GLRAGTVWINC
Sbjct: 412 AREEIFGPVMQILKFKSLEEVIERANDSKYGLAAAVFTQNIDKANYISHGLRAGTVWINC 471

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+VF    PFGGYK SGIGRE G Y L+ Y +VK V    P KN
Sbjct: 472 YNVFGVQAPFGGYKASGIGRELGEYGLDIYTEVKTVTIKVPQKN 515



 Score = 28.9 bits (63), Expect(2) = 1e-81
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK V+LELGGKSP
Sbjct: 276 SNLKNVSLELGGKSP 290



>gb:BT007942_2150874 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 2 family (mitochondrial) mRNA, partial
           cds.
          Length = 518

 Score =  296 bits (757), Expect(2) = 2e-81
 Identities = 143/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFVE++ ARA  RVVG+PF
Sbjct: 293 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 353 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 413 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 473 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 2e-81
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:HUMALDH13_2029124 Human nucleus-encoded mitochondrial aldehyde
           dehydrogenase 2 (ALDH2) gene, exon 13.
          Length = 517

 Score =  296 bits (757), Expect(2) = 2e-81
 Identities = 143/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFVE++ ARA  RVVG+PF
Sbjct: 293 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 353 DSKTEQGPQVDETQFKKILGYINTGKQQGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 413 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 473 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 2e-81
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:AY621070_1957710 Homo sapiens mitochondrial aldehyde
           dehydrogenase 2 (ALDH2) mRNA, complete cds; nuclear gene
           for mitochondrial product.
          Length = 517

 Score =  296 bits (757), Expect(2) = 2e-81
 Identities = 143/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFVE++ ARA  RVVG+PF
Sbjct: 293 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 353 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 413 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 473 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 2e-81
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>sp|P05091|DHAM_HUMAN Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2) (ALDHI)
           (ALDH-E2).>pir|A29975|DEHUE2 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial
           [validated] - human>gb:BC002967_1968567 Homo sapiens
           aldehyde dehydrogenase 2 family (mitochondrial), mRNA
           (cDNA clone MGC:1806 IMAGE:3543343), complete
           cds.>gb:BC071839_1988815 Homo sapiens aldehyde
           dehydrogenase 2 family (mitochondrial), mRNA (cDNA clone
           MGC:88499 IMAGE:5477768), complete cds.
          Length = 517

 Score =  296 bits (757), Expect(2) = 2e-81
 Identities = 143/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFVE++ ARA  RVVG+PF
Sbjct: 293 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 353 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 413 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 473 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 2e-81
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:AF260121_2483050 Danio rerio aldehyde dehydrogenase 2 precursor
           (ALDH2) mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 516

 Score =  297 bits (761), Expect(2) = 2e-81
 Identities = 143/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DAN++ AVE AH ALFFNQGQCCCAG+RT+V E IYDEFVE++  RA  R+VGDPF
Sbjct: 292 IILSDANMEEAVEQAHSALFFNQGQCCCAGTRTFVQESIYDEFVERSVERAKNRIVGDPF 351

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D +QF+KVL YI SGK  GA L CGG     +GYFIQPT+F DVK+DM I
Sbjct: 352 DLNTEQGPQVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTVFGDVKDDMKI 411

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK ++EVI+RAN++ YGLAA V+T +IDKAN ++ GLRAGTVWINC
Sbjct: 412 AREEIFGPVMQILKFKSLEEVIERANDSKYGLAAAVFTQNIDKANYISHGLRAGTVWINC 471

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+VF    PFGGYK SGIGRE G Y L+ Y +VK V    P KN
Sbjct: 472 YNVFGVQAPFGGYKASGIGRELGEYGLDIYTEVKTVTIKVPQKN 515



 Score = 28.9 bits (63), Expect(2) = 2e-81
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK V+LELGGKSP
Sbjct: 276 SNLKNVSLELGGKSP 290



>gb:CR456991_1993198 Homo sapiens full open reading frame cDNA clone
           RZPDo834H0211D for gene ALDH2, aldehyde dehydrogenase 2
           family (mitochondrial); complete cds, incl. stopcodon.
          Length = 517

 Score =  295 bits (756), Expect(2) = 2e-81
 Identities = 143/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFVE++ ARA  RVVG+PF
Sbjct: 293 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 353 DSKTEQGPQLDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 413 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 473 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 2e-81
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:CR857362_1181605 Pongo pygmaeus mRNA; cDNA DKFZp469J1332 (from
           clone DKFZp469J1332).
          Length = 517

 Score =  294 bits (752), Expect(2) = 7e-81
 Identities = 142/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFVE++ ARA  RVVG+PF
Sbjct: 293 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 353 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 413 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+VF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 473 YNVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 7e-81
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>sp|P20000|DHAM_BOVIN Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2) (ALDHI)
           (ALDH-E2).>pir|S09030|S09030 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial - bovine
          Length = 520

 Score =  292 bits (748), Expect(2) = 9e-81
 Identities = 141/224 (62%), Positives = 170/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IY EFVE++ ARA  RVVG+PF
Sbjct: 296 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYAEFVERSVARAKSRVVGNPF 355

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+KVL YI+SGKE G  L CGG     +GYFIQPT+F D+++ M I
Sbjct: 356 DSRTEQGPQVDETQFKKVLGYIKSGKEEGLKLLCGGGAAADRGYFIQPTVFGDLQDGMTI 415

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK ++EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 416 AKEEIFGPVMQILKFKSMEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 475

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYK+SG GRE G Y L  Y +VK V    P KN
Sbjct: 476 YDVFGAQSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVRVPQKN 519



 Score = 31.6 bits (70), Expect(2) = 9e-81
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLE+GGKSP
Sbjct: 279 KSNLKRVTLEIGGKSP 294



>gb:HSALDHIR_2010484 Human mRNA for mitochondrial aldehyde
           dehydrogenase (ALDH I).
          Length = 515

 Score =  293 bits (750), Expect(2) = 1e-80
 Identities = 142/224 (63%), Positives = 170/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFV ++ ARA  RVVG+PF
Sbjct: 291 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVVRSVARAKSRVVGNPF 350

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 351 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 410

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 411 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 470

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 471 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 514



 Score = 30.4 bits (67), Expect(2) = 1e-80
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 275 SNLKRVTLELGGKSP 289



>gb:HSALDHI1_2010483 Human RNA for mitochondrial aldehyde
           dehydrogenase I ALDH I (EC 1.2.1.3).
          Length = 516

 Score =  293 bits (750), Expect(2) = 1e-80
 Identities = 142/224 (63%), Positives = 170/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFV ++ ARA  RVVG+PF
Sbjct: 292 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVVRSVARAKSRVVGNPF 351

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 352 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 411

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 412 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 471

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 472 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 515



 Score = 30.4 bits (67), Expect(2) = 1e-80
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 276 SNLKRVTLELGGKSP 290



>pir|S00364|S00364 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2,
           mitochondrial - horse (tentative sequence)
          Length = 500

 Score =  292 bits (747), Expect(2) = 1e-80
 Identities = 144/224 (64%), Positives = 169/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCC AGSRT+V E +Y EFVE++ ARA  RVVG+PF
Sbjct: 276 IIVSDADMDWAVEQAHFALFFNQGQCCGAGSRTFVQEDVYAEFVERSVARAKSRVVGNPF 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF KVL YI+SGKE GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 336 DSQTEQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 396 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 456 YDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKN 499



 Score = 31.6 bits (70), Expect(2) = 1e-80
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 259 RSNLKKVTLELGGKSP 274



>sp|P12762|DHAM_HORSE Aldehyde dehydrogenase, mitochondrial (EC
           1.2.1.3) (ALDH class 2) (ALDHI) (ALDH-E2).
          Length = 500

 Score =  292 bits (747), Expect(2) = 1e-80
 Identities = 144/224 (64%), Positives = 169/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCC AGSRT+V E +Y EFVE++ ARA  RVVG+PF
Sbjct: 276 IIVSDADMDWAVEQAHFALFFNQGQCCGAGSRTFVQEDVYAEFVERSVARAKSRVVGNPF 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF KVL YI+SGKE GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 336 DSQTEQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 396 AKEEIFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 456 YDVFGAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKN 499



 Score = 31.6 bits (70), Expect(2) = 1e-80
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 259 RSNLKKVTLELGGKSP 274



>gb:HUMALDH2_2029127 Human aldehyde dehydrogenase 2
           mRNA.>gb:HUMALDH2Z_2029128 Human aldehyde dehydrogenase
           II (ALDH-2) mRNA, 3' end.
          Length = 399

 Score =  293 bits (750), Expect(2) = 1e-80
 Identities = 142/224 (63%), Positives = 170/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFV ++ ARA  RVVG+PF
Sbjct: 175 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVVRSVARAKSRVVGNPF 234

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 235 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 294

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RANN+ YGLAA V+T D+DKAN L++ L+AGTVW+NC
Sbjct: 295 AKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNC 354

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 355 YDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 398



 Score = 30.4 bits (67), Expect(2) = 1e-80
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 159 SNLKRVTLELGGKSP 173



>gb:BC075335_2558439 Xenopus tropicalis MGC89020 protein, mRNA (cDNA
           clone MGC:89020 IMAGE:7004710), complete cds.
          Length = 521

 Score =  290 bits (741), Expect(2) = 3e-80
 Identities = 142/224 (63%), Positives = 171/224 (76%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRTYV E IY+EFVE++  RA  R+VG+PF
Sbjct: 297 IIFSDADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPF 356

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D EQF KVL YI+SGK+ GA L  GG+    +GYFIQPT+F DV ++M I
Sbjct: 357 DFKTEQGPQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTI 416

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EVI RANN+ YGLAA V+T DIDKA+ +++ +RAGTVWINC
Sbjct: 417 AREEIFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSVRAGTVWINC 476

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVK--AVVTPLKN 219
           YDVF A  PFGG+K SGIGRE G Y L  Y +VK   +  P KN
Sbjct: 477 YDVFGAQAPFGGFKASGIGRELGEYGLEAYTEVKNITIKIPQKN 520



 Score = 32.7 bits (73), Expect(2) = 3e-80
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 280 KSNLKKVTLELGGKSP 295



>gb:AF348412_1790089 Zea mays cytosolic aldehyde dehydrogenase RF2C
           (rf2c) gene, complete cds.
          Length = 502

 Score =  289 bits (739), Expect(2) = 5e-80
 Identities = 136/231 (58%), Positives = 171/231 (74%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA++D AV   +FA + N+G+ C AG+R YV E IYDEFV+KA   A + V
Sbjct: 272 GKSPVIVFDDADLDMAVNLVNFATYTNKGEICVAGTRIYVQEGIYDEFVKKAAELASKSV 331

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF   V QGPQ+D +Q+EKVLRYI  GK  GATL  GG   G KGY+I+PTIF+DVK
Sbjct: 332 VGDPFNPSVSQGPQVDKDQYEKVLRYIDIGKREGATLVTGGKPCGDKGYYIEPTIFTDVK 391

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           +DM IAQDEIFGPV  ++KFK ++EVI++ANNT YGLAAG+ T +ID ANT++R +RAG 
Sbjct: 392 DDMTIAQDEIFGPVMALMKFKTVEEVIQKANNTRYGLAAGIVTKNIDVANTVSRSIRAGA 451

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           +WINCY  FD   PFGGYKMSG G++ G+ +L+ YLQ K VVTPL N  W+
Sbjct: 452 IWINCYFAFDPDAPFGGYKMSGFGKDMGMDALDKYLQTKTVVTPLYNTPWL 502



 Score = 32.7 bits (73), Expect(2) = 5e-80
 Identities = 14/16 (87%), Positives = 16/16 (100%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLKPV+LELGGKSP
Sbjct: 260 ESNLKPVSLELGGKSP 275



>gb:S71509_2139106 Mus sp. aldehyde dehydrogenase AHD-M1 mRNA,
           complete cds.
          Length = 517

 Score =  289 bits (740), Expect(2) = 2e-79
 Identities = 140/224 (62%), Positives = 168/224 (75%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E +YDEFVE++ A A  RVVG+PF
Sbjct: 293 IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQENVYDEFVERSVAGAKSRVVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF K+L YI+ G++ GA L CGG     +GYFIQPT+F DVK+ M I
Sbjct: 353 DSRTEQGPQVDETQFNKILGYIKMGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKDGMTI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +LKFK I+EV+ RAN++ YGLAA V+T D+DKAN L++ L+AGTVWINC
Sbjct: 413 AKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWINC 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y VF A  PFGGYKMSG GRE G Y L  Y +VK V    P KN
Sbjct: 473 YVVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 2e-79
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:AF348413_1790090 Zea mays cytosolic aldehyde dehydrogenase RF2C
           (rf2c) mRNA, complete cds.
          Length = 503

 Score =  285 bits (728), Expect(2) = 9e-79
 Identities = 136/232 (58%), Positives = 172/232 (74%), Gaps = 1/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA++D AV   +FA + N+G+ C AG+R YV E IYDEFV+KA   A + V
Sbjct: 272 GKSPVIVFDDADLDMAVNLVNFATYTNKGEICVAGTRIYVQEGIYDEFVKKAAELASKSV 331

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG-SKGYFIQPTIFSDV 543
           VGDPF   V QGPQ+D +Q+EKVLRYI  GK  GATL  GG   G +KGY+I+PTIF+DV
Sbjct: 332 VGDPFNPSVSQGPQVDKDQYEKVLRYIDIGKREGATLVTGGKPCGDNKGYYIEPTIFTDV 391

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
           K+DM IAQDEIFGPV  ++KFK ++EVI++ANNT YGLAAG+ T +ID ANT++R +RAG
Sbjct: 392 KDDMTIAQDEIFGPVMALMKFKTVEEVIQKANNTRYGLAAGIVTKNIDVANTVSRSIRAG 451

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
            +WINCY  FD   PFGGYKMSG G++ G+ +L+ YLQ K VVTPL N  W+
Sbjct: 452 AIWINCYFAFDPDAPFGGYKMSGFGKDMGMDALDKYLQTKTVVTPLYNTPWL 503



 Score = 32.7 bits (73), Expect(2) = 9e-79
 Identities = 14/16 (87%), Positives = 16/16 (100%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLKPV+LELGGKSP
Sbjct: 260 ESNLKPVSLELGGKSP 275



>gb:BC077256_2559972 Xenopus laevis aldehyde dehydrogenase class I,
           mRNA (cDNA clone MGC:79911 IMAGE:3399386), complete cds.
          Length = 502

 Score =  284 bits (727), Expect(2) = 1e-78
 Identities = 137/217 (63%), Positives = 165/217 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  LFF+QGQCC AGSR +V E IYDEFV K+  RA +RV+GDPF
Sbjct: 278 IIFADADLDLAVEHAHNGLFFHQGQCCIAGSRIFVEEPIYDEFVRKSVERAKKRVLGDPF 337

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
              V QGPQID EQ++K+L  I SGK+ GA L+CGG   G KG++I PT+FSDVK+DM I
Sbjct: 338 APCVNQGPQIDKEQYDKILELIESGKKEGAKLQCGGSAWGEKGFYISPTVFSDVKDDMRI 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +LKFK IDEVIKRANNT YGLAAGV+T D+DKA  ++  L+AGTVWINC
Sbjct: 398 AKEEIFGPVQQILKFKTIDEVIKRANNTKYGLAAGVFTKDMDKAILMSTALQAGTVWINC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
           Y       PFGG+KMSG GRE G Y L+ Y +VK V+
Sbjct: 458 YSAMSPQSPFGGFKMSGNGREMGEYGLHEYTEVKTVI 494



 Score = 32.3 bits (72), Expect(2) = 1e-78
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 261 KSNLKRVTLELGGKSP 276



>gb:AB016718_2460746 Xenopus laevis mRNA for aldehyde dehydrogenase
           class 1, complete cds.
          Length = 502

 Score =  284 bits (727), Expect(2) = 1e-78
 Identities = 137/217 (63%), Positives = 165/217 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  LFF+QGQCC AGSR +V E IYDEFV K+  RA +RV+GDPF
Sbjct: 278 IIFADADLDLAVEHAHNGLFFHQGQCCIAGSRIFVEEPIYDEFVRKSVERAKKRVLGDPF 337

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
              V QGPQID EQ++K+L  I SGK+ GA L+CGG   G KG++I PT+FSDVK+DM I
Sbjct: 338 APCVNQGPQIDKEQYDKILELIESGKKEGAKLQCGGSAWGEKGFYISPTVFSDVKDDMRI 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +LKFK IDEVIKRANNT YGLAAGV+T D+DKA  ++  L+AGTVWINC
Sbjct: 398 AKEEIFGPVQQILKFKTIDEVIKRANNTKYGLAAGVFTKDMDKAILMSTALQAGTVWINC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
           Y       PFGG+KMSG GRE G Y L+ Y +VK V+
Sbjct: 458 YSAMSPQSPFGGFKMSGNGREMGEYGLHEYTEVKTVI 494



 Score = 32.3 bits (72), Expect(2) = 1e-78
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 261 KSNLKRVTLELGGKSP 276



>gb:BC076716_2559463 Xenopus laevis aldehyde dehydrogenase class 1,
           mRNA (cDNA clone MGC:79912 IMAGE:4031362), complete cds.
          Length = 502

 Score =  284 bits (726), Expect(2) = 2e-78
 Identities = 137/217 (63%), Positives = 165/217 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  LF++QGQCC AGSR +V E IYDEFV K+  RA +RV+GDP 
Sbjct: 278 IIFADADLDLAVEHAHNGLFYHQGQCCIAGSRIFVEEPIYDEFVRKSVERAKKRVLGDPL 337

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ+ K+L  I SGK+ GA LECGG   G KG++I PT+FSDVK+DM I
Sbjct: 338 TPGVCQGPQIDKEQYNKILELIESGKKEGAKLECGGSAWGEKGFYISPTVFSDVKDDMRI 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +LKFK IDEVIKRANNT+YGLAAGV+T D+DKA  ++  L+AGTVWINC
Sbjct: 398 AKEEIFGPVQQILKFKTIDEVIKRANNTNYGLAAGVFTKDMDKAILMSTALQAGTVWINC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
           Y       PFGG+KMSG GRE G Y L+ Y +VK V+
Sbjct: 458 YSAMSPQSPFGGFKMSGNGREMGEYGLHEYTEVKTVI 494



 Score = 32.3 bits (72), Expect(2) = 2e-78
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 261 KSNLKRVTLELGGKSP 276



>gb:AB016717_2460745 Xenopus laevis mRNA for aldehyde dehydrogenase
           class 1, complete cds.
          Length = 414

 Score =  284 bits (726), Expect(2) = 2e-78
 Identities = 137/217 (63%), Positives = 165/217 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  LF++QGQCC AGSR +V E IYDEFV K+  RA +RV+GDP 
Sbjct: 190 IIFADADLDLAVEHAHNGLFYHQGQCCIAGSRIFVEEPIYDEFVRKSVERAKKRVLGDPL 249

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ+ K+L  I SGK+ GA LECGG   G KG++I PT+FSDVK+DM I
Sbjct: 250 TPGVCQGPQIDKEQYNKILELIESGKKEGAKLECGGSAWGEKGFYISPTVFSDVKDDMRI 309

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +LKFK IDEVIKRANNT+YGLAAGV+T D+DKA  ++  L+AGTVWINC
Sbjct: 310 AKEEIFGPVQQILKFKTIDEVIKRANNTNYGLAAGVFTKDMDKAILMSTALQAGTVWINC 369

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
           Y       PFGG+KMSG GRE G Y L+ Y +VK V+
Sbjct: 370 YSAMSPQSPFGGFKMSGNGREMGEYGLHEYTEVKTVI 406



 Score = 32.3 bits (72), Expect(2) = 2e-78
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 173 KSNLKRVTLELGGKSP 188



>gb:AF061833_2471352 Xenopus laevis aldehyde dehydrogenase (ALDH1)
           mRNA, complete cds.
          Length = 502

 Score =  283 bits (723), Expect(2) = 4e-78
 Identities = 137/217 (63%), Positives = 164/217 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  LFF+QGQCC AGSR +V E IYDEFV K+  RA +RV+GDPF
Sbjct: 278 IIFADADLDLAVEHAHNGLFFHQGQCCIAGSRIFVEEPIYDEFVRKSVERAKKRVLGDPF 337

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
              V QGPQID EQ++K L  I SGK+ GA L+CGG   G KG++I PT+FSDVK+DM I
Sbjct: 338 APCVNQGPQIDKEQYDKCLELIESGKKEGAKLQCGGSAWGEKGFYISPTVFSDVKDDMRI 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +LKFK IDEVIKRANNT YGLAAGV+T D+DKA  ++  L+AGTVWINC
Sbjct: 398 AKEEIFGPVQQILKFKTIDEVIKRANNTKYGLAAGVFTKDMDKAILMSTALQAGTVWINC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
           Y       PFGG+KMSG GRE G Y L+ Y +VK V+
Sbjct: 458 YSAMSPQSPFGGFKMSGNGREMGEYGLHEYTEVKTVI 494



 Score = 32.3 bits (72), Expect(2) = 4e-78
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 261 KSNLKRVTLELGGKSP 276



>sp|P27463|DHA1_CHICK Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class
           1).>pir|S14629|S14629 aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) 1, cytosolic - chicken>gb:GGADHR_2572902 Gallus
           gallus mRNA for aldehyde dehydrogenase 1 (aldh1 gene).
          Length = 509

 Score =  283 bits (725), Expect(2) = 6e-78
 Identities = 140/224 (62%), Positives = 166/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D A E AH  LF++QGQCC AGSR +V E IYDEFV ++  RA +  +GDP 
Sbjct: 285 IIFADADLDEAAEFAHIGLFYHQGQCCIAGSRIFVEEPIYDEFVRRSIERAKKYTLGDPL 344

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV+QGPQID EQF+K+L  I SGK+ GA LECGG   G+KGYFIQPT+FS+V +DM I
Sbjct: 345 LPGVQQGPQIDKEQFQKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDDMRI 404

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK IDEVIKRANNT YGLAA V+T DIDKA T A  L+AGTVW+NC
Sbjct: 405 AKEEIFGPVQQIMKFKTIDEVIKRANNTTYGLAAAVFTKDIDKALTFASALQAGTVWVNC 464

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y  F A  PFGG+KMSG GRE G Y L  Y +VK V    P KN
Sbjct: 465 YSAFSAQCPFGGFKMSGNGRELGEYGLQEYTEVKTVTIKIPQKN 508



 Score = 31.2 bits (69), Expect(2) = 6e-78
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           K+NLK VTLELGGKSP
Sbjct: 268 KTNLKRVTLELGGKSP 283



>gb:AE014134_1128355 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003624_1218462 Drosophila melanogaster
           chromosome 2L, section 33 of 83 of the complete
           sequence.
          Length = 520

 Score =  285 bits (728), Expect(2) = 9e-78
 Identities = 133/218 (61%), Positives = 171/218 (78%), Gaps = 1/218 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  D ++D AVE AHF LFFN GQCCCAGSRT+V ++IYDEFVE++  RA +R VG+PF
Sbjct: 295 IILSDTDMDYAVETAHFGLFFNMGQCCCAGSRTFVEDKIYDEFVERSAERAKKRTVGNPF 354

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI-GSKGYFIQPTIFSDVKEDMV 528
               EQGPQ++ EQ EK+L  I++GK+ GA L  GG R  G  GYF+QPT+F+DV++DM 
Sbjct: 355 DLNTEQGPQVNEEQMEKILGMIKTGKKQGAKLVAGGSRPEGLPGYFVQPTVFADVQDDMT 414

Query: 527 IAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWIN 348
           IA++EIFGPVQ +++FK +DEVI+RANN+ YGLAA V+T D+DKAN +  GLRAGTVW+N
Sbjct: 415 IAREEIFGPVQQLIRFKKLDEVIERANNSEYGLAAAVFTKDLDKANYIVGGLRAGTVWVN 474

Query: 347 CYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
            Y+V  A  PFGGYKMSG GRE G Y+L+NY +VK+V+
Sbjct: 475 TYNVLAAQAPFGGYKMSGHGRENGEYALSNYTEVKSVI 512



 Score = 29.3 bits (64), Expect(2) = 9e-78
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           +NLK VTLELGGKSP
Sbjct: 279 TNLKRVTLELGGKSP 293



>gb:AB037421_1519138 Oryza sativa (japonica cultivar-group) ALDH1a
           mRNA for cytosolic aldehyde dehydrogenase, complete
           cds.>gb:AP003048_1824452 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0710A02.
          Length = 502

 Score =  278 bits (712), Expect(2) = 2e-77
 Identities = 132/231 (57%), Positives = 167/231 (72%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA++D AV   H A + N+G+ C AGSR YV E IYD FV+KA   A + V
Sbjct: 272 GKSPVIVFDDADLDTAVNLVHMASYTNKGEICVAGSRIYVQEGIYDAFVKKATEMAKKSV 331

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF   V QGPQID EQ+EK+L+YI  GK  GATL  GG   G  GY+I+PTIF+DVK
Sbjct: 332 VGDPFNPRVHQGPQIDKEQYEKILKYIDIGKREGATLVTGGKPCGENGYYIEPTIFTDVK 391

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           E+M IAQ+EIFGPV  ++KFK ++E I++AN+T YGLAAG+ T +ID ANT++R +RAG 
Sbjct: 392 EEMSIAQEEIFGPVMALMKFKTVEEAIQKANSTRYGLAAGIVTKNIDVANTVSRSIRAGA 451

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           +WINCY  FD  +PFGGYKMSG G++ G+ +L  YL  KAVVTPL N  W+
Sbjct: 452 IWINCYLGFDPDVPFGGYKMSGFGKDMGMDALEKYLHTKAVVTPLYNTPWL 502



 Score = 34.3 bits (77), Expect(2) = 2e-77
 Identities = 15/16 (93%), Positives = 16/16 (100%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLKPV+LELGGKSP
Sbjct: 260 KSNLKPVSLELGGKSP 275



>gb:AE014297_1141634 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003758_1223627 Drosophila melanogaster
           chromosome 3R, section 96 of 118 of the complete
           sequence.
          Length = 485

 Score =  279 bits (714), Expect(2) = 5e-76
 Identities = 135/225 (60%), Positives = 166/225 (73%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ DDA+ID AVE  H ALF N GQ CCAGSRTYVHE+IYDEFV KA A+A  R 
Sbjct: 260 GKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTYVHEKIYDEFVAKAAAKAKARK 319

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VG+PF++ V+QGPQID +   KVL YI SGK+ GA L+ GG RIG+ G+F++PT+FSDVK
Sbjct: 320 VGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRIGNVGFFVEPTVFSDVK 379

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           +DM IAQ+EIFGPVQ + KF  ++E+I RANN  YGLAAGV T+DI+KA   A  + AG+
Sbjct: 380 DDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKALKFANNVDAGS 439

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           VWINCYD    + PFGGYK SGIGRE G   L+NYL+ K +   L
Sbjct: 440 VWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 484



 Score = 28.9 bits (63), Expect(2) = 5e-76
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK V+LELGGKSP
Sbjct: 249 SNLKRVSLELGGKSP 263



>gb:BOVALDHYDA_1435150 Bos taurus aldehyde dehydrogenase mRNA,
           complete cds.
          Length = 501

 Score =  277 bits (708), Expect(2) = 7e-76
 Identities = 130/216 (60%), Positives = 166/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 277 IVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ+EK+L  I SGK+ GA LECGG   G+KGYFIQPT+FSDV +DM I
Sbjct: 337 TPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AG++T+DIDKA T++  L++GTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V
Sbjct: 457 YSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTV 492



 Score = 30.8 bits (68), Expect(2) = 7e-76
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK V+LELGGKSP
Sbjct: 260 KSNLKRVSLELGGKSP 275



>pir|S78582|S14752 aldehyde dehydrogenase (NAD) (EC 1.2.1.3),
           cytosolic - sheep>gb:OAU12761_1441882 Ovis aries
           aldehyde dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  277 bits (708), Expect(2) = 7e-76
 Identities = 130/216 (60%), Positives = 166/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 277 IVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ+EK+L  I SGK+ GA LECGG   G+KGYFIQPT+FSDV +DM I
Sbjct: 337 TPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AG++T+DIDKA T++  L++GTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V
Sbjct: 457 YSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTV 492



 Score = 30.8 bits (68), Expect(2) = 7e-76
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK V+LELGGKSP
Sbjct: 260 KSNLKRVSLELGGKSP 275



>sp|P51977|DHA1_SHEEP Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  277 bits (708), Expect(2) = 7e-76
 Identities = 130/216 (60%), Positives = 166/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 276 IVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ+EK+L  I SGK+ GA LECGG   G+KGYFIQPT+FSDV +DM I
Sbjct: 336 TPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AG++T+DIDKA T++  L++GTVW+NC
Sbjct: 396 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V
Sbjct: 456 YSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTV 491



 Score = 30.8 bits (68), Expect(2) = 7e-76
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK V+LELGGKSP
Sbjct: 259 KSNLKRVSLELGGKSP 274



>sp|P48644|DHA1_BOVIN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  277 bits (708), Expect(2) = 7e-76
 Identities = 130/216 (60%), Positives = 166/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 276 IVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ+EK+L  I SGK+ GA LECGG   G+KGYFIQPT+FSDV +DM I
Sbjct: 336 TPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AG++T+DIDKA T++  L++GTVW+NC
Sbjct: 396 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V
Sbjct: 456 YSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTV 491



 Score = 30.8 bits (68), Expect(2) = 7e-76
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK V+LELGGKSP
Sbjct: 259 KSNLKRVSLELGGKSP 274



>gb:BT007808_2150740 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 mRNA, partial cds.
          Length = 502

 Score =  274 bits (700), Expect(2) = 2e-75
 Identities = 127/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 277 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 337 TPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T DIDKA T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 457 YGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



 Score = 32.3 bits (72), Expect(2) = 2e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>gb:AF003341_1875821 Homo sapiens aldehyde dehydrogenase 1 (ALDH1)
           mRNA, complete cds.
          Length = 501

 Score =  274 bits (700), Expect(2) = 2e-75
 Identities = 127/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 277 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 337 TPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T DIDKA T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 457 YGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



 Score = 32.3 bits (72), Expect(2) = 2e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>gb:CR860845_1184893 Pongo pygmaeus mRNA; cDNA DKFZp469B0514 (from
           clone DKFZp469B0514).
          Length = 501

 Score =  274 bits (700), Expect(2) = 2e-75
 Identities = 126/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 277 IVLADADLDNAVESAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 337 TPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T D+DKA T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDLDKAVTISSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 457 YGVVTAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



 Score = 32.3 bits (72), Expect(2) = 2e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>pir|A33371|DEHUE1 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1,
           cytosolic [validated] - human>gb:AL591031_1929961 Human
           DNA sequence from clone RP11-151D14 on chromosome
           9q13-21.2 Contains a novel gene and the ALDH1A1 gene for
           aldehyde dehydrogenase 1 family member A1, complete
           sequence.>gb:AL591031_1929962 Human DNA sequence from
           clone RP11-151D14 on chromosome 9q13-21.2 Contains a
           novel gene and the ALDH1A1 gene for aldehyde
           dehydrogenase 1 family member A1, complete
           sequence.>gb:AY338497_1944176 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 (ALDH1A1) gene,
           complete cds.>gb:AY390731_1948914 Homo sapiens aldehyde
           dehydrogenase 1 A1 mRNA, complete
           cds.>gb:BC001505_1967642 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1, mRNA (cDNA clone
           MGC:2318 IMAGE:2988388), complete
           cds.>gb:BT006921_1990359 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 mRNA, complete
           cds.>gb:HUMALDC13_2029121 Homo sapiens aldehyde
           dehydrogenase (ALDH1) gene, exon 13 and complete cds.
          Length = 501

 Score =  274 bits (700), Expect(2) = 2e-75
 Identities = 127/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 277 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 337 TPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T DIDKA T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 457 YGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



 Score = 32.3 bits (72), Expect(2) = 2e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>sp|P00352|DHA1_HUMAN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase 1) (ALHDII) (ALDH- E1).
          Length = 500

 Score =  274 bits (700), Expect(2) = 2e-75
 Identities = 127/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 276 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 336 TPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T DIDKA T++  L+AGTVW+NC
Sbjct: 396 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 456 YGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 495



 Score = 32.3 bits (72), Expect(2) = 2e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 259 KSNLKRVTLELGGKSP 274



>gb:HUMALDH1Z_2029126 Human aldehyde dehydrogenase I (ALDH-1) mRNA,
           3' end.>gb:HUMALDHA1_2029129 Human aldehyde
           dehydrogenase 1 mRNA.
          Length = 340

 Score =  274 bits (700), Expect(2) = 2e-75
 Identities = 127/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 116 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 175

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 176 TPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 235

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T DIDKA T++  L+AGTVW+NC
Sbjct: 236 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNC 295

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 296 YGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 335



 Score = 32.3 bits (72), Expect(2) = 2e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 99  KSNLKRVTLELGGKSP 114



>sp|P15437|DHA1_HORSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).>pir|S02302|S02302 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) 1, cytosolic - horse
          Length = 500

 Score =  271 bits (692), Expect(2) = 3e-75
 Identities = 128/225 (56%), Positives = 166/225 (73%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G   FI+  DA+++ A+E  H ALF++QGQCC A SR +V E IYDEFV ++  RA + V
Sbjct: 271 GKSPFIVFADADLETALEVTHQALFYHQGQCCVAASRLFVEESIYDEFVRRSVERAKKYV 330

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           +G+P   GV QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYFIQPT+FS+V 
Sbjct: 331 LGNPLTPGVSQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVS 390

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ ++KFK +D+VIKRANNT YGL AG +T D+DKA T++  L+AGT
Sbjct: 391 DEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTTYGLFAGSFTKDLDKAITVSAALQAGT 450

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           VW+NCY V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 451 VWVNCYGVVSAQCPFGGFKMSGNGREMGEYGFHEYTEVKTVTVKI 495



 Score = 34.7 bits (78), Expect(2) = 3e-75
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPF 886
           KSNLK VTLELGGKSPF
Sbjct: 259 KSNLKRVTLELGGKSPF 275



>gb:AF542418_1906474 Macaca fascicularis retinal dehydrogenase 1
           mRNA, complete cds.
          Length = 501

 Score =  272 bits (696), Expect(2) = 6e-75
 Identities = 126/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 277 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G  QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 337 TPGATQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T+DIDKA T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTNDIDKAVTISSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 457 YGVVTAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 496



 Score = 32.3 bits (72), Expect(2) = 6e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>sp|Q8HYE4|DHA1_MACFA Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase 1).
          Length = 500

 Score =  272 bits (696), Expect(2) = 6e-75
 Identities = 126/220 (57%), Positives = 166/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 276 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPL 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G  QGPQID EQ++K+L  I SGK+ GA LECGG   G+KGYF+QPT+FS+V ++M I
Sbjct: 336 TPGATQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AGV+T+DIDKA T++  L+AGTVW+NC
Sbjct: 396 AKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTNDIDKAVTISSALQAGTVWVNC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A  PFGG+KMSG GRE G Y  + Y +VK V   +
Sbjct: 456 YGVVTAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKI 495



 Score = 32.3 bits (72), Expect(2) = 6e-75
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 259 KSNLKRVTLELGGKSP 274



>sp|Q8MI17|DHA1_RABIT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class
           1).>gb:AY038801_1424256 Oryctolagus cuniculus aldehyde
           dehydrogenase 1A1 (ALDH1A1) mRNA, complete cds.
          Length = 496

 Score =  271 bits (693), Expect(2) = 1e-74
 Identities = 127/220 (57%), Positives = 165/220 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 272 IVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 331

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
              V QGPQID EQ+ K+L  I SGK+ GA LECGG   G+KGYFIQPT+FS+V ++M I
Sbjct: 332 APEVNQGPQIDKEQYNKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGL+AG++T D+DKA T++  L+AGTVW+NC
Sbjct: 392 AKEEIFGPVQQIMKFKSLDDVIKRANNTTYGLSAGIFTKDLDKAVTVSSALQAGTVWVNC 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A +PFGG+KMSG GRE G Y L  Y +VK V   +
Sbjct: 452 YSVVSAQVPFGGFKMSGNGRELGEYGLQQYTEVKTVTVKI 491



 Score = 32.3 bits (72), Expect(2) = 1e-74
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 255 KSNLKRVTLELGGKSP 270



>sp|Q29491|DHAN_MACPR Aldehyde dehydrogenase, cytosolic 2 (EC
           1.2.1.3) (ALDH class 1) (Non- lens ALDH1) (ALDH1-NL)
           (Fragment).>gb:MPU40486_1441251 Macroscelides
           proboscideus cytoplasmic aldehyde dehydrogenase ALDH1-nl
           mRNA, partial cds.
          Length = 240

 Score =  273 bits (698), Expect(2) = 4e-74
 Identities = 130/216 (60%), Positives = 164/216 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  LFF+QGQCC A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 16  IVFADADLDNAVEFAHRGLFFHQGQCCVAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 75

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV QGPQID EQ++K++  I SGK+ GA LECGG   G+KGYFIQPT+FS+V ++M I
Sbjct: 76  TPGVSQGPQIDKEQYDKIIDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDEMRI 135

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +DEVIKRANNT YGLAAGV+T D+DKA T++  L+AGTVW+NC
Sbjct: 136 AKEEIFGPVQQIMKFKSLDEVIKRANNTFYGLAAGVFTKDLDKAVTVSAALQAGTVWVNC 195

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y       PFGG+KMSG GRE G Y L+ Y +VK V
Sbjct: 196 YMANSVQCPFGGFKMSGNGRELGEYGLHEYTEVKTV 231



 Score = 28.9 bits (63), Expect(2) = 4e-74
 Identities = 13/14 (92%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           NLK VTLELGGKSP
Sbjct: 1   NLKRVTLELGGKSP 14



>gb:AF348415_1790092 Zea mays cytosolic aldehyde dehydrogenase RF2D
           (rf2d) mRNA, complete cds.
          Length = 511

 Score =  270 bits (691), Expect(2) = 1e-73
 Identities = 130/230 (56%), Positives = 164/230 (71%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II DDA++D AV  +  A+FFN+G+ C AGSR YV E IYDEFV+KA   A    
Sbjct: 281 GKSPLIIFDDADVDMAVNLSRLAVFFNKGEVCVAGSRVYVQEGIYDEFVKKAVEAARSWK 340

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF      GPQ+D +QFE+VL+YI  GK  GATL  GG     KGY+I+PTIF DV 
Sbjct: 341 VGDPFDVTSNMGPQVDKDQFERVLKYIEHGKSEGATLLTGGKPAADKGYYIEPTIFVDVT 400

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           EDM IAQ+EIFGPV  ++KFK +DEVI++AN T YGLAAG+ T  +D AN ++R +RAGT
Sbjct: 401 EDMKIAQEEIFGPVMSLMKFKTVDEVIEKANCTRYGLAAGIVTKSLDVANRVSRSVRAGT 460

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           VW+NCY  FD   PFGGYKMSG GR++G+ +++ YLQVK+V+T L +  W
Sbjct: 461 VWVNCYFAFDPDAPFGGYKMSGFGRDQGLAAMDKYLQVKSVITALPDSPW 510



 Score = 30.0 bits (66), Expect(2) = 1e-73
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK V+LELGGKSP
Sbjct: 269 RSNLKTVSLELGGKSP 284



>gb:AF348414_1790091 Zea mays cytosolic aldehyde dehydrogenase RF2D
           (rf2d) gene, partial cds.
          Length = 466

 Score =  270 bits (691), Expect(2) = 1e-73
 Identities = 130/230 (56%), Positives = 164/230 (71%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II DDA++D AV  +  A+FFN+G+ C AGSR YV E IYDEFV+KA   A    
Sbjct: 236 GKSPLIIFDDADVDMAVNLSRLAVFFNKGEVCVAGSRVYVQEGIYDEFVKKAVEAARSWK 295

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF      GPQ+D +QFE+VL+YI  GK  GATL  GG     KGY+I+PTIF DV 
Sbjct: 296 VGDPFDVTSNMGPQVDKDQFERVLKYIEHGKSEGATLLTGGKPAADKGYYIEPTIFVDVT 355

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           EDM IAQ+EIFGPV  ++KFK +DEVI++AN T YGLAAG+ T  +D AN ++R +RAGT
Sbjct: 356 EDMKIAQEEIFGPVMSLMKFKTVDEVIEKANCTRYGLAAGIVTKSLDVANRVSRSVRAGT 415

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           VW+NCY  FD   PFGGYKMSG GR++G+ +++ YLQVK+V+T L +  W
Sbjct: 416 VWVNCYFAFDPDAPFGGYKMSGFGRDQGLAAMDKYLQVKSVITALPDSPW 465



 Score = 30.0 bits (66), Expect(2) = 1e-73
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK V+LELGGKSP
Sbjct: 224 RSNLKTVSLELGGKSP 239



>gb:AP003617_1831493 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0502H06.
          Length = 526

 Score =  263 bits (673), Expect(2) = 2e-73
 Identities = 125/230 (54%), Positives = 163/230 (70%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G   FI+ DDA++D+AVE A    FFN+G+ C AGSR +V E IYD F +K        V
Sbjct: 296 GKSPFIVFDDADLDKAVELAIGGNFFNKGEACVAGSRVFVQEGIYDRFEQKLADTMKSWV 355

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF   V QGPQ+D  Q+E+VL YI  GK  GAT+  GG   G KGY+I+PTIF++VK
Sbjct: 356 VGDPFDPRVNQGPQVDKAQYERVLGYIEQGKAEGATVLTGGKPCGKKGYYIEPTIFTNVK 415

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           +DMVIA++EIFGPV C++KFK ++E I+RAN T YGLAAG+ T DID AN +AR +RAG 
Sbjct: 416 DDMVIAREEIFGPVMCLMKFKTVEEAIERANGTRYGLAAGLVTRDIDVANRMARSIRAGV 475

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           VW+NCY   D + PFGG KMSG G++  +++L+ +L VK+VVTP+    W
Sbjct: 476 VWVNCYFAMDRSCPFGGRKMSGFGKDDSMHALDKFLAVKSVVTPVHGSPW 525



 Score = 36.2 bits (82), Expect(2) = 2e-73
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPF 886
           KSNLKPV LELGGKSPF
Sbjct: 284 KSNLKPVALELGGKSPF 300



>gb:AF246711_2060468 Mus musculus retinaldehyde dehydrogenase 3
           mRNA, complete cds.>gb:AF280404_2061324 Mus musculus
           retinaldehyde dehydrogenase 3 (Raldh3) mRNA, complete
           cds.>gb:BC058277_2103153 Mus musculus aldehyde
           dehydrogenase family 1, subfamily A3, mRNA (cDNA clone
           MGC:67939 IMAGE:6515355), complete cds.
          Length = 512

 Score =  270 bits (689), Expect(2) = 2e-73
 Identities = 132/230 (57%), Positives = 167/230 (72%), Gaps = 2/230 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +FFNQGQCC A SR +V E++Y EFV ++   A +R 
Sbjct: 283 GKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRP 342

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  +G FI+PT+FSDV 
Sbjct: 343 VGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVT 402

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LKFK+++EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 403 DNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAALESGT 462

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VWINCY+ F A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 463 VWINCYNAFYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLEEKNP 512



 Score = 30.0 bits (66), Expect(2) = 2e-73
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGK+P
Sbjct: 271 RSNLKRVTLELGGKNP 286



>pir|JC5553|JC5553 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) -
           rat>gb:AF001896_2050051 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:AF001897_2050052 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:AF001898_2050053 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:BC061526_2104509 Rattus norvegicus aldehyde
           dehydrogenase family 1, member A1, mRNA (cDNA clone
           MGC:72648 IMAGE:6921926), complete
           cds.>gb:RNU79118_2137805 Rattus norvegicus aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  267 bits (683), Expect(2) = 2e-73
 Identities = 124/216 (57%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV K+  RA + V+G+P 
Sbjct: 277 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVRKSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 337 TQGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK ID+VIKRANNT YGLAAGV+T D+D+A T++  L+AG VW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSIDDVIKRANNTTYGLAAGVFTKDLDRAITVSSALQAGVVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 457 YMILSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 492



 Score = 32.3 bits (72), Expect(2) = 2e-73
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>pir|JC4524|JC4524 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) -
           rat>gb:RATALDHA_2131447 Rattus rattus aldehyde
           dehydrogenase (ALDH) mRNA, complete cds.
          Length = 501

 Score =  267 bits (683), Expect(2) = 2e-73
 Identities = 124/216 (57%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV K+  RA + V+G+P 
Sbjct: 277 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVRKSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 337 TQGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK ID+VIKRANNT YGLAAGV+T D+D+A T++  L+AG VW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSIDDVIKRANNTTYGLAAGVFTKDLDRAITVSSALQAGVVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 457 YMILSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 492



 Score = 32.3 bits (72), Expect(2) = 2e-73
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>sp|P51647|DHA1_RAT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase) (RALDH) (RalDH1).
          Length = 500

 Score =  267 bits (683), Expect(2) = 2e-73
 Identities = 124/216 (57%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV K+  RA + V+G+P 
Sbjct: 276 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVRKSVERAKKYVLGNPL 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 336 TQGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK ID+VIKRANNT YGLAAGV+T D+D+A T++  L+AG VW+NC
Sbjct: 396 AKEEIFGPVQQIMKFKSIDDVIKRANNTTYGLAAGVFTKDLDRAITVSSALQAGVVWVNC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 456 YMILSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 491



 Score = 32.3 bits (72), Expect(2) = 2e-73
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 259 KSNLKRVTLELGGKSP 274



>gb:AB176450_1411042 Oryctolagus cuniculus aldDH mRNA for aldehyde
           dehydrogenase, complete cds.
          Length = 496

 Score =  267 bits (682), Expect(2) = 2e-73
 Identities = 125/220 (56%), Positives = 164/220 (74%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 272 IVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 331

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
              V QGPQID EQ+ K+L  I SGK+  A LECGG   G+KGYFIQPT+FS+V ++M I
Sbjct: 332 APEVNQGPQIDKEQYNKILDLIESGKKQWAKLECGGGPWGNKGYFIQPTVFSNVTDEMRI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A+++IFGPVQ ++KFK +D+VIKRANNT YGL+AG++T D+DKA T++  L+AGTVW+NC
Sbjct: 392 AKEQIFGPVQQIMKFKSLDDVIKRANNTTYGLSAGIFTKDLDKAVTVSSALQAGTVWVNC 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y V  A +PFGG+KMSG GRE G Y L  Y +VK V   +
Sbjct: 452 YSVVSAQVPFGGFKMSGNGRELGEYGLQQYTEVKTVTVKI 491



 Score = 32.3 bits (72), Expect(2) = 2e-73
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 255 KSNLKRVTLELGGKSP 270



>gb:BC030589_1979857 Homo sapiens aldehyde dehydrogenase 1 family,
           member A2, transcript variant 2, mRNA (cDNA clone
           MGC:26444 IMAGE:4826743), complete cds.
          Length = 480

 Score =  268 bits (685), Expect(2) = 2e-73
 Identities = 130/224 (58%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV ++  RA RRVVG PF
Sbjct: 256 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPF 315

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 316 DPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 375

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA T++  ++AGTVWINC
Sbjct: 376 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINC 435

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 436 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 479



 Score = 31.2 bits (69), Expect(2) = 2e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 239 RSNLKRVTLELGGKSP 254



>gb:AF310252_2486808 Xenopus laevis RALDH2 mRNA, complete cds.
          Length = 518

 Score =  268 bits (684), Expect(2) = 3e-73
 Identities = 128/224 (57%), Positives = 166/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSRT+V + IY+EFV ++  RA RR+VG PF
Sbjct: 294 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRTFVEDSIYEEFVRRSVERAKRRIVGSPF 353

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ + +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 354 DPTTEQGPQTNKKQYNKILELIQSGITEGAKLECGGKALGRKGFFIEPTVFSNVADDMRI 413

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK ++EVI+RANN+ YGL A V+T+DI+KA T++  ++AGTVWINC
Sbjct: 414 AREEIFGPVQQILRFKTVEEVIERANNSDYGLVAAVFTNDINKALTVSSAMQAGTVWINC 473

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+  +A  PFGGYKMSG GRE G Y L  Y + K V    P KN
Sbjct: 474 YNALNAQSPFGGYKMSGNGREMGEYGLREYTEAKTVTIKIPQKN 517



 Score = 31.2 bits (69), Expect(2) = 3e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 277 RSNLKRVTLELGGKSP 292



>gb:AB015226_1864682 Homo sapiens mRNA for RALDH2, complete cds.
          Length = 518

 Score =  268 bits (684), Expect(2) = 3e-73
 Identities = 129/224 (57%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV ++  RA RR+VG PF
Sbjct: 294 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPF 353

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 354 DPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 413

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA T++  ++AGTVWINC
Sbjct: 414 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINC 473

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 474 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 517



 Score = 31.2 bits (69), Expect(2) = 3e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 277 RSNLKRVTLELGGKSP 292



>sp|O93344|DHAS_CHICK Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>gb:AF064253_2471394 Gallus gallus
           retinaldehyde dehydrogenase 2 (RALDH2) mRNA, complete
           cds.>gb:AF181680_2478897 Gallus gallus retinaldehyde
           dehydrogenase 2 (Raldh2) mRNA, complete cds.
          Length = 499

 Score =  268 bits (684), Expect(2) = 3e-73
 Identities = 131/224 (58%), Positives = 166/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR YV E IY+EFV ++  RA RRVVG PF
Sbjct: 275 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIYVEESIYEEFVRRSVERAKRRVVGSPF 334

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 335 DPTTEQGPQIDKKQYNKILELIQSGITEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 394

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA T++  ++AGTVWINC
Sbjct: 395 AKEEIFGPVQEILRFKTVDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINC 454

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+  +A  PFGG+KMSG GRE G   L  Y +VK V    P KN
Sbjct: 455 YNALNAQSPFGGFKMSGNGREMGESGLREYSEVKTVTIKIPQKN 498



 Score = 31.2 bits (69), Expect(2) = 3e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 258 RSNLKRVTLELGGKSP 273



>sp|O94788|DHA2_HUMAN Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).
          Length = 499

 Score =  268 bits (684), Expect(2) = 3e-73
 Identities = 129/224 (57%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV ++  RA RR+VG PF
Sbjct: 275 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPF 334

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 335 DPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 394

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA T++  ++AGTVWINC
Sbjct: 395 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINC 454

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 455 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 498



 Score = 31.2 bits (69), Expect(2) = 3e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 258 RSNLKRVTLELGGKSP 273



>gb:AB015227_1864683 Homo sapiens mRNA for RALDH2-T, complete
           cds.>gb:AB015228_1864684 Homo sapiens mRNA for RALDH2-T,
           complete cds.
          Length = 422

 Score =  268 bits (684), Expect(2) = 3e-73
 Identities = 129/224 (57%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV ++  RA RR+VG PF
Sbjct: 198 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPF 257

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 258 DPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 317

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA T++  ++AGTVWINC
Sbjct: 318 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINC 377

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 378 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 421



 Score = 31.2 bits (69), Expect(2) = 3e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 181 RSNLKRVTLELGGKSP 196



>gb:AF434845_2065705 Rattus norvegicus aldehyde dehydrogenase 6
           mRNA, complete cds.
          Length = 512

 Score =  269 bits (688), Expect(2) = 5e-73
 Identities = 131/230 (56%), Positives = 167/230 (72%), Gaps = 2/230 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +FFNQGQCC A SR +V E++Y EFV ++   A +R 
Sbjct: 283 GRNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRP 342

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  +G FI+PT+FSDV 
Sbjct: 343 VGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVT 402

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LKFK+++EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 403 DNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGT 462

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VW+NCY+ F A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 463 VWVNCYNAFYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLDEKNP 512



 Score = 28.9 bits (63), Expect(2) = 5e-73
 Identities = 12/16 (75%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGG++P
Sbjct: 271 RSNLKRVTLELGGRNP 286



>gb:BC069274_1987897 Homo sapiens aldehyde dehydrogenase 1 family,
           member A3, mRNA (cDNA clone MGC:78582 IMAGE:6208628),
           complete cds.
          Length = 512

 Score =  268 bits (684), Expect(2) = 7e-73
 Identities = 132/230 (57%), Positives = 165/230 (71%), Gaps = 2/230 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +FFNQGQCC A SR +V E++Y EFV ++   A +R 
Sbjct: 283 GKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRP 342

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  KG FI+PT+FS+V 
Sbjct: 343 VGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVT 402

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LKFK I+EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 403 DNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGT 462

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VWINCY+   A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 463 VWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLGDKNP 512



 Score = 30.0 bits (66), Expect(2) = 7e-73
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGK+P
Sbjct: 271 RSNLKRVTLELGGKNP 286



>sp|P47895|DHA6_HUMAN Aldehyde dehydrogenase 6 (EC
           1.2.1.5).>pir|A55684|A55684 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) 6 precursor, salivary -
           human>gb:HSU07919_2021848 Human aldehyde dehydrogenase 6
           mRNA, complete cds.
          Length = 512

 Score =  268 bits (684), Expect(2) = 7e-73
 Identities = 132/230 (57%), Positives = 165/230 (71%), Gaps = 2/230 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +FFNQGQCC A SR +V E++Y EFV ++   A +R 
Sbjct: 283 GKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRP 342

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  KG FI+PT+FS+V 
Sbjct: 343 VGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVT 402

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LKFK I+EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 403 DNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGT 462

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VWINCY+   A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 463 VWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLGDKNP 512



 Score = 30.0 bits (66), Expect(2) = 7e-73
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGK+P
Sbjct: 271 RSNLKRVTLELGGKNP 286



>gb:HSM806186_2018223 Homo sapiens mRNA; cDNA DKFZp686G1675 (from
           clone DKFZp686G1675); complete cds.
          Length = 416

 Score =  268 bits (684), Expect(2) = 7e-73
 Identities = 132/230 (57%), Positives = 165/230 (71%), Gaps = 2/230 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +FFNQGQCC A SR +V E++Y EFV ++   A +R 
Sbjct: 187 GKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRP 246

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  KG FI+PT+FS+V 
Sbjct: 247 VGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVT 306

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LKFK I+EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 307 DNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGT 366

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VWINCY+   A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 367 VWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLGDKNP 416



 Score = 30.0 bits (66), Expect(2) = 7e-73
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGK+P
Sbjct: 175 RSNLKRVTLELGGKNP 190



>gb:BC075704_2106719 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A2, mRNA (cDNA clone MGC:76772
           IMAGE:30471325), complete cds.
          Length = 518

 Score =  266 bits (680), Expect(2) = 9e-73
 Identities = 129/224 (57%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV+++  RA RR+VG PF
Sbjct: 294 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPF 353

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ KVL  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 354 DPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 413

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA  ++  ++AGTVWINC
Sbjct: 414 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINC 473

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 474 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 517



 Score = 31.2 bits (69), Expect(2) = 9e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 277 RSNLKRVTLELGGKSP 292



>gb:AF152359_2056754 Mus musculus aldehyde dehydrogenase-6 (Aldh6)
           mRNA, complete cds.
          Length = 512

 Score =  267 bits (683), Expect(2) = 9e-73
 Identities = 131/230 (56%), Positives = 166/230 (72%), Gaps = 2/230 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +FFNQGQCC A SR +V E++Y EFV ++   A +  
Sbjct: 283 GKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKSP 342

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  +G FI+PT+FSDV 
Sbjct: 343 VGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVT 402

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LKFK+++EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 403 DNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAALESGT 462

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VWINCY+ F A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 463 VWINCYNAFYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLEEKNP 512



 Score = 30.0 bits (66), Expect(2) = 9e-73
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGK+P
Sbjct: 271 RSNLKRVTLELGGKNP 286



>gb:BC087227_2565084 Xenopus laevis hypothetical LOC496110, mRNA
           (cDNA clone MGC:98380 IMAGE:7197199), complete cds.
          Length = 511

 Score =  266 bits (680), Expect(2) = 9e-73
 Identities = 129/224 (57%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV+++  RA RR+VG PF
Sbjct: 287 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPF 346

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ KVL  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 347 DPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 406

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA  ++  ++AGTVWINC
Sbjct: 407 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINC 466

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 467 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 510



 Score = 31.2 bits (69), Expect(2) = 9e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 270 RSNLKRVTLELGGKSP 285



>sp|Q62148|DHA2_MOUSE Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>pir|S74224|S74224 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) 2 -
           mouse>gb:AK078553_1172383 Mus musculus 12 days embryo
           female mullerian duct includes surrounding region cDNA,
           RIKEN full-length enriched library, clone:6820449I02
           product:aldehyde dehydrogenase family 1, subfamily A2,
           full insert sequence.>gb:MMRALDH2_2117154 M.musculus
           mRNA for retinaldehyde-specific dehydrogenase.
          Length = 499

 Score =  266 bits (680), Expect(2) = 9e-73
 Identities = 129/224 (57%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV+++  RA RR+VG PF
Sbjct: 275 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPF 334

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ KVL  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 335 DPTTEQGPQIDKKQYNKVLELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 394

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA  ++  ++AGTVWINC
Sbjct: 395 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINC 454

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 455 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 498



 Score = 31.2 bits (69), Expect(2) = 9e-73
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 258 RSNLKRVTLELGGKSP 273



>gb:AF152358_2477321 Gallus gallus aldehyde dehydrogenase-6 (ALDH6)
           mRNA, complete cds.>gb:AF246710_2482314 Gallus gallus
           retinaldehyde dehydrogenase 3 mRNA, complete cds.
          Length = 512

 Score =  266 bits (679), Expect(2) = 1e-72
 Identities = 128/225 (56%), Positives = 165/225 (73%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +F NQGQCC A SR +V E+IY EFV+++   A +R+
Sbjct: 283 GKNPCIVCADADLDLAVECAHQGVFLNQGQCCTAASRVFVEEQIYPEFVKRSVEYAKKRL 342

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  I  +G FI+PT+FS+V 
Sbjct: 343 VGDPFDARTEQGPQIDQKQFDKILELIESGKKEGAKLECGGLAIEDRGLFIKPTVFSEVT 402

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ ++KFK I+EVI+RANNT YGL A V+T ++D+A TLA  L++GT
Sbjct: 403 DNMRIAKEEIFGPVQPIMKFKSIEEVIRRANNTEYGLTAAVFTKNLDRALTLASALQSGT 462

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           VWINCY+   A  PFGG+KMSG GRE G Y+L  Y +VK V   L
Sbjct: 463 VWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKL 507



 Score = 31.2 bits (69), Expect(2) = 1e-72
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGK+P
Sbjct: 271 KSNLKRVTLELGGKNP 286



>gb:BC044729_2099010 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A1, mRNA (cDNA clone IMAGE:5098781), partial
           cds.
          Length = 511

 Score =  265 bits (676), Expect(2) = 1e-72
 Identities = 122/216 (56%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV+++  RA + V+G+P 
Sbjct: 287 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPL 346

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 347 TPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 406

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGLAAG++T D+DKA T++  L+AG VW+NC
Sbjct: 407 AKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNC 466

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 467 YMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 502



 Score = 32.3 bits (72), Expect(2) = 1e-72
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 270 KSNLKRVTLELGGKSP 285



>gb:AF253409_2060655 Mus musculus retinaldehyde dehydrogenase 3
           mRNA, complete cds.
          Length = 512

 Score =  267 bits (682), Expect(2) = 1e-72
 Identities = 131/230 (56%), Positives = 166/230 (72%), Gaps = 2/230 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D AVE AH  +FFNQGQCC A SR +V E++Y EFV ++   A +R 
Sbjct: 283 GKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYGEFVRRSVEFAKKRP 342

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  +G FI+PT+FSDV 
Sbjct: 343 VGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVT 402

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M  A++EIFGPVQ +LKFK+++EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 403 DNMRRAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAALESGT 462

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VWINCY+ F A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 463 VWINCYNAFYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLEEKNP 512



 Score = 30.0 bits (66), Expect(2) = 1e-72
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGK+P
Sbjct: 271 RSNLKRVTLELGGKNP 286



>gb:AP003048_1824454 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0710A02.
          Length = 507

 Score =  267 bits (683), Expect(2) = 1e-72
 Identities = 126/230 (54%), Positives = 164/230 (71%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA++D AV  +  A+FFN+G+ C AGSR YV E IYDEFV+KA   A    
Sbjct: 277 GKSPMIVFDDADVDMAVSLSSLAVFFNKGEICVAGSRVYVQEGIYDEFVKKAVEAAKNWK 336

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF      GPQ+D  QFE+VL+YI  GK  GATL  GG   G KGY+I+PTIF DVK
Sbjct: 337 VGDPFDAATNMGPQVDKVQFERVLKYIEIGKNEGATLLTGGKPTGDKGYYIEPTIFVDVK 396

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           E+M IAQ+EIFGPV  ++KFK ++E I++AN T YGLAAG+ T +++ AN ++R +RAGT
Sbjct: 397 EEMTIAQEEIFGPVMSLMKFKTVEEAIEKANCTKYGLAAGIVTKNLNIANMVSRSVRAGT 456

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           VW+NCY  FD   PFGGYKMSG GR++G+ +++ YLQVK V+T + +  W
Sbjct: 457 VWVNCYFAFDPDAPFGGYKMSGFGRDQGMVAMDKYLQVKTVITAVPDSPW 506



 Score = 29.6 bits (65), Expect(2) = 1e-72
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK V+LELGGKSP
Sbjct: 265 RSNLKNVSLELGGKSP 280



>sp|Q63639|DHA2_RAT Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>gb:RNU60063_2137521 Rattus
           norvegicus aldehyde dehydrogenase mRNA, complete cds.
          Length = 499

 Score =  266 bits (679), Expect(2) = 1e-72
 Identities = 128/224 (57%), Positives = 167/224 (74%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR +V E IY+EFV+++  RA RR+VG PF
Sbjct: 275 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVKRSVERAKRRIVGSPF 334

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 335 DPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 394

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA  ++  ++AGTVWINC
Sbjct: 395 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALMVSSAMQAGTVWINC 454

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           Y+  +A  PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 455 YNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 498



 Score = 31.2 bits (69), Expect(2) = 1e-72
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 258 RSNLKRVTLELGGKSP 273



>gb:S75713_2139306 ahd-2=acetaldehyde dehydrogenase [mice, BALB/c,
           livers, mRNA Partial, 1632 nt].
          Length = 501

 Score =  265 bits (676), Expect(2) = 1e-72
 Identities = 122/216 (56%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV+++  RA + V+G+P 
Sbjct: 277 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 337 TPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGLAAG++T D+DKA T++  L+AG VW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 457 YMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 492



 Score = 32.3 bits (72), Expect(2) = 1e-72
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>gb:BC054386_2101670 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A1, mRNA (cDNA clone MGC:62611 IMAGE:6477503),
           complete cds.
          Length = 501

 Score =  265 bits (676), Expect(2) = 1e-72
 Identities = 122/216 (56%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV+++  RA + V+G+P 
Sbjct: 277 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 337 TPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGLAAG++T D+DKA T++  L+AG VW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 457 YMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 492



 Score = 32.3 bits (72), Expect(2) = 1e-72
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>pir|JQ1004|JQ1004 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1
           precursor, cytosolic - mouse>gb:MUSAHD2F_2125057 Mouse
           aldehyde dehydrogenase II mRNA, complete cds.
          Length = 501

 Score =  265 bits (676), Expect(2) = 1e-72
 Identities = 122/216 (56%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV+++  RA + V+G+P 
Sbjct: 277 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 337 TPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGLAAG++T D+DKA T++  L+AG VW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 457 YIMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 492



 Score = 32.3 bits (72), Expect(2) = 1e-72
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>sp|P24549|DHA1_MOUSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  265 bits (676), Expect(2) = 1e-72
 Identities = 122/216 (56%), Positives = 165/216 (76%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F++QGQCC A SR +V E +YDEFV+++  RA + V+G+P 
Sbjct: 276 IVFADADLDIAVEFAHHGVFYHQGQCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPL 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ +K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 336 TPGINQGPQIDKEQHDKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGLAAG++T D+DKA T++  L+AG VW+NC
Sbjct: 396 AKEEIFGPVQQIMKFKSVDDVIKRANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y +  A  PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 456 YMMLSAQCPFGGFKMSGNGRELGEHGLYEYTELKTV 491



 Score = 32.3 bits (72), Expect(2) = 1e-72
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 259 KSNLKRVTLELGGKSP 274



>gb:AF106575_1241652 Caenorhabditis elegans cosmid K04F1, complete
           sequence.
          Length = 537

 Score =  265 bits (676), Expect(2) = 5e-72
 Identities = 126/224 (56%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AV  +H ALFFNQGQCC AGSRT+V  +IYDEFV KAK    + V+GDPF
Sbjct: 313 IVFADADLEEAVRQSHHALFFNQGQCCSAGSRTFVEGKIYDEFVAKAKELVEKTVIGDPF 372

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +   QGPQID  Q E +++YI SGK+ GA L  GG + G +GYF++PTIF++V + M I
Sbjct: 373 DENTTQGPQIDESQVETIMKYIESGKKEGAQLVTGGVKHGDQGYFVKPTIFANVNDQMKI 432

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  V++F  ++E+I++ANNT YGLAAGV T+D++KA  +A  +RAG+VW+NC
Sbjct: 433 AQEEIFGPVMIVIRFDSMEELIEKANNTIYGLAAGVVTNDLNKALQVANTIRAGSVWVNC 492

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVFD   PFGG+K SGIGRE G Y L  Y +VK V    P KN
Sbjct: 493 YDVFDPAAPFGGFKQSGIGRELGEYGLAAYTEVKTVTIKVPQKN 536



 Score = 30.0 bits (66), Expect(2) = 5e-72
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SN+K VTLELGGKSP
Sbjct: 296 ESNVKKVTLELGGKSP 311



>pir|D88956|D88956 protein K04F1.15 [imported] - Caenorhabditis
           elegans
          Length = 309

 Score =  265 bits (676), Expect(2) = 6e-72
 Identities = 126/224 (56%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AV  +H ALFFNQGQCC AGSRT+V  +IYDEFV KAK    + V+GDPF
Sbjct: 85  IVFADADLEEAVRQSHHALFFNQGQCCSAGSRTFVEGKIYDEFVAKAKELVEKTVIGDPF 144

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +   QGPQID  Q E +++YI SGK+ GA L  GG + G +GYF++PTIF++V + M I
Sbjct: 145 DENTTQGPQIDESQVETIMKYIESGKKEGAQLVTGGVKHGDQGYFVKPTIFANVNDQMKI 204

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  V++F  ++E+I++ANNT YGLAAGV T+D++KA  +A  +RAG+VW+NC
Sbjct: 205 AQEEIFGPVMIVIRFDSMEELIEKANNTIYGLAAGVVTNDLNKALQVANTIRAGSVWVNC 264

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVFD   PFGG+K SGIGRE G Y L  Y +VK V    P KN
Sbjct: 265 YDVFDPAAPFGGFKQSGIGRELGEYGLAAYTEVKTVTIKVPQKN 308



 Score = 30.0 bits (66), Expect(2) = 6e-72
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SN+K VTLELGGKSP
Sbjct: 68  ESNVKKVTLELGGKSP 83



>pir|D88449|D88449 protein F54D8.3 [imported] - Caenorhabditis
           elegans
          Length = 544

 Score =  263 bits (673), Expect(2) = 1e-71
 Identities = 124/224 (55%), Positives = 165/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA+++ +V  A+  LFFNQGQCCCAGSRT+V  +IYD+FV ++K  A + V+GDPF
Sbjct: 320 IIFADADLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPF 379

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QGPQ+D +Q E +L+YI +GK+ GA L  GG + G +G+F++PTIF++VK+ M I
Sbjct: 380 DLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTI 439

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  +++F  ++E++++ANNT YGLAAGV T DIDKA  +A   RAG+VW+NC
Sbjct: 440 AQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNC 499

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVFDA  PFGG+K SGIGRE G Y L  Y +VK V    P KN
Sbjct: 500 YDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKN 543



 Score = 30.0 bits (66), Expect(2) = 1e-71
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SN+K VTLELGGKSP
Sbjct: 303 ESNVKKVTLELGGKSP 318



>gb:BC081884_2108130 Rattus norvegicus aldehyde dehydrogenase 1
           family, member B1 (predicted), mRNA (cDNA clone
           MGC:93759 IMAGE:7108511), complete cds.
          Length = 519

 Score =  263 bits (672), Expect(2) = 1e-71
 Identities = 123/216 (56%), Positives = 162/216 (75%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AV+  H ALFFN GQCCCAGSRT+V E IY EF+E+   +A +R VG+PF
Sbjct: 295 IVLADADMDHAVDQCHEALFFNMGQCCCAGSRTFVEESIYHEFLERTVEKAKKRKVGNPF 354

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFEK+L YIR G++ GA L CGG+R G +G+FI+PT+F +V++DM I
Sbjct: 355 ELDTQQGPQVDKEQFEKILGYIRLGQKEGAKLLCGGERFGERGFFIKPTVFGNVQDDMRI 414

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK I+EVI+RANNT YGLAA V+T D+DKA   ++ L+AGTVW+N 
Sbjct: 415 AREEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKALYFSQALQAGTVWVNT 474

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++     PFGG+K SG GRE G   L  Y +VK V
Sbjct: 475 YNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTV 510



 Score = 30.4 bits (67), Expect(2) = 1e-71
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 279 SNLKRVTLELGGKSP 293



>gb:U12966_1401766 Caenorhabditis elegans cosmid F54D8, complete
           sequence.
          Length = 510

 Score =  263 bits (673), Expect(2) = 1e-71
 Identities = 124/224 (55%), Positives = 165/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA+++ +V  A+  LFFNQGQCCCAGSRT+V  +IYD+FV ++K  A + V+GDPF
Sbjct: 286 IIFADADLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPF 345

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QGPQ+D +Q E +L+YI +GK+ GA L  GG + G +G+F++PTIF++VK+ M I
Sbjct: 346 DLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTI 405

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  +++F  ++E++++ANNT YGLAAGV T DIDKA  +A   RAG+VW+NC
Sbjct: 406 AQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNC 465

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVFDA  PFGG+K SGIGRE G Y L  Y +VK V    P KN
Sbjct: 466 YDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKN 509



 Score = 30.0 bits (66), Expect(2) = 1e-71
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SN+K VTLELGGKSP
Sbjct: 269 ESNVKKVTLELGGKSP 284



>sp|Q27640|DHAL_ENCBU Aldehyde dehydrogenase (EC 1.2.1.3) (Aldehyde
           dehydrogenase [NAD+]).>pir|JC4924|JC4924 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) - earthworm
           (Enchytraeus buchholzi)>gb:EBALDH_1384127 E.buchholzi
           mRNA for aldehyde dehydrogenase.
          Length = 497

 Score =  262 bits (670), Expect(2) = 1e-71
 Identities = 128/223 (57%), Positives = 160/223 (71%), Gaps = 2/223 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  D+++D AVE +H A+  N GQ CCAGSRT+VHE IY+EFV ++  RA +R VGDPF
Sbjct: 274 IIFPDSDLDYAVEVSHQAIMANMGQVCCAGSRTFVHEDIYEEFVRRSVERAKKRTVGDPF 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               E GPQ+D  Q +K+L  I SGK  GA LECGG R+G KGYF++PT+F+DV   M +
Sbjct: 334 DPKNENGPQVDETQLKKILELIESGKTEGAKLECGGKRLGDKGYFVEPTVFTDVTSSMRV 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFKD+DEVI+RAN+T YGLAA V+T +ID A  +A  L AGTVW+N 
Sbjct: 394 AKEEIFGPVQLIFKFKDVDEVIERANDTSYGLAAAVFTKNIDTALKVANSLEAGTVWVNT 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLK 222
           Y+ F    PFGGYKMSG GRE G Y L  +L+VK V   TP K
Sbjct: 454 YNHFAFQAPFGGYKMSGQGREFGHYGLEAFLEVKTVYVRTPTK 496



 Score = 31.2 bits (69), Expect(2) = 1e-71
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           K+NLK VTLELGGKSP
Sbjct: 257 KTNLKRVTLELGGKSP 272



>gb:U12966_1401767 Caenorhabditis elegans cosmid F54D8, complete
           sequence.
          Length = 422

 Score =  263 bits (673), Expect(2) = 1e-71
 Identities = 124/224 (55%), Positives = 165/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA+++ +V  A+  LFFNQGQCCCAGSRT+V  +IYD+FV ++K  A + V+GDPF
Sbjct: 198 IIFADADLNDSVHQANHGLFFNQGQCCCAGSRTFVEGKIYDDFVARSKELAEKAVIGDPF 257

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QGPQ+D +Q E +L+YI +GK+ GA L  GG + G +G+F++PTIF++VK+ M I
Sbjct: 258 DLKTTQGPQVDGKQVETILKYIAAGKKDGAQLVTGGAKHGDQGHFVKPTIFANVKDQMTI 317

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  +++F  ++E++++ANNT YGLAAGV T DIDKA  +A   RAG+VW+NC
Sbjct: 318 AQEEIFGPVMTIIRFDTMEELVEKANNTIYGLAAGVMTKDIDKALHIANATRAGSVWVNC 377

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           YDVFDA  PFGG+K SGIGRE G Y L  Y +VK V    P KN
Sbjct: 378 YDVFDAAAPFGGFKQSGIGRELGEYGLEAYTEVKTVTIKVPQKN 421



 Score = 30.0 bits (66), Expect(2) = 1e-71
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SN+K VTLELGGKSP
Sbjct: 181 ESNVKKVTLELGGKSP 196



>pir|A32616|A32616 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) PB,
           cytosolic - rat>gb:RATALDH_2131446 Rat aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  260 bits (665), Expect(2) = 2e-71
 Identities = 124/216 (57%), Positives = 160/216 (74%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +FF+QGQ C A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 277 IVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ  K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 337 DSGISQGPQIDKEQHAKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK IDEVIKRANNT YGLAAGV+T D+D+A T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSIDEVIKRANNTPYGLAAGVFTKDLDRAITVSSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y       PFGG+KMSG GRE G   +  Y ++K V
Sbjct: 457 YLTLSVQCPFGGFKMSGNGREMGEQGVYEYTELKTV 492



 Score = 32.3 bits (72), Expect(2) = 2e-71
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>sp|P13601|DHAC_RAT Aldehyde dehydrogenase, cytosolic 1 (EC 1.2.1.3)
           (ALDH class 1) (ALHDII) (ALDH-E1).
          Length = 500

 Score =  260 bits (665), Expect(2) = 2e-71
 Identities = 124/216 (57%), Positives = 160/216 (74%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +FF+QGQ C A SR +V E IYDEFV ++  RA + V+G+P 
Sbjct: 276 IVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYVLGNPL 335

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ  K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 336 DSGISQGPQIDKEQHAKILDLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 395

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK IDEVIKRANNT YGLAAGV+T D+D+A T++  L+AGTVW+NC
Sbjct: 396 AKEEIFGPVQQIMKFKSIDEVIKRANNTPYGLAAGVFTKDLDRAITVSSALQAGTVWVNC 455

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y       PFGG+KMSG GRE G   +  Y ++K V
Sbjct: 456 YLTLSVQCPFGGFKMSGNGREMGEQGVYEYTELKTV 491



 Score = 32.3 bits (72), Expect(2) = 2e-71
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 259 KSNLKRVTLELGGKSP 274



>sp|P41751|DHAL_ASPNG Aldehyde dehydrogenase (EC 1.2.1.3)
           (ALDDH).>gb:ASNALDAA_1542172 Aspergillus niger aldehyde
           dehydrogenase (aldA) gene, complete cds.
          Length = 497

 Score =  260 bits (664), Expect(2) = 2e-71
 Identities = 118/216 (54%), Positives = 161/216 (74%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ +DA+ID A+  A+F +F+N GQCCCAGSR  V E IYD+F+ + K RA++  VGDPF
Sbjct: 273 IVFNDADIDNAISWANFGIFYNHGQCCCAGSRILVQEGIYDKFIARLKERALQNKVGDPF 332

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            K   QGPQ+   QF++++ YI+ GK++GAT+  GG+R G++GYFIQPT+F+DV  DM I
Sbjct: 333 AKDTFQGPQVSQLQFDRIMEYIQHGKDAGATVAVGGERHGTEGYFIQPTVFTDVTSDMKI 392

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            Q+EIFGPV  V KFKD+++ IK  N+T YGLAAG++T D+  A  ++  LRAGTVW+N 
Sbjct: 393 NQEEIFGPVVTVQKFKDVEDAIKIGNSTSYGLAAGIHTKDVTTAIRVSNALRAGTVWVNS 452

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++    +PFGG+K SGIGRE G Y+L NY Q+KAV
Sbjct: 453 YNLIQYQVPFGGFKESGIGRELGSYALENYTQIKAV 488



 Score = 32.7 bits (73), Expect(2) = 2e-71
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 256 KSNLKKVTLELGGKSP 271



>gb:AB020746_1514614 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MOB24.>gb:AY056398_1563706 Arabidopsis
           thaliana aldehyde dehydrogenase mRNA, complete
           cds.>gb:AF349448_1790192 Arabidopsis thaliana aldehyde
           dehydrogenase AtALDH1a mRNA, complete cds.
          Length = 501

 Score =  263 bits (672), Expect(2) = 3e-71
 Identities = 128/231 (55%), Positives = 160/231 (69%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    +I +DA+ID+A + A    F+N+G+ C A SR +V E IYD+ VEK   +A    
Sbjct: 271 GKSPLLIFNDADIDKAADLALLGCFYNKGEICVASSRVFVQEGIYDKVVEKLVEKAKDWT 330

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF     QGPQ+D  QFEK+L YI  GK  GATL  GG  IG KGYFIQPTIF+DV 
Sbjct: 331 VGDPFDSTARQGPQVDKRQFEKILSYIEHGKNEGATLLTGGKAIGDKGYFIQPTIFADVT 390

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           EDM I QDEIFGPV  ++KFK ++E IK ANNT YGLAAG+ + DID  NT++R ++AG 
Sbjct: 391 EDMKIYQDEIFGPVMSLMKFKTVEEGIKCANNTKYGLAAGILSQDIDLINTVSRSIKAGI 450

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           +W+NCY  FD   P+GGYKMSG  RE G+ +L+NYLQ K+VV PL N  W+
Sbjct: 451 IWVNCYFGFDLDCPYGGYKMSGNCRESGMDALDNYLQTKSVVMPLHNSPWM 501



 Score = 29.3 bits (64), Expect(2) = 3e-71
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK V+LELGGKSP
Sbjct: 260 SNLKKVSLELGGKSP 274



>gb:BT007781_2150713 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 1 family, member B1 mRNA, partial cds.
          Length = 518

 Score =  261 bits (666), Expect(2) = 6e-71
 Identities = 124/224 (55%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AVE  H ALFFN GQCCCAGSRT+V E IY+EF+E+   +A +R VG+PF
Sbjct: 293 IVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFE+VL YI+ G++ GA L CGG+R G +G+FI+PT+F  V++DM I
Sbjct: 353 ELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK I+EV++RANNT YGLAA V+T D+DKA    + L+AGTVW+N 
Sbjct: 413 AKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNT 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y++     PFGG+K SG GRE G   L  Y +VK V    P KN
Sbjct: 473 YNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 6e-71
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:BC001619_1967717 Homo sapiens aldehyde dehydrogenase 1 family,
           member B1, mRNA (cDNA clone MGC:2230 IMAGE:3356389),
           complete cds.>gb:BT007418_1990856 Homo sapiens aldehyde
           dehydrogenase 1 family, member B1 mRNA, complete cds.
          Length = 517

 Score =  261 bits (666), Expect(2) = 6e-71
 Identities = 124/224 (55%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AVE  H ALFFN GQCCCAGSRT+V E IY+EF+E+   +A +R VG+PF
Sbjct: 293 IVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFE+VL YI+ G++ GA L CGG+R G +G+FI+PT+F  V++DM I
Sbjct: 353 ELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK I+EV++RANNT YGLAA V+T D+DKA    + L+AGTVW+N 
Sbjct: 413 AKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNT 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y++     PFGG+K SG GRE G   L  Y +VK V    P KN
Sbjct: 473 YNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 6e-71
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:AL135785_1918684 Human DNA sequence from clone RP11-113O24 on
           chromosome 9p11-13.3 Contains a novel gene, possible
           ortholog of mouse insulin-like growth factor binding
           protein 7 (IGFBP7), a novel gene similar to aldehyde
           dehydrogenase 1 family, member B1 (ALDH5, ALDHX,
           MGC2230) (ALDH1B1), a novel gene and four CpG islands,
           complete sequence.
          Length = 517

 Score =  261 bits (666), Expect(2) = 6e-71
 Identities = 124/224 (55%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AVE  H ALFFN GQCCCAGSRT+V E IY+EF+E+   +A +R VG+PF
Sbjct: 293 IVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFE+VL YI+ G++ GA L CGG+R G +G+FI+PT+F  V++DM I
Sbjct: 353 ELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK I+EV++RANNT YGLAA V+T D+DKA    + L+AGTVW+N 
Sbjct: 413 AKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNT 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y++     PFGG+K SG GRE G   L  Y +VK V    P KN
Sbjct: 473 YNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 6e-71
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>pir|A40872|A40872 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 5
           precursor, mitochondrial - human
          Length = 517

 Score =  261 bits (666), Expect(2) = 6e-71
 Identities = 124/224 (55%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AVE  H ALFFN GQCCCAGSRT+V E IY+EF+E+   +A +R VG+PF
Sbjct: 293 IVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFE+VL YI+ G++ GA L CGG+R G +G+FI+PT+F  V++DM I
Sbjct: 353 ELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK I+EV++RANNT YGLAA V+T D+DKA    + L+AGTVW+N 
Sbjct: 413 AKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNT 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y++     PFGG+K SG GRE G   L  Y +VK V    P KN
Sbjct: 473 YNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 6e-71
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>sp|P30837|DHA5_HUMAN Aldehyde dehydrogenase X, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class
           2).>gb:HUMMTALD_2034921 Human mitochondrial aldehyde
           dehydrogenase x gene, complete cds.
          Length = 517

 Score =  261 bits (666), Expect(2) = 6e-71
 Identities = 124/224 (55%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AVE  H ALFFN GQCCCAGSRT+V E IY+EF+E+   +A +R VG+PF
Sbjct: 293 IVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFE+VL YI+ G++ GA L CGG+R G +G+FI+PT+F  V++DM I
Sbjct: 353 ELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK I+EV++RANNT YGLAA V+T D+DKA    + L+AGTVW+N 
Sbjct: 413 AKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNT 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y++     PFGG+K SG GRE G   L  Y +VK V    P KN
Sbjct: 473 YNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 6e-71
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>gb:AK012213_1156839 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700007F14
           product:aldehyde dehydrogenase 1 family, member B1, full
           insert sequence.>gb:AK088396_1175377 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430014M04 product:aldehyde
           dehydrogenase 1 family, member B1, full insert
           sequence.>gb:BC020001_2093199 Mus musculus aldehyde
           dehydrogenase 1 family, member B1, mRNA (cDNA clone
           MGC:28561 IMAGE:4207479), complete
           cds.>gb:BC086768_2109784 Mus musculus aldehyde
           dehydrogenase 1 family, member B1, mRNA (cDNA clone
           MGC:101971 IMAGE:6808412), complete cds.
          Length = 519

 Score =  260 bits (664), Expect(2) = 8e-71
 Identities = 124/224 (55%), Positives = 164/224 (73%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AV+  H ALFFN GQCCCAGSRT+V E IY EF+E+   +A +R VG+PF
Sbjct: 295 IVLADADMEHAVDQCHEALFFNMGQCCCAGSRTFVEESIYREFLERTVEKAKQRKVGNPF 354

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFE++L YIR G++ GA L CGG+R+G +G+FI+PT+F DV++ M I
Sbjct: 355 ELDTQQGPQVDKEQFERILGYIRLGQKEGAKLLCGGERLGERGFFIKPTVFGDVQDGMRI 414

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK I+EVI+RANNT YGLAA V+T D+DKA    + L+AGTVW+N 
Sbjct: 415 AKEEIFGPVQPLFKFKKIEEVIQRANNTRYGLAAAVFTRDLDKAIYFTQALQAGTVWVNT 474

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y++     PFGG+K SG GRE G   L  Y +VK V    P KN
Sbjct: 475 YNIVTCHTPFGGFKESGNGRELGEDGLRAYTEVKTVTIKVPEKN 518



 Score = 30.8 bits (68), Expect(2) = 8e-71
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 278 ESNLKRVTLELGGKSP 293



>gb:BC046315_2099162 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A7, mRNA (cDNA clone IMAGE:6314273), partial
           cds.
          Length = 507

 Score =  258 bits (660), Expect(2) = 8e-71
 Identities = 122/216 (56%), Positives = 160/216 (74%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +FF+QGQ C A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 283 IVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYILGNPL 342

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ  K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 343 NSGINQGPQIDKEQHNKILGLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 402

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGLAAGV+T D+DKA T++  L+AG VW+NC
Sbjct: 403 AKEEIFGPVQQIMKFKSMDDVIKRANNTTYGLAAGVFTKDLDKAITVSSALQAGMVWVNC 462

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y       PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 463 YLAVPVQCPFGGFKMSGNGRELGEHGLYEYTELKTV 498



 Score = 32.3 bits (72), Expect(2) = 8e-71
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 266 KSNLKRVTLELGGKSP 281



>gb:MMU96401_2124157 Mus musculus aldehyde dehydrogenase Ahd-2-like
           mRNA, complete cds.
          Length = 501

 Score =  258 bits (660), Expect(2) = 8e-71
 Identities = 122/216 (56%), Positives = 160/216 (74%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +FF+QGQ C A SR +V E IYDEFV ++  RA + ++G+P 
Sbjct: 277 IVFADADLDSAVEFAHQGVFFHQGQICVAASRLFVEESIYDEFVRRSVERAKKYILGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             G+ QGPQID EQ  K+L  I SGK+ GA LECGG R G+KG+F+QPT+FS+V ++M I
Sbjct: 337 NSGINQGPQIDKEQHNKILGLIESGKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +D+VIKRANNT YGLAAGV+T D+DKA T++  L+AG VW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSMDDVIKRANNTTYGLAAGVFTKDLDKAITVSSALQAGMVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y       PFGG+KMSG GRE G + L  Y ++K V
Sbjct: 457 YLAVPVQCPFGGFKMSGNGRELGEHGLYEYTELKTV 492



 Score = 32.3 bits (72), Expect(2) = 8e-71
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKRVTLELGGKSP 275



>gb:AF148508_1245135 Placopecten magellanicus aldehyde dehydrogenase
           mRNA, complete cds.>gb:AF175578_1247684 Placopecten
           magellanicus omega-crystallin mRNA, complete cds.
          Length = 492

 Score =  260 bits (665), Expect(2) = 1e-70
 Identities = 126/223 (56%), Positives = 158/223 (70%), Gaps = 2/223 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           ++  DA++D AVE  H  LFFN GQCCCA SRTYV E IYD F +K   +A  RVVGDPF
Sbjct: 269 VVFSDADLDIAVEACHNGLFFNMGQCCCAASRTYVQEDIYDVFTKKLVEKAKTRVVGDPF 328

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                 GPQ+D EQF+K+L  I SG + GA LECGG R G+ GYF+QPT+FS V EDM I
Sbjct: 329 DSRSMSGPQVDQEQFDKILALIDSGVQQGAKLECGGKRHGNVGYFVQPTVFSGVTEDMRI 388

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPVQ ++KFK ++EV++RAN T YGLAA + T DIDK  T +  ++AGTVW+N 
Sbjct: 389 GKEEIFGPVQQIIKFKTMEEVVQRANKTTYGLAAAICTKDIDKVMTYSSQVKAGTVWVNS 448

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLK 222
           ++VF A  PFGG+KMSGIGRE G   L  Y +VK ++  TP K
Sbjct: 449 FNVFGAQCPFGGFKMSGIGRELGESGLQQYSEVKTIIIKTPTK 491



 Score = 30.0 bits (66), Expect(2) = 1e-70
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           ++NLK VTLELGGKSP
Sbjct: 252 RTNLKRVTLELGGKSP 267



>gb:BX294151_770628 Pirellula sp. strain 1 complete genome; segment
           19/24.
          Length = 489

 Score =  265 bits (677), Expect(2) = 2e-70
 Identities = 124/220 (56%), Positives = 159/220 (72%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           +I  DA++D AV+ +   L+ NQGQCCCAGSR +V E I++ FVEK      +RVVG+PF
Sbjct: 270 VIFSDADLDAAVQGSFVGLYLNQGQCCCAGSRVFVEESIHEAFVEKLTDLTNKRVVGNPF 329

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   EQGPQID  QF+K++ YI  G + GA+   GG R G +GYFI+PT+F+DV++DM I
Sbjct: 330 EHTTEQGPQIDQAQFDKIMSYIDKGNQQGASCVSGGKRSGDRGYFIEPTVFTDVQDDMAI 389

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A+DEIFGPV  VL FKD D+++KRAN+T +GLAA V+T DI KA+  A  +RAGTVW+NC
Sbjct: 390 ARDEIFGPVMSVLSFKDSDDILKRANDTMFGLAAAVWTQDIKKAHHFAANVRAGTVWVNC 449

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           YDVFDA  PFGG+KMSG GRE G   L  YL+ K V   L
Sbjct: 450 YDVFDAAAPFGGFKMSGQGRELGTEGLKAYLESKTVTVAL 489



 Score = 24.3 bits (51), Expect(2) = 2e-70
 Identities = 10/14 (71%), Positives = 12/14 (85%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           +LK +T ELGGKSP
Sbjct: 255 SLKRLTFELGGKSP 268



>gb:CSA549290_1673847 Crocus sativus mRNA for aldehyde dehydrogenase
           (adh gene).
          Length = 506

 Score =  261 bits (666), Expect(2) = 3e-70
 Identities = 126/231 (54%), Positives = 160/231 (69%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA++D AV     A+FFN+G+ C AGSR YV E IYDEFV++A   A    
Sbjct: 276 GKSPMIVFDDADVDMAVSLNSLAVFFNKGEVCVAGSRVYVQEGIYDEFVKRAVEAARSWK 335

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF +    GPQ+D +QFE VL+YI  GK  GATL  GG     KGY+I+PTIF DV 
Sbjct: 336 VGDPFDQSRNMGPQVDKDQFESVLKYIEHGKSEGATLLTGGKPAADKGYYIEPTIFVDVT 395

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           EDM IAQ+EIFGPV  ++KFK ++E I  ANNT YGLAAG+ + D+D  NT++R ++AG 
Sbjct: 396 EDMKIAQEEIFGPVMSLMKFKTVEEGIDCANNTKYGLAAGILSQDLDLINTVSRSIKAGI 455

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAWI 207
           +W+NCY  FD   P+GGYKMSG  RE G+ +L+NYLQ K+VV PL N  W+
Sbjct: 456 IWVNCYFGFDLDCPYGGYKMSGNCRESGMDALDNYLQTKSVVMPLHNSPWL 506



 Score = 28.1 bits (61), Expect(2) = 3e-70
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK V+ ELGGKSP
Sbjct: 264 KSNLKNVSPELGGKSP 279



>gb:AF162770_2477781 Taeniopygia guttata class I aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 517

 Score =  257 bits (657), Expect(2) = 4e-70
 Identities = 126/216 (58%), Positives = 161/216 (74%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AH  +FFNQGQCC AGSR YV E IY+EFV K+  RA R++VG PF
Sbjct: 294 IIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIYVEESIYEEFVRKSVKRAKRKIVGSPF 353

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM I
Sbjct: 354 DPTTEQGPQIDKKQYNKILELIQSGITEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRI 413

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA T++  ++AGTVWINC
Sbjct: 414 AKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINC 473

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+  +A  PFGG K SG GRE G   L  Y +VK V
Sbjct: 474 YNALNAQSPFGGSK-SGNGREMGECGLREYSEVKTV 508



 Score = 31.2 bits (69), Expect(2) = 4e-70
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 277 RSNLKRVTLELGGKSP 292



>gb:CR860576_1184640 Pongo pygmaeus mRNA; cDNA DKFZp459D157 (from
           clone DKFZp459D157).
          Length = 517

 Score =  258 bits (658), Expect(2) = 5e-70
 Identities = 123/224 (54%), Positives = 163/224 (72%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+++ AVE  H ALFFN GQCCCAGSRT+V E IY+EF+E+   +A +R VG+PF
Sbjct: 293 IVLADADMEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLERTVEKAKQRKVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   +QGPQ+D EQFE+VL YI+ G++ GA L CGG+R G +G+FI+PT+F  V++DM I
Sbjct: 353 ELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERFGERGFFIKPTVFGGVQDDMRI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KFK ++EVI+RAN T YGLAA V+T D+DKA    + L+AGTVW+N 
Sbjct: 413 AKEEIFGPVQPLFKFKKMEEVIERANTTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNT 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y++     PFGG+K SG GRE G   L  Y +VK V    P KN
Sbjct: 473 YNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKVPQKN 516



 Score = 30.4 bits (67), Expect(2) = 5e-70
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 277 SNLKRVTLELGGKSP 291



>sp|P08157|DHAL_EMENI Aldehyde dehydrogenase (EC 1.2.1.3)
           (ALDDH).>pir|A29055|A29055 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) - Emericella nidulans>gb:EMEALDA_1676593
           A.nidulans aldA gene encoding aldehyde dehydrogenase,
           complete cds.
          Length = 497

 Score =  254 bits (650), Expect(2) = 9e-70
 Identities = 118/216 (54%), Positives = 158/216 (73%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ DDA+ID A+  A+F +FFN GQCCCAGSR  V E IYD+FV + K RA +  VG+PF
Sbjct: 272 IVFDDADIDNAISWANFGIFFNHGQCCCAGSRILVQEGIYDKFVARFKERAQKNKVGNPF 331

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           ++   QGPQ+   QF++++ YI  GK++GAT+  GGDR G++GYFIQPT+F+DV  DM I
Sbjct: 332 EQDTFQGPQVSQLQFDRIMEYINHGKKAGATVATGGDRHGNEGYFIQPTVFTDVTSDMKI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  + KFKD+ E IK  N+T YGLAA V+T +++ A  ++  L+AGTVWIN 
Sbjct: 392 AQEEIFGPVVTIQKFKDVAEAIKIGNSTDYGLAAAVHTKNVNTAIRVSNALKAGTVWINN 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++     PFGG+K SG+GRE G Y+L NY Q+K V
Sbjct: 452 YNMISYQAPFGGFKQSGLGRELGSYALENYTQIKTV 487



 Score = 32.7 bits (73), Expect(2) = 9e-70
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 255 KSNLKKVTLELGGKSP 270



>sp|Q29490|DHAE_MACPR Aldehyde dehydrogenase, cytosolic 1 (EC
           1.2.1.3) (ALDH class 1) (ETA-
           crystallin).>gb:MPU03906_1441244 Macroscelides
           proboscideus aldehyde dehydrogenase I, eta-crystallin
           mRNA, complete cds.
          Length = 501

 Score =  257 bits (656), Expect(2) = 2e-69
 Identities = 124/216 (57%), Positives = 158/216 (73%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F NQGQ C A S+ +V E IYDEFV+++  RA + V G+P 
Sbjct: 277 IVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEETIYDEFVQRSVERAKKYVFGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV  GPQI+  Q  K++  I SGK+ GA LECGG   G+KGYFIQPTIFS+V +DM I
Sbjct: 337 TPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPWGNKGYFIQPTIFSNVTDDMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +DEVIKRANNT+YGL AGV+T D+DKA T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVSSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y    A  P GG+KMSG GRE G Y ++ Y +VK V
Sbjct: 457 YLAASAQSPAGGFKMSGHGREMGEYGIHEYTEVKTV 492



 Score = 28.9 bits (63), Expect(2) = 2e-69
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELG K+P
Sbjct: 260 KSNLKRVTLELGAKNP 275



>sp|Q28399|DHAE_ELEED Aldehyde dehydrogenase, cytosolic 1 (EC
           1.2.1.3) (ALDH class 1) (ETA-
           crystallin).>gb:U02483_1446207 Elephantulus edwardi
           aldehyde dehydrogenase 1/eta-crystallin mRNA, complete
           cds.
          Length = 501

 Score =  256 bits (655), Expect(2) = 3e-69
 Identities = 123/216 (56%), Positives = 158/216 (73%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D AVE AH  +F NQGQ C A S+ +V E IYDEFV+++  RA + V G+P 
Sbjct: 277 IVFADADLDSAVEFAHQGVFTNQGQSCIAASKLFVEEAIYDEFVQRSVERAKKYVFGNPL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
             GV  GPQI+  Q  K++  I SGK+ GA LECGG   G+KGYFIQPT+FS+V +DM I
Sbjct: 337 TPGVNHGPQINKAQHNKIMELIESGKKEGAKLECGGGPWGNKGYFIQPTVFSNVTDDMRI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK +DEVIKRANNT+YGL AGV+T D+DKA T++  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVQQIMKFKSLDEVIKRANNTYYGLVAGVFTKDLDKAVTVSSALQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y    A  P GG+KMSG GRE G Y ++ Y +VK V
Sbjct: 457 YLAASAQSPAGGFKMSGHGREMGEYGIHEYTEVKTV 492



 Score = 28.9 bits (63), Expect(2) = 3e-69
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELG K+P
Sbjct: 260 KSNLKRVTLELGAKNP 275



>gb:AF260123_1781463 Aspergillus nidulans aldehyde dehydrogenase
           ALDH (aldA) gene, complete cds.
          Length = 497

 Score =  252 bits (644), Expect(2) = 4e-69
 Identities = 118/216 (54%), Positives = 157/216 (72%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ DDA+ID A+  A+F +FFN GQCCCAGSR  V E IYD+FV + K RA +  VG+PF
Sbjct: 272 IVFDDADIDNAISWANFGIFFNHGQCCCAGSRILVQEGIYDKFVARFKERAQKNKVGNPF 331

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           ++   QGPQ+   QF++++ YI  GK++GAT+  GGDR G++GYFIQPT+F+DV  DM I
Sbjct: 332 EQDTFQGPQVSQLQFDRIMEYINHGKKAGATVATGGDRHGNEGYFIQPTVFTDVTSDMKI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  + KFKD  E IK  N+T YGLAA V+T +++ A  ++  L+AGTVWIN 
Sbjct: 392 AQEEIFGPVVTIQKFKDEAEAIKIGNSTDYGLAAAVHTKNVNTAIRVSNALKAGTVWINN 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++     PFGG+K SG+GRE G Y+L NY Q+K V
Sbjct: 452 YNMISYQAPFGGFKQSGLGRELGSYALENYTQIKTV 487



 Score = 32.7 bits (73), Expect(2) = 4e-69
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 255 KSNLKKVTLELGGKSP 270



>gb:AF260124_1781464 Aspergillus nidulans aldehyde dehydrogenase
           ALDH15 (aldA) gene, aldA15 allele, complete cds.
          Length = 497

 Score =  251 bits (640), Expect(2) = 1e-68
 Identities = 117/216 (54%), Positives = 156/216 (72%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ DDA+ID A+   +F +FFN GQCCCAGSR  V E IYD+FV + K RA +  VG+PF
Sbjct: 272 IVFDDADIDNAISWVNFGIFFNHGQCCCAGSRILVQEGIYDKFVARFKERAQKNKVGNPF 331

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           ++   QGPQ+   QF++++ YI  GK++GAT+  GGDR G++GYFIQPT+F+DV  DM I
Sbjct: 332 EQDTFQGPQVSQLQFDRIMEYINHGKKAGATVATGGDRHGNEGYFIQPTVFTDVTSDMKI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  + KFKD  E IK  N+T YGLAA V+T +++ A  ++  L+AGTVWIN 
Sbjct: 392 AQEEIFGPVVTIQKFKDEAEAIKIGNSTDYGLAAAVHTKNVNTAIRVSNALKAGTVWINN 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++     PFGG+K SG+GRE G Y+L NY Q+K V
Sbjct: 452 YNMISYQAPFGGFKQSGLGRELGSYALENYTQIKTV 487



 Score = 32.7 bits (73), Expect(2) = 1e-68
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 255 KSNLKKVTLELGGKSP 270



>gb:HSM800910_1185982 Homo sapiens mRNA; cDNA DKFZp434N221 (from
           clone DKFZp434N221).
          Length = 217

 Score =  261 bits (667), Expect = 1e-68
 Identities = 125/216 (57%), Positives = 161/216 (74%), Gaps = 2/216 (0%)
 Frame = -2

Query: 860 DRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFKKGVEQGP 681
           D AVE AH  +FFNQGQCC AGSR +V E IY+EFV ++  RA RR+VG PF    EQGP
Sbjct: 1   DYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGP 60

Query: 680 QIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGP 501
           QID +Q+ K+L  I+SG   GA LECGG  +G KG+FI+PT+FS+V +DM IA++EIFGP
Sbjct: 61  QIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGP 120

Query: 500 VQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATI 321
           VQ +L+FK +DEVI+RANN+ +GL A V+T+DI+KA T++  ++AGTVWINCY+  +A  
Sbjct: 121 VQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQS 180

Query: 320 PFGGYKMSGIGREKGVYSLNNYLQVKAVVT--PLKN 219
           PFGG+KMSG GRE G + L  Y +VK V    P KN
Sbjct: 181 PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKN 216



>gb:AF339837_2488543 Danio rerio retinaldehyde dehydrogenase type 2
           (RALDH2) mRNA, complete cds.
          Length = 518

 Score =  251 bits (640), Expect(2) = 2e-68
 Identities = 120/216 (55%), Positives = 154/216 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA+ + A+E AH  +FFN GQCC AGSR +V E IYDEFV ++  RA RR VG+PF
Sbjct: 294 IIFADADFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPF 353

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               E GPQ+  EQ  +VL  I+SG   GA LECGG    +KG+F++PT+FS+VK+ M I
Sbjct: 354 DPTTEHGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPATKGFFVEPTVFSNVKDHMRI 413

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK I+EVI+RANNT YGLAA V+T DI KA T++  ++AGTVWINC
Sbjct: 414 AKEEIFGPVQQIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINC 473

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+      PFGG+KMSG GRE G   L  Y ++K +
Sbjct: 474 YNAMSCQCPFGGFKMSGNGRELGEIGLKEYTELKTI 509



 Score = 32.3 bits (72), Expect(2) = 2e-68
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 277 KSNLKRVTLELGGKSP 292



>gb:AF288764_2485043 Danio rerio retinaldehyde dehydrogenase 2
           (raldh2) mRNA, complete cds.
          Length = 518

 Score =  251 bits (640), Expect(2) = 2e-68
 Identities = 120/216 (55%), Positives = 154/216 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA+ + A+E AH  +FFN GQCC AGSR +V E IYDEFV ++  RA RR VG+PF
Sbjct: 294 IIFADADFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPF 353

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               E GPQ+  EQ  +VL  I+SG   GA LECGG    +KG+F++PT+FS+VK+ M I
Sbjct: 354 DPTTEHGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPATKGFFVEPTVFSNVKDHMRI 413

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK I+EVI+RANNT YGLAA V+T DI KA T++  ++AGTVWINC
Sbjct: 414 AKEEIFGPVQQIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINC 473

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+      PFGG+KMSG GRE G   L  Y ++K +
Sbjct: 474 YNALSCQCPFGGFKMSGNGRELGEIGLKEYTELKTI 509



 Score = 32.3 bits (72), Expect(2) = 2e-68
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 277 KSNLKRVTLELGGKSP 292



>gb:AF260125_1781465 Aspergillus nidulans aldehyde dehydrogenase
           ALDH57 (aldA) gene, aldA57 allele, complete cds.
          Length = 497

 Score =  250 bits (638), Expect(2) = 2e-68
 Identities = 117/216 (54%), Positives = 156/216 (72%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ DDA+ID A+  A+F +FFN GQCCCAGSR  V E IYD+FV + K RA +  VG+PF
Sbjct: 272 IVFDDADIDNAISWANFGIFFNHGQCCCAGSRILVQEGIYDKFVARFKERAQKNKVGNPF 331

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           ++   Q PQ+   QF++++ YI  GK++GAT+  GGDR G++GYFIQPT+F+DV  DM I
Sbjct: 332 EQDTFQSPQVSQLQFDRIMEYINHGKKAGATVATGGDRHGNEGYFIQPTVFTDVTSDMKI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  + KFKD  E IK  N+T YGLAA V+T +++ A  ++  L+AGTVWIN 
Sbjct: 392 AQEEIFGPVVTIQKFKDEAEAIKIGNSTDYGLAAAVHTKNVNTAIRVSNALKAGTVWINN 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++     PFGG+K SG+GRE G Y+L NY Q+K V
Sbjct: 452 YNMISYQAPFGGFKQSGLGRELGSYALENYTQIKTV 487



 Score = 32.7 bits (73), Expect(2) = 2e-68
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 255 KSNLKKVTLELGGKSP 270



>gb:AF315691_2487173 Danio rerio aldehyde dehydrogenase 1A2 mRNA,
           complete cds.
          Length = 518

 Score =  250 bits (638), Expect(2) = 3e-68
 Identities = 120/216 (55%), Positives = 154/216 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA+ + A+E AH  +FFN GQCC AGSR +V E IYDEFV ++  RA RR VG+PF
Sbjct: 294 IIFADADFELALEQAHQGVFFNNGQCCTAGSRIFVEEPIYDEFVRRSVERAQRRKVGNPF 353

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               E GPQ+  EQ  +VL  I+SG   GA LECGG    +KG+F++PT+FS+VK+ M I
Sbjct: 354 DPTTEHGPQVSEEQQRRVLELIQSGITEGAKLECGGKAPPTKGFFVEPTVFSNVKDHMRI 413

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ ++KFK I+EVI+RANNT YGLAA V+T DI KA T++  ++AGTVWINC
Sbjct: 414 AKEEIFGPVQQIMKFKTIEEVIERANNTEYGLAAAVFTRDISKAMTISAAVQAGTVWINC 473

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+      PFGG+KMSG GRE G   L  Y ++K +
Sbjct: 474 YNALSCQCPFGGFKMSGNGRELGEIGLKEYTELKTI 509



 Score = 32.3 bits (72), Expect(2) = 3e-68
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 277 KSNLKRVTLELGGKSP 292



>sp|P40108|DHAL_CLAHE Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)
           (Allergen Cla h 3) (Cla h III).>pir|S43114|S43114
           aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - fungus
           (Cladosporium herbarum)>gb:CHCLAH3_1646558 C.herbarum
           ClaH3 mRNA for aldehyde dehydrogenase.
          Length = 496

 Score =  249 bits (636), Expect(2) = 1e-67
 Identities = 117/216 (54%), Positives = 155/216 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ +DA+ID A+   +F +FFN GQCCCAGSR YV E IYD+FV+K K RA + VVGDPF
Sbjct: 271 IVFEDADIDNAISWVNFGIFFNHGQCCCAGSRVYVQESIYDKFVQKFKERAQKNVVGDPF 330

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QGPQ+   QF++++ YI++GK++GAT+E GG R G KGYFI+PTIFS+V EDM I
Sbjct: 331 AADTFQGPQVSKVQFDRIMEYIQAGKDAGATVETGGSRKGDKGYFIEPTIFSNVTEDMKI 390

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  + KFK  ++ IK  N + YGLAA V+T +++ A  ++  L+AGTVW+N 
Sbjct: 391 VKEEIFGPVCSIAKFKTKEDAIKLGNASTYGLAAAVHTKNLNTAIEVSNALKAGTVWVNT 450

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+     +PFGGYK SGIGRE G  +L NY Q K V
Sbjct: 451 YNTLHHQMPFGGYKESGIGRELGEDALANYTQTKTV 486



 Score = 30.8 bits (68), Expect(2) = 1e-67
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 255 SNLKKVTLELGGKSP 269



>sp|O74187|DHAL_AGABI Aldehyde dehydrogenase (EC 1.2.1.3)
           (ALDDH).>gb:ABY17825_1529986 Agaricus bisporus aldA and
           echA genes.
          Length = 500

 Score =  246 bits (627), Expect(2) = 5e-67
 Identities = 114/221 (51%), Positives = 158/221 (71%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    +I DDA+++++V      LF+N GQ CCAG+R +V E IYD+F++K   +     
Sbjct: 272 GKSPVVIFDDADLEQSVNWTAHGLFWNHGQACCAGTRIFVQEGIYDKFLQKFTDKIKEIK 331

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           +GDPF  G++QGPQ+   Q+++++ YI SG+  GAT+  GG+R G++GYFIQPTIF+D  
Sbjct: 332 LGDPFGLGIDQGPQVSQIQYDRIMSYIESGRAEGATVHVGGERHGNEGYFIQPTIFTDTT 391

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            DM I ++EIFGPV  V+KFKD  EVIK+AN+++YGLAA V++ DI+KA   A   +AGT
Sbjct: 392 PDMKIVKEEIFGPVGAVIKFKDGKEVIKQANDSNYGLAAAVFSQDINKAIETAHAFKAGT 451

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            W+NC +  DA +PFGGYK SGIGRE G Y+L+NY  VKAV
Sbjct: 452 AWVNCANTIDAGVPFGGYKQSGIGRELGEYALHNYTNVKAV 492



 Score = 32.3 bits (72), Expect(2) = 5e-67
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 260 KSNLKNVTLELGGKSP 275



>gb:OMMOMEGCRY_1391246 Ommastrephes sloanei omega-crystallin gene,
           complete cds.
          Length = 495

 Score =  254 bits (648), Expect = 2e-66
 Identities = 115/224 (51%), Positives = 162/224 (72%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           ++ +D  +D AV+ AH A F N GQC  +GSRTYVHE IYDEFV++A  +A  R  GDP+
Sbjct: 271 VVFEDTELDFAVQQAHEAAFQNMGQCRWSGSRTYVHENIYDEFVKRAVEKATSRKTGDPY 330

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   E GPQID EQ++K++ +I+ GK+ GA L+CGG+R G KG++++PT+FSDV ++M  
Sbjct: 331 EMDTEHGPQIDEEQYKKIMEFIKKGKDKGAQLKCGGNRHGDKGFYVEPTVFSDVTDEMKF 390

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           +Q+EIFGPVQ ++KFKD+DEVI R NNT YG+AA ++T+DI+++ T    +  GTVW+N 
Sbjct: 391 SQEEIFGPVQLIMKFKDMDEVIDRCNNTDYGMAAAIFTNDINRSITFTHAMYCGTVWVNT 450

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+ +    PFGGYK SG+ RE G Y+L  Y +VK +V   P KN
Sbjct: 451 YNHWFPQAPFGGYKKSGLYREMGKYTLQEYTEVKNIVYRIPQKN 494



>sp|P30842|CROM_OMMSL Omega-crystallin.
          Length = 494

 Score =  254 bits (648), Expect = 2e-66
 Identities = 115/224 (51%), Positives = 162/224 (72%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           ++ +D  +D AV+ AH A F N GQC  +GSRTYVHE IYDEFV++A  +A  R  GDP+
Sbjct: 270 VVFEDTELDFAVQQAHEAAFQNMGQCRWSGSRTYVHENIYDEFVKRAVEKATSRKTGDPY 329

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +   E GPQID EQ++K++ +I+ GK+ GA L+CGG+R G KG++++PT+FSDV ++M  
Sbjct: 330 EMDTEHGPQIDEEQYKKIMEFIKKGKDKGAQLKCGGNRHGDKGFYVEPTVFSDVTDEMKF 389

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           +Q+EIFGPVQ ++KFKD+DEVI R NNT YG+AA ++T+DI+++ T    +  GTVW+N 
Sbjct: 390 SQEEIFGPVQLIMKFKDMDEVIDRCNNTDYGMAAAIFTNDINRSITFTHAMYCGTVWVNT 449

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV--TPLKN 219
           Y+ +    PFGGYK SG+ RE G Y+L  Y +VK +V   P KN
Sbjct: 450 YNHWFPQAPFGGYKKSGLYREMGKYTLQEYTEVKNIVYRIPQKN 493



>gb:NCB11B23_1688984 Neurospora crassa DNA linkage group II BAC
           clone B11B23.
          Length = 494

 Score =  244 bits (624), Expect(2) = 2e-66
 Identities = 118/220 (53%), Positives = 157/220 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II +DA+ID+A++  +F ++FN GQ CCAGSR YV E IYD+FV   K RA +  VGDPF
Sbjct: 274 IIFNDADIDQAIDWVNFGIYFNHGQTCCAGSRVYVQEGIYDKFVAAFKQRAQQNKVGDPF 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QGPQ+   Q+++++ YI++GKE GAT+E GG+R G KGYFIQPTIF++V+ DM I
Sbjct: 334 HDETFQGPQVSQLQYDRIMGYIKAGKEEGATVETGGERHGDKGYFIQPTIFTNVRHDMKI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V KF   +EVIK  N+++YGLAA V+T D++ A  ++  LRAGTVW+N 
Sbjct: 394 MKEEIFGPVCAVAKFSTEEEVIKLGNDSNYGLAAAVHTKDLNTAIRVSNHLRAGTVWVNT 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y+     +PFGGYK SGIGRE G  +L NY Q K+V   L
Sbjct: 454 YNALHHQLPFGGYKESGIGRELGEAALANYTQCKSVAIKL 493



 Score = 31.2 bits (69), Expect(2) = 2e-66
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 257 ESNLKKVTLELGGKSP 272



>sp|O14293|YF19_SCHPO Hypothetical aldehyde-dehydrogenase like
           protein C9E9.09c (EC 1.2.1.-).>pir|T39216|T39216
           aldehyde dehydrogenase - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC9E9_1718517 S.pombe
           chromosome I cosmid c9E9.
          Length = 503

 Score =  244 bits (624), Expect(2) = 3e-66
 Identities = 114/216 (52%), Positives = 153/216 (70%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ +DA++D A    ++ +F+N GQ CCAGSR YV E +YDEF+++  A+A    VGDPF
Sbjct: 278 IVFNDADLDSAAVWTNYGIFYNSGQVCCAGSRVYVQEDVYDEFIKRMVAKAKTLKVGDPF 337

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +   QG Q+  +Q+E+++ YI SG   GA LE GG R G+ GYF++PTI S+V EDM +
Sbjct: 338 AEDTFQGAQVSKQQYERIVSYIESGIAHGAKLEIGGKRHGNLGYFVEPTILSNVTEDMAV 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V+KFK I+E I+R NN+ YGLAAGV+T++I  A  ++  L AGTVW+NC
Sbjct: 398 GKEEIFGPVLAVIKFKTIEEAIRRGNNSTYGLAAGVHTNNITNAIKVSNALEAGTVWVNC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++    IPFGGYK SGIGRE G Y L NY Q KAV
Sbjct: 458 YNLLHHQIPFGGYKESGIGRELGSYGLTNYTQTKAV 493



 Score = 30.8 bits (68), Expect(2) = 3e-66
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 262 SNLKKVTLELGGKSP 276



>sp|P42041|DHAL_ALTAL Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)
           (Allergen Alt a 10) (Alt a X).>pir|S43108|S43108
           aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - Alternaria
           alternata>gb:AAALTA2_1508147 A.alternata AltA2 mRNA for
           aldehyde dehydrogenase.
          Length = 495

 Score =  244 bits (623), Expect(2) = 4e-66
 Identities = 118/216 (54%), Positives = 155/216 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D A+   +F ++FN GQ CCAGSR YV E IYD+F+++ K RA +  VGDPF
Sbjct: 271 IVFADADLDEAIHWVNFGIYFNHGQACCAGSRIYVQEEIYDKFIQRFKERAAQNAVGDPF 330

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
              + QGPQ+   QF++++ YI  GK+SGAT+E GG+R G KGYFI+PTIFS+V EDM I
Sbjct: 331 AATL-QGPQVSQLQFDRIMGYIEEGKKSGATIETGGNRKGDKGYFIEPTIFSNVTEDMKI 389

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            Q+EIFGPV  + KFK   +VIK  NNT YGL+A V+TS++  A  +A  LRAGTVW+N 
Sbjct: 390 QQEEIFGPVCTISKFKTKADVIKIGNNTTYGLSAAVHTSNLTTAIEVANALRAGTVWVNS 449

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+     +PFGGYK SGIGRE G  +L+NY+Q K V
Sbjct: 450 YNTLHWQLPFGGYKESGIGRELGEAALDNYIQTKTV 485



 Score = 30.8 bits (68), Expect(2) = 4e-66
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 255 SNLKKVTLELGGKSP 269



>pir|T43153|T43153 probable aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) - fission yeast (Schizosaccharomyces
           pombe)>gb:D89246_1675363 Schizosaccharomyces pombe mRNA,
           partial cds, clone: SY 1574.
          Length = 250

 Score =  243 bits (621), Expect(2) = 7e-66
 Identities = 114/216 (52%), Positives = 152/216 (70%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ +DA++D A    ++ +F+N GQ CCAGSR YV E +YDEF+++  A+A    VGDPF
Sbjct: 25  IVFNDADLDSAAVWTNYGIFYNSGQVCCAGSRVYVQEDVYDEFIKRMVAKAKTLKVGDPF 84

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +   QG Q+  +Q+E+++ YI SG   GA LE GG R G  GYF++PTI S+V EDM +
Sbjct: 85  AEDTFQGAQVSKQQYERIVSYIESGIAHGAKLEIGGKRHGYLGYFVEPTILSNVTEDMAV 144

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V+KFK I+E I+R NN+ YGLAAGV+T++I  A  ++  L AGTVW+NC
Sbjct: 145 GKEEIFGPVLAVIKFKTIEEAIRRGNNSTYGLAAGVHTNNITNAIKVSNALEAGTVWVNC 204

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y++    IPFGGYK SGIGRE G Y L NY Q KAV
Sbjct: 205 YNLLHHQIPFGGYKESGIGRELGSYGLTNYTQTKAV 240



 Score = 30.8 bits (68), Expect(2) = 7e-66
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 9   SNLKKVTLELGGKSP 23



>gb:AF275347_1782534 Cladosporium fulvum aldehyde dehydrogenase
           (aldh) mRNA, complete cds.
          Length = 497

 Score =  242 bits (617), Expect(2) = 2e-65
 Identities = 115/216 (53%), Positives = 155/216 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ DDA+ID A+   +F +FFN GQ CCAGSR YV E IYD+F+++ K RA + VVGDPF
Sbjct: 272 IVFDDADIDNAISWVNFGIFFNHGQRCCAGSRIYVQEGIYDKFLQRFKERAQKNVVGDPF 331

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QGPQ+   QF++++ YI++G+++GAT+E GG+R G KGYFI+PTIF++V EDM I
Sbjct: 332 AADTFQGPQVSQVQFDRIMGYIQAGRDAGATVEIGGNRKGDKGYFIEPTIFANVTEDMKI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            Q+EIFGPV  + KFK  ++ IK  N T YGLAA V+T +++ A  ++  LRAGTVW+N 
Sbjct: 392 MQEEIFGPVCSISKFKTKEDAIKVGNATPYGLAAAVHTRNLNTAIEVSNALRAGTVWVNT 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+     +PFGG+K SGIGRE G  +L NY Q K V
Sbjct: 452 YNTLHHQLPFGGFKESGIGRELGEDALANYTQTKTV 487



 Score = 30.8 bits (68), Expect(2) = 2e-65
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 256 SNLKKVTLELGGKSP 270



>gb:BOR548846_1633873 Bixa orellana mRNA for aldehyde dehydrogenase
           (adh gene).
          Length = 504

 Score =  240 bits (613), Expect(2) = 2e-64
 Identities = 121/232 (52%), Positives = 155/232 (66%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKA--KARAMR 726
           G    II DDA++D AV  +  A F N+G+ C A SR YV E IYD  V+K    AR  R
Sbjct: 278 GKSPVIIFDDADVDMAVSLSQLACFTNKGEICVATSRVYVQEGIYDALVKKIVEAAREWR 337

Query: 725 RVVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSD 546
                 F      GPQ+D +QFE+VL+YI  GK  GATL  GG   G KGY+IQPTIF D
Sbjct: 338 ------FDTKANMGPQVDKKQFERVLKYIDLGKREGATLLTGGKTNGDKGYYIQPTIFLD 391

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           V+EDM IAQDE+FGPV  ++KFK +DE I++AN T YGLAAG+ T +++ ANT++R +RA
Sbjct: 392 VREDMNIAQDELFGPVMALMKFKTVDEAIQKANCTKYGLAAGIVTKELNLANTVSRSIRA 451

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NCY  FD   PFGGYKMSG G+++GV +++ YL+ K V T + N  W
Sbjct: 452 GAVWVNCYFGFDPDAPFGGYKMSGFGKDRGVLAIDQYLKAKTVNTAIPNSPW 503



 Score = 29.3 bits (64), Expect(2) = 2e-64
 Identities = 13/16 (81%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK V+LELGGKSP
Sbjct: 266 QSNLKNVSLELGGKSP 281



>gb:UMU74468_1726880 Ustilago maydis cytosolic indole-3-acetaldehyde
           dehydrogenase (iad1) gene, complete cds.
          Length = 497

 Score =  239 bits (611), Expect(2) = 2e-64
 Identities = 119/224 (53%), Positives = 153/224 (68%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D+AV  + F + FN GQCCCAGSR YV E IYD F+EK  A      VGDPF
Sbjct: 273 IIFKDADLDQAVRWSAFGIMFNHGQCCCAGSRVYVEESIYDAFMEKMTAHCKALQVGDPF 332

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QGPQ+   Q+++++ YI SGK+  A L  GG R G++GYFI+PTIF+DV  D  I
Sbjct: 333 SANTFQGPQVSQLQYDRIMEYIESGKKD-ANLALGGVRKGNEGYFIEPTIFTDVPHDAKI 391

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  V KFKD  ++I+ AN++ YGLAA V++ DI +A   A  L+AGTVW+NC
Sbjct: 392 AKEEIFGPVVVVSKFKDEKDLIRIANDSIYGLAAAVFSRDISRAIETAHKLKAGTVWVNC 451

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPA 213
           Y+     +PFGGYK SGIGRE G Y+L+NY  +KAV   L  PA
Sbjct: 452 YNQLIPQVPFGGYKASGIGRELGEYALSNYTNIKAVHVNLSQPA 495



 Score = 29.6 bits (65), Expect(2) = 2e-64
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           +NLK VTLELGGKSP
Sbjct: 257 TNLKKVTLELGGKSP 271



>gb:CR382131_1663463 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 522

 Score =  239 bits (610), Expect(2) = 6e-64
 Identities = 115/227 (50%), Positives = 151/227 (66%), Gaps = 2/227 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II DDAN++ A+  A   +FFN G+ CCAGSR +V   +YD+ VE  K +A    VGDPF
Sbjct: 292 IIFDDANLEDALSAAALGIFFNSGEVCCAGSRLFVQAGVYDQVVEAFKKKAESVKVGDPF 351

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSDVKEDM 531
                QGPQ +  QF+K+L YI  G++ GA L CGG      +KGYFIQPT+F+DV  DM
Sbjct: 352 DPNSLQGPQQNKNQFKKILGYIEQGQKEGAHLLCGGSAQAGPNKGYFIQPTVFTDVNNDM 411

Query: 530 VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI 351
            I ++EIFGPV  + KF  +DEVI  AN++ YGLAAG++T+DI+KA+ +A  + +GT+W+
Sbjct: 412 SIVREEIFGPVLTITKFNTVDEVIDMANDSEYGLAAGIHTTDINKAHYVAENIASGTIWV 471

Query: 350 NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           NCY+ F   +PFGGYK SG G+E G   L NYLQ KAV   L    W
Sbjct: 472 NCYNAFHEAVPFGGYKQSGFGKEMGRDGLENYLQTKAVRVKLDERKW 518



 Score = 28.5 bits (62), Expect(2) = 6e-64
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK  T+ELGGKSP
Sbjct: 276 SNLKKTTMELGGKSP 290



>sp|P46367|DHA4_YEAST Potassium-activated aldehyde dehydrogenase,
           mitochondrial precursor (EC 1.2.1.3) (K(+)-activated
           acetaldehyde dehydrogenase)
           (K(+)-ACDH).>pir|S67286|S67286 probable aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) YOR374w - yeast
           (Saccharomyces cerevisiae)>gb:SCYOR374W_1714630
           S.cerevisiae chromosome XV reading frame ORF YOR374w.
          Length = 519

 Score =  239 bits (611), Expect(2) = 1e-63
 Identities = 116/216 (53%), Positives = 152/216 (70%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA + +AV++    +++N G+ CCAGSR YV E IYD+F+E+ KA +    VGDPF
Sbjct: 298 IVFADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPF 357

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +   QG Q    Q  K+L+Y+  GK  GATL  GG+R+GSKGYFI+PT+F DVKEDM I
Sbjct: 358 DESTFQGAQTSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRI 417

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V KFK  DEVI  AN++ YGLAAG++TS+I+ A  +A  + AGTVWIN 
Sbjct: 418 VKEEIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINT 477

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+ F   +PFGG+  SG+GRE  V +L NYLQVKAV
Sbjct: 478 YNDFHHAVPFGGFNASGLGREMSVDALQNYLQVKAV 513



 Score = 27.3 bits (59), Expect(2) = 1e-63
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           + LK VTLELGGKSP
Sbjct: 282 AGLKKVTLELGGKSP 296



>gb:CR382126_1658362 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 522

 Score =  237 bits (605), Expect(2) = 1e-63
 Identities = 113/221 (51%), Positives = 157/221 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           ++  DAN+  AV+++   +++N G+ CCAGSR YV E IYD+F+++ K+ +    VGDPF
Sbjct: 302 VVFADANLKSAVQNSLLGIYYNSGEVCCAGSRLYVEESIYDDFLKEIKSASEALKVGDPF 361

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QG Q    Q +K+L+Y+  GK  GATL  GG+RIG KGYF++PTIF+DV+E M I
Sbjct: 362 DAETFQGAQTSQNQLDKILKYVEIGKNEGATLITGGERIGDKGYFVRPTIFADVEESMRI 421

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V KFK IDE+I++AN++ YGLAAG++TS+I+ A  ++  L AGTVWIN 
Sbjct: 422 VKEEIFGPVVTVTKFKTIDELIEKANDSEYGLAAGIHTSNINTAIQVSNRLNAGTVWINT 481

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
           Y+ F   +PFGG+  SGIGRE G  +L+NY QVKAV   L+
Sbjct: 482 YNDFHHCVPFGGFNASGIGREMGSEALDNYTQVKAVRVKLE 522



 Score = 29.3 bits (64), Expect(2) = 1e-63
 Identities = 13/14 (92%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           NLK VTLELGGKSP
Sbjct: 287 NLKKVTLELGGKSP 300



>gb:CR382123_1655809 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 514

 Score =  239 bits (609), Expect(2) = 3e-63
 Identities = 112/223 (50%), Positives = 158/223 (70%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D+AV++  F +F+N G+ CCAGSR YV + +Y+E +EK K  A    VG+PF
Sbjct: 290 IVFGDADLDKAVKNIAFGIFYNSGEVCCAGSRIYVQDTVYEEVLEKFKQYAESLKVGNPF 349

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           ++ V QG Q    Q +K+L Y+  G   GA +  GG+RIG+KGYFI+PTIF+DVKEDM I
Sbjct: 350 EENVFQGAQTSQMQIDKILSYVDVGTSEGARVITGGERIGNKGYFIKPTIFADVKEDMQI 409

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V KF  +DEV+ +AN++ YGLAAG++T D++KA  ++  ++AGTVWIN 
Sbjct: 410 VKEEIFGPVVTVSKFTTVDEVVAKANDSEYGLAAGIHTKDVNKAIDVSNRVKAGTVWINT 469

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP 216
           Y+ F   +PFGG+  SGIGRE G  +L+NY Q KAV   + +P
Sbjct: 470 YNNFHQNVPFGGFGQSGIGREMGAEALDNYTQTKAVRMAIDHP 512



 Score = 26.6 bits (57), Expect(2) = 3e-63
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           ++K VTLELGGKSP
Sbjct: 275 SIKKVTLELGGKSP 288



>gb:HUMALDH16_2029125 Human aldehyde dehydrogenase I mRNA, partial
           cds.
          Length = 287

 Score =  234 bits (597), Expect(2) = 5e-63
 Identities = 116/207 (56%), Positives = 140/207 (67%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++D AVE AHFALFFNQGQCCCAGSRT+V E IYDEFV ++ ARA  RVVG+PF
Sbjct: 80  IIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVVRSVARAKSRVVGNPF 139

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
               EQGPQ+D  QF+K+L YI +GK+ GA L CGG     +GYFIQPT+F DV++ M I
Sbjct: 140 DSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTI 199

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV  +L+ +D       +   H    A V+   I          +AGTVW+NC
Sbjct: 200 AKEEIFGPVMQILEVQDHRGGCWESQQFHVRAGAAVFAQRIWTRPITCPSPQAGTVWVNC 259

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSL 264
           YDVF A  PFGGYKMSG GRE G Y L
Sbjct: 260 YDVFGAQSPFGGYKMSGSGRELGEYGL 286



 Score = 30.4 bits (67), Expect(2) = 5e-63
 Identities = 14/15 (93%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK VTLELGGKSP
Sbjct: 64  SNLKRVTLELGGKSP 78



>gb:AE016816_1746648 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 513

 Score =  237 bits (604), Expect(2) = 2e-62
 Identities = 111/216 (51%), Positives = 155/216 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA+ID+AV++  F +F+N G+ CCAGSR YV + +YDE +EK K  +    VG+PF
Sbjct: 289 IVFADADIDKAVKNIGFGIFYNAGEVCCAGSRVYVQDSVYDEVLEKFKQFSENLKVGNPF 348

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           ++GV QG Q    Q +K+L Y+  G + GA +  GG+R+G KG+FI+PTIF+DV E+M +
Sbjct: 349 EEGVFQGAQTSQMQVDKILSYVDIGVKEGARIVAGGERLGRKGFFIKPTIFADVNENMRV 408

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            +DEIFGPV  V KF  +DEVI  ANN+ YGLAAG++T+DI+KA  ++  ++AGTVW+N 
Sbjct: 409 VKDEIFGPVVTVSKFSTVDEVIAMANNSQYGLAAGIHTTDINKAIDVSNQIKAGTVWVNT 468

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+ F   +PFGG+  SGIG E GV +L+NY Q KAV
Sbjct: 469 YNDFHPNVPFGGFGQSGIGSEMGVQALDNYTQTKAV 504



 Score = 25.8 bits (55), Expect(2) = 2e-62
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 275 VKKVTLELGGKSP 287



>gb:CR382139_1672150 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 521

 Score =  229 bits (583), Expect(2) = 1e-61
 Identities = 107/216 (49%), Positives = 150/216 (69%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ +DA++ ++ +     +F+N G+ CCAGSR YV E IYD  +E+ K  + +  +G+PF
Sbjct: 298 IVFNDADVQKSAQSLITGIFYNTGEVCCAGSRIYVQEEIYDNVLEELKNASSKIKIGNPF 357

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           ++    G Q  S+Q +K+L+YI +GK  GA L  GG+R+  KGYFI+PTIF DV EDM I
Sbjct: 358 EEDTFMGAQASSQQLDKILKYIETGKNEGAKLISGGERVQGKGYFIKPTIFGDVTEDMQI 417

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  + KFK IDEV+  AN++ YGLAAG++T +I+ A  +A  L+AGTVW+N 
Sbjct: 418 VKEEIFGPVVTITKFKTIDEVVDLANDSEYGLAAGIHTENINTAIGVANRLQAGTVWVNT 477

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+ F   +PFGGY  SG GRE G  +L+NY QVKAV
Sbjct: 478 YNDFHPMVPFGGYGQSGFGREMGAEALDNYTQVKAV 513



 Score = 31.2 bits (69), Expect(2) = 1e-61
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 281 ESNLKKVTLELGGKSP 296



>sp|Q25417|DHAM_LEITA Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2)
           (P51).>pir|S43184|S43184 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) precursor, mitochondrial - Leishmania
           tarentolae>gb:LTALDDE_1389226 L.tarentolae (UC) gene for
           aldehyde dehydrogenase.
          Length = 498

 Score =  234 bits (596), Expect(2) = 2e-61
 Identities = 113/221 (51%), Positives = 152/221 (68%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C+DA+++ A E A   ++FN GQ C A SR YVHE +YDEFV + +  A  R 
Sbjct: 268 GKSALIVCEDADLEEAAEVATTRVYFNTGQVCTASSRIYVHESVYDEFVSRLRKNAEARK 327

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VG     G   GP +  +Q E+VL YI  G ++GAT+  GG +IG KGYF+QPTIFSDVK
Sbjct: 328 VGPGNDTGNNMGPLVSKKQHERVLGYIEDGVKAGATVVTGGKKIGDKGYFVQPTIFSDVK 387

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           EDM I ++EIFGPV CV+K+KD+DEV+KRAN++ YGLAAG+ T  +D A   +  L AGT
Sbjct: 388 EDMRICKEEIFGPVTCVMKYKDMDEVVKRANDSIYGLAAGICTRSMDTALRYSTYLNAGT 447

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           VW+N ++ F  ++PFGG+K SGIGRE G   ++ Y + KA+
Sbjct: 448 VWVNTWNNFCPSMPFGGFKQSGIGRELGKEVVDMYTEPKAI 488



 Score = 25.8 bits (55), Expect(2) = 2e-61
 Identities = 11/15 (73%), Positives = 14/15 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           ++NLK V+LELGGKS
Sbjct: 256 ETNLKKVSLELGGKS 270



>gb:CR380956_1652119 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 517

 Score =  233 bits (593), Expect(2) = 2e-61
 Identities = 107/223 (47%), Positives = 154/223 (69%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++++AVE+    +FFN G+ CCAGSR YV ++ YDE +++ K       VG+PF
Sbjct: 293 IVFADADLEQAVENIAHGIFFNSGEVCCAGSRIYVQDKCYDEVLDRLKKYTESLKVGNPF 352

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                QG Q   +Q +K+L Y+  GK+ GA +  GG+RIG KGYF +PT+F+DVKE+M I
Sbjct: 353 GDNTYQGSQTSQQQLDKILEYVDIGKQEGARIVTGGERIGEKGYFFKPTVFADVKENMRI 412

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            +DEIFGP+  V +F  +DEVI  AN++ YGLAAG++T+D++KA  ++  L+AGT+WIN 
Sbjct: 413 VKDEIFGPIVTVSQFSTVDEVIAMANDSQYGLAAGIHTNDVNKAVEVSSRLKAGTIWINT 472

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP 216
           Y+ F   +PFGG+  SGIGRE G  +L+NY QVK+V   +  P
Sbjct: 473 YNAFHQNVPFGGFGQSGIGREMGSAALDNYTQVKSVRMAITKP 515



 Score = 26.6 bits (57), Expect(2) = 2e-61
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           ++K VTLELGGKSP
Sbjct: 278 SIKKVTLELGGKSP 291



>gb:CR382138_1670689 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 504

 Score =  228 bits (581), Expect(2) = 2e-61
 Identities = 114/229 (49%), Positives = 152/229 (66%), Gaps = 1/229 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II +DA++D  ++     +F+N G+ C AGSR Y+ E IYD FVEK        V
Sbjct: 274 GKSPHIIFNDADMDTTLKSVVTGIFYNSGEVCSAGSRLYIQEGIYDAFVEKFVQTTKSDV 333

Query: 719 -VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDV 543
            VGDPF     QG Q   +Q +K+L+YI+ G + GA +  GG+R+  KGYFI+PTIF DV
Sbjct: 334 KVGDPFLPDTIQGAQNSVDQLDKILKYIQIGTDEGAKILAGGERLQGKGYFIKPTIFGDV 393

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
           KEDM I Q+EIFGPV  + KFK  D+V++ ANNT YGLAAG+ TS++++A  ++R L+AG
Sbjct: 394 KEDMRIVQEEIFGPVITISKFKTTDDVVRMANNTDYGLAAGIQTSNVNRAIDVSRRLKAG 453

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP 216
           TVW+N Y+ F   +PFGGY +SG+GRE GV  L NY Q KAV   +  P
Sbjct: 454 TVWVNTYNDFHPMVPFGGYNLSGMGREMGVEVLQNYTQTKAVRMSIIKP 502



 Score = 31.2 bits (69), Expect(2) = 2e-61
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 262 ESNLKKVTLELGGKSP 277



>gb:CR382129_1661437 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 496

 Score =  230 bits (587), Expect(2) = 2e-61
 Identities = 114/216 (52%), Positives = 147/216 (68%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II DDAN+  A+  A   +FFN G+ C A SR YV E +Y E V   K RA   VVGDPF
Sbjct: 271 IIFDDANLPNAISWAALGIFFNSGEVCAAASRLYVQEGVYHEVVAALKQRAEALVVGDPF 330

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +   QG Q    QF++V+ +I +GK  GATL  GG R   KGYFI+PT+F+DVK+DM I
Sbjct: 331 DQQTFQGAQTSKIQFDRVMSFIEAGKAEGATLLTGGCRAKDKGYFIRPTVFTDVKKDMKI 390

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            Q+EIFGPV  V KFK ++EVI+ AN++ YGLAAGV+T DI +A+ LA  L AGTVW+N 
Sbjct: 391 VQEEIFGPVVVVTKFKTLEEVIELANDSEYGLAAGVHTQDISRAHYLAENLHAGTVWVNT 450

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+ F  ++PFGG+  SG G+E G   L++Y+Q KAV
Sbjct: 451 YNSFHISLPFGGFNQSGFGKEMGKDGLDSYIQTKAV 486



 Score = 28.9 bits (63), Expect(2) = 2e-61
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK ++LELGGKSP
Sbjct: 255 SNLKKISLELGGKSP 269



>gb:CR380950_1649933 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 524

 Score =  232 bits (591), Expect(2) = 3e-61
 Identities = 110/216 (50%), Positives = 151/216 (69%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++ +AV++    +++N G+ CCAGSR YV E IYDEF ++ K  +    VG+PF
Sbjct: 304 IVFADADLKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDEFAQEFKTASEALKVGNPF 363

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +   QG Q    Q +K+L Y+  GK+ GATL  GG+RIG KGYFI+PTIF DV EDM I
Sbjct: 364 DESTFQGAQTSQMQLDKILSYVEIGKKEGATLITGGERIGEKGYFIKPTIFGDVTEDMRI 423

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V KFKD+D V++ AN++ YGLAAG++T++I+ A  +A  L+AGTVW+N 
Sbjct: 424 VKEEIFGPVVTVTKFKDLDHVVQMANDSEYGLAAGIHTTNINSAVKVADRLKAGTVWVNT 483

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+ F   IPFGG+  SG+GRE    +L+ YLQ KAV
Sbjct: 484 YNDFHQNIPFGGFNASGLGREMSKEALDGYLQAKAV 519



 Score = 26.9 bits (58), Expect(2) = 3e-61
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           LK VTLELGGKSP
Sbjct: 290 LKKVTLELGGKSP 302



>pir|A46725|A46725 omega-crystallin - giant
           octopus>gb:OCTOMEGCRY_1391073 Octopus dofleini
           omega-crystallin, complete cds.
          Length = 496

 Score =  236 bits (602), Expect(2) = 3e-61
 Identities = 108/218 (49%), Positives = 158/218 (72%), Gaps = 1/218 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           ++  D ++D AV+ AH A F N GQC  +GSR YVHE IY+EFV+++  +A RR +GDP+
Sbjct: 271 VVFPDTDLDFAVQQAHEAAFQNMGQCRWSGSRAYVHESIYEEFVKRSVEQATRRKIGDPY 330

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG-YFIQPTIFSDVKEDMV 528
           +   E GPQID EQ+ KVL YI+S +E GA L+ GG++ G KG Y+I+PT+FS+V ++M 
Sbjct: 331 ELDTEHGPQIDEEQYTKVLDYIKSAQEQGAKLKYGGNKHGDKGGYYIEPTVFSEVSDNMK 390

Query: 527 IAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWIN 348
           IA++EIFGPVQ ++KF+D+D+VI R NN+ YG+AA ++T+DI++  T    +  GT+W+N
Sbjct: 391 IAKEEIFGPVQLLMKFRDLDDVIDRCNNSDYGMAAAIFTNDINRIMTFTNAVNTGTIWVN 450

Query: 347 CYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
            +  +    PFGG+K SGI RE G Y+L  Y +VK+V+
Sbjct: 451 TFHHWFPQAPFGGFKTSGISREMGKYALREYTEVKSVI 488



 Score = 22.7 bits (47), Expect(2) = 3e-61
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK  +LEL GK P
Sbjct: 255 SNLKRCSLELSGKCP 269



>sp|P30841|CROM_OCTDO Omega-crystallin.
          Length = 495

 Score =  236 bits (602), Expect(2) = 3e-61
 Identities = 108/218 (49%), Positives = 158/218 (72%), Gaps = 1/218 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           ++  D ++D AV+ AH A F N GQC  +GSR YVHE IY+EFV+++  +A RR +GDP+
Sbjct: 270 VVFPDTDLDFAVQQAHEAAFQNMGQCRWSGSRAYVHESIYEEFVKRSVEQATRRKIGDPY 329

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKG-YFIQPTIFSDVKEDMV 528
           +   E GPQID EQ+ KVL YI+S +E GA L+ GG++ G KG Y+I+PT+FS+V ++M 
Sbjct: 330 ELDTEHGPQIDEEQYTKVLDYIKSAQEQGAKLKYGGNKHGDKGGYYIEPTVFSEVSDNMK 389

Query: 527 IAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWIN 348
           IA++EIFGPVQ ++KF+D+D+VI R NN+ YG+AA ++T+DI++  T    +  GT+W+N
Sbjct: 390 IAKEEIFGPVQLLMKFRDLDDVIDRCNNSDYGMAAAIFTNDINRIMTFTNAVNTGTIWVN 449

Query: 347 CYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVV 234
            +  +    PFGG+K SGI RE G Y+L  Y +VK+V+
Sbjct: 450 TFHHWFPQAPFGGFKTSGISREMGKYALREYTEVKSVI 487



 Score = 22.7 bits (47), Expect(2) = 3e-61
 Identities = 10/15 (66%), Positives = 11/15 (73%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK  +LEL GK P
Sbjct: 254 SNLKRCSLELSGKCP 268



>gb:BST458323_751290 Geobacillus stearothermophilus partial aldh
           gene for aldehyde dehydrogenase and partial pddh gene
           for 1,3 propanediol dehydrogenase.
          Length = 494

 Score =  231 bits (589), Expect(2) = 5e-61
 Identities = 112/216 (51%), Positives = 150/216 (69%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA+  +A+  A   + FNQGQ CCAGSR ++ ++ YD  V    + A     G   
Sbjct: 274 IILPDADFSKAIPGALNGVMFNQGQVCCAGSRVFIQKKQYDNVVADMVSHAKSIKQGFGL 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           K   E GP + SEQ  +VL YI  G E GA L  GG +   +GYF++PTIF++V++ M I
Sbjct: 334 KADTEMGPLVSSEQQNRVLGYIEKGLEEGAELLTGGQKPSEQGYFVEPTIFANVEDSMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           +++EIFGPV   L ++DIDE+I+RAN+T+YGLAAGV+T D+ KA+ +A  LRAGTVW+NC
Sbjct: 394 SKEEIFGPVIAALPYEDIDELIERANDTNYGLAAGVWTRDVTKAHYIANKLRAGTVWVNC 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+VFDA  PFGGYK SGIGRE G Y+L+NY +VK+V
Sbjct: 454 YNVFDAASPFGGYKESGIGREMGSYALDNYTEVKSV 489



 Score = 26.9 bits (58), Expect(2) = 5e-61
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           +LK VTLELGGKSP
Sbjct: 259 SLKRVTLELGGKSP 272



>sp|P40047|DHA5_YEAST Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3).>gb:SCU56605_1710510
           Saccharomyces cerevisiae precursor aldehyde
           dehydrogenase gene, nuclear gene encoding mitochondrial
           protein, complete cds.
          Length = 519

 Score =  231 bits (589), Expect(2) = 1e-60
 Identities = 108/223 (48%), Positives = 154/223 (69%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D+AV++  F +F+N G+ CCAGSR Y+ + +Y+E ++K K       VGDPF
Sbjct: 295 IVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLKVGDPF 354

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            + V QG Q   +Q  K+L Y+   K  GA L  GG R GSKGYF++PT+F+DVKEDM I
Sbjct: 355 DEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGGARHGSKGYFVKPTVFADVKEDMRI 414

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++E+FGP+  V KF  +DEVI  AN++ YGLAAG++T+DI+KA  +++ ++AGTVWIN 
Sbjct: 415 VKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWINT 474

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP 216
           Y+ F   +PFGG+  SGIGRE G  +L+NY Q K+V   +  P
Sbjct: 475 YNNFHQNVPFGGFGQSGIGREMGEAALSNYTQTKSVRIAIDKP 517



 Score = 25.8 bits (55), Expect(2) = 1e-60
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 281 VKKVTLELGGKSP 293



>gb:AE016817_1747800 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 507

 Score =  231 bits (588), Expect(2) = 1e-60
 Identities = 113/216 (52%), Positives = 152/216 (70%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++ +A ++   ++FFN G+ CCAGSR Y+ E IY+EF+++ KA A    VGDP 
Sbjct: 287 IIFADADLKKAAQNVLNSIFFNGGEVCCAGSRMYIEEPIYEEFLQEIKAVAESVKVGDPS 346

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            K   QG Q    Q +K+L YI  GK+ GA +  GG+R+G KGY+++PTIF+DV+EDM I
Sbjct: 347 WKDTFQGAQTSQMQLDKILSYIEIGKQEGARVVTGGERLGEKGYYVKPTIFADVREDMRI 406

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  V KF +ID++++ AN+T YGLAAGVY+S + KA  +A  L AGTVWIN 
Sbjct: 407 VKEEIFGPVVTVTKFTNIDDLLEMANDTQYGLAAGVYSSSMKKAIDVANRLDAGTVWINT 466

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+ F  ++PFGGYK SG GRE G   + NY QVKAV
Sbjct: 467 YNDFHCSVPFGGYKGSGFGREMGAEVVENYTQVKAV 502



 Score = 25.8 bits (55), Expect(2) = 1e-60
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           +LK V+LELGGKSP
Sbjct: 272 DLKKVSLELGGKSP 285



>gb:AE017346_1757528 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 506

 Score =  226 bits (576), Expect(2) = 3e-60
 Identities = 106/221 (47%), Positives = 150/221 (67%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ +DA+ + AV+ +   +FFN GQ CCAGSR YV + IY++FV+  K +  +  
Sbjct: 274 GKSANIVFEDADFEEAVKYSAQGIFFNHGQTCCAGSRIYVQKPIYEKFVKAFKEQTSKLK 333

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF     QGPQ+   Q E+++ Y+  GK+ GAT+  GG R G KGYFI+PT+F DV 
Sbjct: 334 VGDPFDPNTYQGPQVSQIQAERIMSYVDHGKQEGATVITGGKRCGDKGYFIEPTVFGDVT 393

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            +M I ++EIFGPV  V  F+  +E ++ AN++ YGLA+ V+TS+I +A  +A  L+AGT
Sbjct: 394 ANMKIVKEEIFGPVVVVSPFETEEEALEHANDSVYGLASAVFTSNISRATRVASKLKAGT 453

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           VWINCY+     +PFGG+K SG+GRE G Y+L NY ++KAV
Sbjct: 454 VWINCYNELHPQVPFGGFKQSGLGRELGEYALENYTEIKAV 494



 Score = 29.3 bits (64), Expect(2) = 3e-60
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           KSN+K VTLELGGKS
Sbjct: 262 KSNIKKVTLELGGKS 276



>pir|S50576|S50576 probable aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) YER073w - yeast (Saccharomyces
           cerevisiae)>gb:SCE3612_1707963 Saccharomyces cerevisiae
           chromosome V lambda clone 3612 and cosmid 9747.
          Length = 520

 Score =  228 bits (582), Expect(2) = 7e-60
 Identities = 107/223 (47%), Positives = 153/223 (68%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D+AV++  F +F+N G+ CCAGSR Y+ + +Y+E ++K K       VGDPF
Sbjct: 296 IVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLKVGDPF 355

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            + V QG Q   +Q  K+L Y+   K  GA L  GG R GSKGYF++PT+F+DVK DM I
Sbjct: 356 DEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGGARHGSKGYFVKPTVFADVKGDMRI 415

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++E+FGP+  V KF  +DEVI  AN++ YGLAAG++T+DI+KA  +++ ++AGTVWIN 
Sbjct: 416 VKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWINT 475

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP 216
           Y+ F   +PFGG+  SGIGRE G  +L+NY Q K+V   +  P
Sbjct: 476 YNNFHQNVPFGGFGQSGIGREMGEAALSNYTQTKSVRIAIDKP 518



 Score = 25.8 bits (55), Expect(2) = 7e-60
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 282 VKKVTLELGGKSP 294



>sp|P32872|DHAY_YEAST Aldehyde dehydrogenase 2, mitochondrial
           precursor (EC 1.2.1.3).>pir|S31308|S31308 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) 2 precursor,
           mitochondrial - yeast (Saccharomyces
           cerevisiae)>gb:SCALDDEH_1706492 Saccharomyces cerevisiae
           gene for aldehyde dehydrogenase.
          Length = 511

 Score =  218 bits (556), Expect(2) = 6e-59
 Identities = 112/213 (52%), Positives = 145/213 (68%), Gaps = 1/213 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+  DA++D AVE+AHF +FFNQGQCC A SR  VHE IYDE VE+   +A ++V
Sbjct: 300 GKSPMIVFIDADLDWAVENAHFGVFFNQGQCCIAQSRITVHESIYDEIVERDLEKAKKQV 359

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS-KGYFIQPTIFSDV 543
           +G+PF+     GPQI   +F+ + R I S K  GA + CGG R  S  GY+IQPT+F+DV
Sbjct: 360 LGNPFESDTRYGPQILKIEFDSIPRLINSAKAEGAKVLCGGGRDDSCVGYYIQPTVFADV 419

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
            ++M IA++EIFGPV  + +FK +DE IKR +NT YGLAA V+T   DKA  ++  L+AG
Sbjct: 420 TDEMRIAKEEIFGPVITISRFKSVDEAIKRVDNTKYGLAAYVFTK--DKAIRISAALKAG 477

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSL 264
           TVW+NC  V    IPFGG K SG+GRE G Y L
Sbjct: 478 TVWVNCVHVASYQIPFGGNKNSGMGRELGEYGL 510



 Score = 32.7 bits (73), Expect(2) = 6e-59
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 288 KSNLKKVTLELGGKSP 303



>gb:AY829749_1180148 Lonomia obliqua hypothetical protein 10 mRNA,
           partial cds.
          Length = 211

 Score =  228 bits (582), Expect = 1e-58
 Identities = 110/203 (54%), Positives = 145/203 (71%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           ++ +DA++D+A E AH A F N GQCC AG+RT V   IYD+FV KA   A +R VG+PF
Sbjct: 3   VVFNDADVDKAAEIAHKAAFANAGQCCVAGTRTCVQSGIYDKFVAKASEIAKKRTVGNPF 62

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +  V QGPQID E F KV+ YI +GK+ GA    GGDR G  GYF+ PT+F+DVK+DM I
Sbjct: 63  ED-VLQGPQIDLEMFNKVMGYIDAGKKGGARCVAGGDRAGKVGYFVTPTVFADVKDDMKI 121

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPVQ + KF+  +EV+ RAN+++YGL AGV T+D+  A    + +RAG++W+N 
Sbjct: 122 AREEIFGPVQSIFKFETFEEVVDRANDSNYGLGAGVITNDVTTALAFVKYVRAGSMWVNT 181

Query: 344 YDVFDATIPFGGYKMSGIGREKG 276
           YDV     PFGG+K SGIGRE G
Sbjct: 182 YDVVSPQTPFGGFKESGIGRELG 204



>gb:AY550122_1613293 Saussurea medusa cytosolic aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 491

 Score =  228 bits (581), Expect = 1e-58
 Identities = 107/205 (52%), Positives = 143/205 (69%)
 Frame = -2

Query: 821 NQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPFKKGVEQGPQIDSEQFEKVLRY 642
           ++G+ C AGSR +V E ++D FV+K +        GDPF      GPQ + + +EKVL  
Sbjct: 287 SKGEMCVAGSRVFVQEGVHDVFVKKLEVMVKGWATGDPFDLATRHGPQNNKQHYEKVLSC 346

Query: 641 IRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEV 462
           I  GK+ GATL  GG   G +GY+I+PT+F++V +DM IA++EIFGPV  VLKFK +DEV
Sbjct: 347 IERGKKEGATLVTGGKPFGKRGYYIEPTLFTNVTDDMTIAKEEIFGPVISVLKFKTVDEV 406

Query: 461 IKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINCYDVFDATIPFGGYKMSGIGRE 282
           IKRAN T YGLA+GV T +ID ANT++R +RAG VW+NC+   D   P GGYKMSG GRE
Sbjct: 407 IKRANATKYGLASGVMTKNIDIANTVSRSIRAGAVWVNCFIALDRDAPHGGYKMSGFGRE 466

Query: 281 KGVYSLNNYLQVKAVVTPLKNPAWI 207
           +G+ +L +YLQVK V TP+ +  W+
Sbjct: 467 QGLEALEHYLQVKTVATPIYDSPWL 491



>pir|H69614|H69614 aldehyde dehydrogenase dhaS - Bacillus
           subtilis>gb:AF027868_470468 Bacillus subtilis chromosome
           region between terC and odhAB.>gb:BSUB0011_753896
           Bacillus subtilis complete genome (section 11 of 21):
           from 2014895 to 2207855.
          Length = 495

 Score =  223 bits (568), Expect(2) = 2e-58
 Identities = 105/222 (47%), Positives = 154/222 (69%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DAN+ +A+  A   + FNQGQ CCAGSR ++H+  YDE V++  + A     G   
Sbjct: 274 ILLPDANLKKAIPGALNGVMFNQGQVCCAGSRVFIHKDQYDEVVDEMASYAESLRQGAGL 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            K  + GP +  EQ E+VL YI+ GK+ GA    GG      GYF+ PT+F++V+++M I
Sbjct: 334 HKDTQIGPLVSKEQHERVLSYIQKGKDEGAKAVTGGSCPFEAGYFVAPTVFANVEDEMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV   + ++ +DEVI+RAN++ YGLAAG++T ++ +A+ +A  L+AGTVW+NC
Sbjct: 394 AKEEIFGPVLTAIPYETVDEVIERANHSEYGLAAGLWTENVKQAHYIADRLQAGTVWVNC 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKN 219
           Y+VFDA  PFGGYK SG+GRE G Y+L+NY +VK+V   L++
Sbjct: 454 YNVFDAASPFGGYKQSGLGREMGSYALDNYTEVKSVWVNLED 495



 Score = 26.2 bits (56), Expect(2) = 2e-58
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           ++K VTLELGGKSP
Sbjct: 259 SIKRVTLELGGKSP 272



>gb:AE017344_1756162 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 495

 Score =  220 bits (561), Expect(2) = 3e-58
 Identities = 115/221 (52%), Positives = 140/221 (63%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDAN+  A + A F ++ N GQ C AGSR  V E IYD+F+   KA A    
Sbjct: 261 GKSANIVFDDANLQEAAKWAAFGVYENMGQSCSAGSRVLVQESIYDQFITHFKAAAEAFK 320

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDP      QGPQ++  QF KVL YI SGK SGA L  GG R GS+GYFIQPT+F DV 
Sbjct: 321 VGDPADPDTFQGPQVNEAQFRKVLDYIESGKRSGAKLLTGGSRHGSRGYFIQPTVFGDVT 380

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            DM IA++EIFGPV  V++FKD  + I  ANNT YGLAA V++ +  +   + R L+AGT
Sbjct: 381 MDMKIAREEIFGPVASVIRFKDEADAISIANNTEYGLAAAVHSQNYARVQRVTRKLKAGT 440

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           VWIN Y      +PFGGYK SG GRE G+  L  YL  K+V
Sbjct: 441 VWINQYVALSHQVPFGGYKQSGWGRELGLEGLEPYLITKSV 481



 Score = 28.5 bits (62), Expect(2) = 3e-58
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           +SNLK VTLELGGKS
Sbjct: 249 ESNLKSVTLELGGKS 263



>gb:AE017007_377739 Bacillus cereus ATCC 14579 section 10 of 18 of
           the complete genome.>gb:AE016877_1017989 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 494

 Score =  223 bits (567), Expect(2) = 4e-58
 Identities = 108/221 (48%), Positives = 150/221 (67%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II +DA+++ A+  A   + +N GQ C AGSR +VH + Y+  V+     A    +G   
Sbjct: 274 IILEDADLEEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVDALVKMANNVKLGAGM 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +KG E GP +  +Q E+VL YI  GK+ GAT+  GG+R   KGYF++PT+F+DV +DM I
Sbjct: 334 EKGTEMGPLVSKKQQERVLHYIEQGKKEGATVAAGGERALEKGYFVKPTVFTDVTDDMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  VL F   +EVI+RANN+ YGLAAGV+T +I   + +A  L+AGTVWIN 
Sbjct: 394 VKEEIFGPVVVVLPFDSTEEVIERANNSSYGLAAGVWTQNIKTGHQVANKLKAGTVWIND 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
           Y++ +A  PFGGYK SGIGRE G Y+L+NY +VK+V   +K
Sbjct: 454 YNLENAAAPFGGYKQSGIGRELGSYALDNYTEVKSVWVNIK 494



 Score = 25.8 bits (55), Expect(2) = 4e-58
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 260 IKHVTLELGGKSP 272



>gb:AE017333_448092 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857900 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 498

 Score =  220 bits (561), Expect(2) = 2e-57
 Identities = 101/216 (46%), Positives = 149/216 (68%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++ +A+  A   + FNQGQ CCAGSR ++H+  YD+ V++  A +     G   
Sbjct: 277 IILPDADLKKAIPGALTGVMFNQGQVCCAGSRVFIHKDQYDKVVDEMAAYSKSLRQGAGL 336

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +  + GP +  EQ E+VL YI  G++ GA +  GG     +GYF+ PT+F++V+++M I
Sbjct: 337 HEDTQMGPLVSKEQHERVLSYIEKGRQEGAKIAAGGTCPYEQGYFVSPTVFTNVEDEMTI 396

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV   + ++ +DEVI+RAN + YGLAAGV+T ++  A+ +A  L+AGTVW+NC
Sbjct: 397 AKEEIFGPVLAAIPYETVDEVIERANRSEYGLAAGVWTENLKNAHYIADRLQAGTVWVNC 456

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+ FDA  PFGGYK SG+GRE G Y+L+NY +VK+V
Sbjct: 457 YNAFDAASPFGGYKQSGLGREMGSYALDNYTEVKSV 492



 Score = 25.8 bits (55), Expect(2) = 2e-57
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           ++K VTLELGGKSP
Sbjct: 262 SVKRVTLELGGKSP 275



>gb:CR382132_1665124 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 515

 Score =  216 bits (550), Expect(2) = 7e-57
 Identities = 111/225 (49%), Positives = 147/225 (65%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEK-AKARAMRR 723
           G    I+  DA++D+A + AH  +  NQGQ CC  SR  VHE IYD+FV+K  +    R 
Sbjct: 283 GKSPMIVLGDADLDQATKWAHAGIMTNQGQICCGVSRVLVHESIYDQFVDKYVEVVKQRS 342

Query: 722 VVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS---KGYFIQPTIF 552
            VGD F+  + QGPQ+   Q EKVL YI  GKE GA L   G        KGYF+ PT+F
Sbjct: 343 RVGDMFQDKILQGPQVSKVQQEKVLGYIEKGKEEGAKLVYSGAVAAEALEKGYFVPPTVF 402

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           +DV++DMVI+++EIFGPV  + KF D+++ I RAN++ YGLAA VYT D+ +A+ ++R L
Sbjct: 403 ADVRDDMVISREEIFGPVVAIAKFSDVEDAINRANDSEYGLAASVYTKDLTEAHRISRRL 462

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            +G V+IN   + D  +PFGGYK SGIGRE G Y L+ Y Q KAV
Sbjct: 463 ESGQVFINMAHMGDYRMPFGGYKQSGIGRELGEYGLDTYTQCKAV 507



 Score = 28.1 bits (61), Expect(2) = 7e-57
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = -1

Query: 942 LQKSNLKPVTLELGGKSP 889
           L  +NLK +TLE GGKSP
Sbjct: 269 LAATNLKAITLECGGKSP 286



>gb:AP006627_562374 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 498

 Score =  216 bits (551), Expect(2) = 1e-56
 Identities = 105/216 (48%), Positives = 144/216 (66%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++ +AV  +   + FNQGQ CCAGSR YV ++ YD  V    +   +   GD  
Sbjct: 278 IILPDADLSKAVPGSLMGIMFNQGQVCCAGSRLYVQKKQYDHVVADLVSLTKKINQGDGL 337

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +    GP I ++Q ++V  YI  G E GA L  GG     +GYF+ PTIF+DV   M I
Sbjct: 338 LEHTTMGPLISTQQQKRVKNYIDRGVEEGAELLAGGTIPYDQGYFVSPTIFADVDHSMTI 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV   + F+ +D++I +AN++ YGLAAGV+T DI KA+ +A  ++AGT+W+NC
Sbjct: 398 AKEEIFGPVVAAMPFESVDDLIGKANDSDYGLAAGVWTQDIKKAHYIAHRIKAGTIWVNC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+VFDA  PFGGYK SGIGRE G Y+L+NY +VK+V
Sbjct: 458 YNVFDAASPFGGYKQSGIGREMGSYALDNYTEVKSV 493



 Score = 26.9 bits (58), Expect(2) = 1e-56
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           +LK VTLELGGKSP
Sbjct: 263 SLKRVTLELGGKSP 276



>gb:AE017033_382905 Bacillus anthracis str. Ames section 10 of 18 of
           the complete genome.>gb:AE017225_408026 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_452753 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1012610 Bacillus
           anthracis str. Ames complete genome.
          Length = 494

 Score =  217 bits (553), Expect(2) = 2e-56
 Identities = 106/221 (47%), Positives = 147/221 (66%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II +DA+++ A+  A   + +N GQ C AGSR +VH + Y+  V +    A    +G   
Sbjct: 274 IILEDADLEEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVNELVKMANNVKLGAGM 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +K  E GP +  +Q E+VL YI  GK  GAT+  GG+R   KGYF+QPT+F+DV +DM I
Sbjct: 334 EKDTEMGPLVSKKQQERVLHYIEQGKAEGATVAAGGERAFEKGYFVQPTVFTDVTDDMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  VL F   +EVI+RAN + YGLAAGV+T +I   + +A  L+AGTVWIN 
Sbjct: 394 VKEEIFGPVVVVLPFDSTEEVIERANRSSYGLAAGVWTQNIKTGHQVANKLKAGTVWIND 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
           Y++ +A  PFGG+K SGIGRE G Y+L+NY +VK+V   +K
Sbjct: 454 YNLENAAAPFGGFKQSGIGRELGSYALDNYTEVKSVWVNIK 494



 Score = 25.8 bits (55), Expect(2) = 2e-56
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 260 IKHVTLELGGKSP 272



>gb:CP000001_853165 Bacillus cereus ZK, complete genome.
          Length = 494

 Score =  217 bits (552), Expect(2) = 2e-56
 Identities = 106/221 (47%), Positives = 147/221 (66%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II +DA+++ A+  A   + +N GQ C AGSR +VH + Y+  V +    A    +G   
Sbjct: 274 IILEDADLEEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVNELVKMADNVKLGAGM 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +K  E GP +  +Q E+VL YI  GK  GAT+  GG+R   KGYF+QPT+F+DV +DM I
Sbjct: 334 EKDTEMGPLVSKKQQERVLHYIEQGKAEGATVAAGGERAFEKGYFVQPTVFTDVTDDMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  VL F   +EVI+RAN + YGLAAGV+T +I   + +A  L+AGTVWIN 
Sbjct: 394 VKEEIFGPVVVVLPFDSTEEVIERANRSSYGLAAGVWTQNIKTGHQVANKLKAGTVWIND 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
           Y++ +A  PFGG+K SGIGRE G Y+L+NY +VK+V   +K
Sbjct: 454 YNLENAAAPFGGFKQSGIGRELGSYALDNYTEVKSVWVNIK 494



 Score = 25.8 bits (55), Expect(2) = 2e-56
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 260 IKHVTLELGGKSP 272



>gb:BA000040_735867 Bradyrhizobium japonicum USDA 110 DNA, complete
            genome.
          Length = 565

 Score =  215 bits (547), Expect(2) = 3e-56
 Identities = 103/220 (46%), Positives = 146/220 (66%), Gaps = 4/220 (1%)
 Frame = -2

Query: 884  IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
            I+  DA++D AV  A  A+F N GQ C AG+R +V + IY+EFV +      +  VG+  
Sbjct: 341  IVFADADLDAAVPGAAMAVFANSGQICSAGTRLFVEQSIYEEFVGRVAEFGKKLQVGNGL 400

Query: 704  KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG----SKGYFIQPTIFSDVKE 537
               V+ GP +  +Q E+V  Y+  G++ GA    GG R+     SKG+F+ PT+F+ V++
Sbjct: 401  DPNVQIGPLVSEQQLERVTGYLDIGQKEGARALAGGGRVTEGALSKGFFVSPTVFAGVQD 460

Query: 536  DMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTV 357
            +M IAQ+EIFGPV   + FKD+DE++KRANNT +GL +G++T D+ KA+ +A+ LRAG+V
Sbjct: 461  NMRIAQEEIFGPVISAIAFKDMDELVKRANNTTFGLGSGLWTRDVSKAHAVAKSLRAGSV 520

Query: 356  WINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            W+NCY   D  +PFGGYKMSG GRE G   +  YL VKAV
Sbjct: 521  WVNCYQAMDPAVPFGGYKMSGYGRESGKQHVEEYLNVKAV 560



 Score = 27.3 bits (59), Expect(2) = 3e-56
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           NLK V+LELGGKSP
Sbjct: 326 NLKRVSLELGGKSP 339



>pir|AH3424|AH3424 betaine aldehyde dehydrogenase (EC 1.2.1.8)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009576_253300 Brucella melitensis 16M
           chromosome I, section 133 of 195 of the complete
           sequence.>gb:AE008917_979212 Brucella melitensis 16M
           chromosome I, complete sequence.
          Length = 500

 Score =  216 bits (550), Expect(2) = 3e-56
 Identities = 103/225 (45%), Positives = 150/225 (66%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA+++ A+  A    F++ GQ C  G+R +VH+ I + F+E+   R  +  
Sbjct: 265 GKSPLIVFDDADLESAIGGAMLGNFYSTGQVCSNGTRVFVHKNIRERFIERLVERTRKIR 324

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGD----RIGSKGYFIQPTIF 552
           +GDPF +  + GP I + Q +KVL YI+ GK  GATL CGG     +   KG+FI+PT+F
Sbjct: 325 IGDPFDEATQMGPLISAAQRDKVLSYIKKGKAEGATLACGGGVPKLQGFDKGFFIEPTVF 384

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           +DV + M IA++EIFGPV  VL+F D DEVI RAN++ +GLAAGV+T+D+ + + +   +
Sbjct: 385 ADVTDTMTIAREEIFGPVMSVLEFSDEDEVIARANDSEFGLAAGVFTADLSRGHHVIGQI 444

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           +AGT WIN Y++    +PFGGYK SGIGRE G+ +L +Y Q+K V
Sbjct: 445 KAGTCWINAYNLTPVEVPFGGYKQSGIGRENGIAALAHYSQIKTV 489



 Score = 25.8 bits (55), Expect(2) = 3e-56
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           LK VT+ELGGKSP
Sbjct: 256 LKHVTMELGGKSP 268



>pir|C83717|C83717 NADP-dependent aldehyde dehydrogenase dhaS
           [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_654485 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 498

 Score =  215 bits (547), Expect(2) = 3e-56
 Identities = 106/216 (49%), Positives = 141/216 (65%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++ +AV  +   + FNQGQ CCAGSR YV ++ YD  V    +       GD  
Sbjct: 278 IILPDADLSKAVPGSLMGIMFNQGQVCCAGSRLYVQKKQYDHVVADLVSLTNEIQQGDGL 337

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
            +    GP I ++Q  +V  YI  G E GA L  GG+    +GYF+ PTIF+DV   M I
Sbjct: 338 LEQTTMGPLISNQQQSRVKNYIDRGVEEGAELLTGGNIPYDQGYFVAPTIFADVDHSMTI 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV   + F  ID++I +AN++ YGLAAGV+T DI KA+ +A  ++AGT+W+NC
Sbjct: 398 AKEEIFGPVVAAMPFDSIDDLIDKANDSDYGLAAGVWTQDIKKAHYIAHRIKAGTIWVNC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+VFDA  PFGGYK SGIGRE G Y+L NY +VK+V
Sbjct: 458 YNVFDAASPFGGYKQSGIGREMGSYALENYTEVKSV 493



 Score = 26.9 bits (58), Expect(2) = 3e-56
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           +LK VTLELGGKSP
Sbjct: 263 SLKRVTLELGGKSP 276



>gb:AE014291_307995 Brucella suis 1330 chromosome I, complete
           sequence.
          Length = 487

 Score =  216 bits (550), Expect(2) = 3e-56
 Identities = 103/225 (45%), Positives = 150/225 (66%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA+++ A+  A    F++ GQ C  G+R +VH+ I + F+E+   R  +  
Sbjct: 252 GKSPLIVFDDADLESAIGGAMLGNFYSTGQVCSNGTRVFVHKNIRERFIERLVERTRKIR 311

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGD----RIGSKGYFIQPTIF 552
           +GDPF +  + GP I + Q +KVL YI+ GK  GATL CGG     +   KG+FI+PT+F
Sbjct: 312 IGDPFDEATQMGPLISAAQRDKVLSYIKKGKAEGATLACGGGVPKLQGFDKGFFIEPTVF 371

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           +DV + M IA++EIFGPV  VL+F D DEVI RAN++ +GLAAGV+T+D+ + + +   +
Sbjct: 372 ADVTDTMTIAREEIFGPVMSVLEFSDEDEVIARANDSEFGLAAGVFTADLSRGHHVIGQI 431

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           +AGT WIN Y++    +PFGGYK SGIGRE G+ +L +Y Q+K V
Sbjct: 432 KAGTCWINAYNLTPVEVPFGGYKQSGIGRENGIAALAHYSQIKTV 476



 Score = 25.8 bits (55), Expect(2) = 3e-56
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           LK VT+ELGGKSP
Sbjct: 243 LKHVTMELGGKSP 255



>gb:AE017355_463892 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 494

 Score =  216 bits (549), Expect(2) = 4e-56
 Identities = 106/221 (47%), Positives = 146/221 (66%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II +DA++  A+  A   + +N GQ C AGSR +VH + Y+  V +    A    +G   
Sbjct: 274 IILEDADLKEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVNELVKMANNVKLGAGM 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +K  E GP +  +Q E+VL YI  GK  GAT+  GG+R   KGYF+QPT+F+DV +DM I
Sbjct: 334 EKETEMGPLVSKKQQERVLHYIEQGKAEGATVAAGGERAFEKGYFVQPTVFTDVTDDMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  VL F   +EVI+RAN + YGLAAGV+T +I   + +A  L+AGTVWIN 
Sbjct: 394 VKEEIFGPVVVVLPFDSTEEVIERANRSSYGLAAGVWTQNIKTGHQVANKLKAGTVWIND 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
           Y++ +A  PFGG+K SGIGRE G Y+L+NY +VK+V   +K
Sbjct: 454 YNLENAAAPFGGFKQSGIGRELGSYALDNYTEVKSVWVNIK 494



 Score = 25.8 bits (55), Expect(2) = 4e-56
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 260 IKHVTLELGGKSP 272



>gb:AE017275_424773 Bacillus cereus ATCC 10987, section 12 of 18 of
           the complete genome.>gb:AE017194_1063192 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 494

 Score =  215 bits (547), Expect(2) = 4e-56
 Identities = 103/216 (47%), Positives = 144/216 (66%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++ RA+  A   + FNQGQ C AGSR +V +++YD  +      + +   G   
Sbjct: 274 IILPDADLSRAIPGALSGVMFNQGQVCSAGSRLFVPKKMYDNVMADLVLYSKKLNQGAGL 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                 GP +  EQ ++V+ YI  G E GA + CGG     +GYF+ PT+F+DV ++M I
Sbjct: 334 SPETTIGPLVSEEQQKRVMGYIEKGIEEGAEVLCGGSNPFDRGYFVSPTVFADVNDEMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV   + F DIDEVI+RAN + +GLAAGV+T ++  A+ +A  +RAGTVW+NC
Sbjct: 394 AKEEIFGPVISAIPFNDIDEVIERANKSQFGLAAGVWTENVKTAHYVASKVRAGTVWVNC 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+VFDA  PFGG+K SG+GRE G Y+LNNY +VK+V
Sbjct: 454 YNVFDAASPFGGFKQSGLGREMGSYALNNYTEVKSV 489



 Score = 26.6 bits (57), Expect(2) = 4e-56
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           LK VTLELGGKSP
Sbjct: 260 LKRVTLELGGKSP 272



>gb:AE017035_383607 Bacillus anthracis str. Ames section 12 of 18 of
           the complete genome.>gb:AE017225_408732 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_453454 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_464611 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_853869 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1013312 Bacillus anthracis str. Ames
           complete genome.
          Length = 494

 Score =  214 bits (546), Expect(2) = 4e-56
 Identities = 104/216 (48%), Positives = 145/216 (67%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++ RA+  A   + FNQGQ C AGSR +V +++YD  +      + +   G   
Sbjct: 274 IILPDADLSRAIPGALSGVMFNQGQVCSAGSRLFVPKKMYDNVMADLVLYSKKLNQGVGL 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                 GP +  EQ ++V+ YI  G E GA + CGG+    +GYFI PT+F+DV ++M I
Sbjct: 334 DPETTIGPLVSEEQQKRVMGYIEKGIEEGAEVLCGGNNPFDQGYFISPTVFADVNDEMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV   + F DIDEVI+RAN + +GLAAGV+T ++  A+ +A  +RAGTVW+NC
Sbjct: 394 AKEEIFGPVISAIPFNDIDEVIERANKSQFGLAAGVWTENVKTAHYVASKVRAGTVWVNC 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+VFDA  PFGG+K SG+GRE G Y+LNNY +VK+V
Sbjct: 454 YNVFDAASPFGGFKQSGLGREMGSYALNNYTEVKSV 489



 Score = 26.9 bits (58), Expect(2) = 4e-56
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           +LK VTLELGGKSP
Sbjct: 259 SLKRVTLELGGKSP 272



>gb:AB047106_7074 Bacillus thermoleovorans Bt-adh, Bt-aldh, ORF-X,
           p21, ORF-Y, genes, partial and complete cds.
          Length = 497

 Score =  215 bits (547), Expect(2) = 6e-56
 Identities = 109/224 (48%), Positives = 147/224 (65%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++++A + A F +F+N GQ C AGSR  V   +Y+ FVE+   RA +  VG   
Sbjct: 268 IIFADADLEQAAKSALFGVFYNSGQVCQAGSRILVERTVYEPFVERLAERAKKLKVGPGT 327

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI--GSKGYFIQPTIFSDVKEDM 531
               + GP I  EQ+EKVLRYI  GK+ GA L  GG  +  G  GYFI+PT+F+DV   M
Sbjct: 328 NPRSDLGPVISREQYEKVLRYIEIGKQEGARLAAGGRALDGGGGGYFIEPTVFADVSPSM 387

Query: 530 VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI 351
            IA +EIFGPV  V+ F D +E ++ AN T YGLAA V+T+DI +A  LAR +++GTVW+
Sbjct: 388 RIACEEIFGPVAAVIPFADEEEAVRIANGTMYGLAAAVWTNDIKRALRLARRVKSGTVWL 447

Query: 350 NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKN 219
           N Y V   T+PFGGYK SG+GRE G+ +L+ YL+ K V+  L +
Sbjct: 448 NTYQVLSPTVPFGGYKQSGLGRELGMQALDAYLETKTVICDLND 491



 Score = 26.2 bits (56), Expect(2) = 6e-56
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           ++K VTLELGGKSP
Sbjct: 253 HIKRVTLELGGKSP 266



>gb:AE017273_424071 Bacillus cereus ATCC 10987, section 10 of 18 of
           the complete genome.>gb:AE017194_1062490 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 494

 Score =  215 bits (547), Expect(2) = 8e-56
 Identities = 105/221 (47%), Positives = 147/221 (66%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II +DA+++ A+  A   + +N GQ C AGSR +VH + Y+  V +    A    +G   
Sbjct: 274 IILEDADLEEAINGAFQGIMYNHGQNCSAGSRVFVHRKHYETVVNELVKMANNVKLGAGM 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
           +K  E GP +  +Q E+VL YI  GK  GAT+  GG+R   KGYF+QPT+F++V +DM I
Sbjct: 334 EKETEMGPLVSKKQQERVLHYIEQGKAEGATVAAGGERAFEKGYFVQPTVFTNVTDDMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            ++EIFGPV  VL F   +EVI+RAN + YGLAAGV+T +I   + +A  L+AGTVWIN 
Sbjct: 394 VKEEIFGPVVVVLPFDSTEEVIERANRSSYGLAAGVWTQNIKTGHQVANKLKAGTVWIND 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
           Y++ +A  PFGG+K SGIGRE G Y+L+NY +VK+V   +K
Sbjct: 454 YNLENAAAPFGGFKQSGIGRELGSYALDNYTEVKSVWVNIK 494



 Score = 25.8 bits (55), Expect(2) = 8e-56
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +K VTLELGGKSP
Sbjct: 260 IKHVTLELGGKSP 272



>gb:AE017009_378445 Bacillus cereus ATCC 14579 section 12 of 18 of
           the complete genome.>gb:AE016877_1018695 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 494

 Score =  214 bits (545), Expect(2) = 8e-56
 Identities = 103/216 (47%), Positives = 144/216 (66%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++ RA+  A   + FNQGQ C AGSR +V +++YD  +      + +   G   
Sbjct: 274 IILPDADLSRAIPGALSGVMFNQGQVCSAGSRLFVPKKMYDNVMADLVLYSKKLNQGVGL 333

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                 GP +  EQ ++V+ YI  G E GA + CGG     +GYF+ PT+F+DV ++M I
Sbjct: 334 NPETTIGPLVSEEQQKRVMGYIEKGIEEGAEVLCGGSNPFDQGYFVSPTVFADVNDEMTI 393

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           A++EIFGPV   + F DIDEVI+RAN + +GLAAGV+T ++  A+ +A  +RAGTVW+NC
Sbjct: 394 AKEEIFGPVISAIPFNDIDEVIERANKSQFGLAAGVWTENVKTAHYVASKVRAGTVWVNC 453

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           Y+VFDA  PFGG+K SG+GRE G Y+LNNY +VK+V
Sbjct: 454 YNVFDAASPFGGFKQSGLGREMGSYALNNYTEVKSV 489



 Score = 26.6 bits (57), Expect(2) = 8e-56
 Identities = 12/13 (92%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           LK VTLELGGKSP
Sbjct: 260 LKRVTLELGGKSP 272



>gb:BA000040_734582 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 493

 Score =  213 bits (542), Expect(2) = 1e-55
 Identities = 107/225 (47%), Positives = 143/225 (63%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA++D+AV  A  A F N GQ C AGSR +V  +I+DE VE+    A    
Sbjct: 264 GKSPVIVCADADLDKAVPIAAMAAFANSGQICIAGSRLFVERKIHDELVERLGKFASALK 323

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG----SKGYFIQPTIF 552
           +GD      E GP +   Q +KV  +++SG+E GA +  GG R+     +KG F++PT+F
Sbjct: 324 IGDGADPTTEIGPLVSQRQLDKVEGFLQSGREEGAKVVAGGRRVREGNLAKGNFVEPTVF 383

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           + V +DM IA+DEIFGPV   L F  +DE ++RAN T YGLAAGV+T D+ KA+ ++R L
Sbjct: 384 AGVSDDMQIARDEIFGPVISALPFDTLDEAVERANATPYGLAAGVFTRDVSKAHVISRSL 443

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           RAG+VW+N Y   D  +PFGGYKMSG GRE G   L+ YL  K V
Sbjct: 444 RAGSVWVNTYHALDPAMPFGGYKMSGYGREGGTEHLDEYLHTKGV 488



 Score = 27.3 bits (59), Expect(2) = 1e-55
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           NLK V+LELGGKSP
Sbjct: 254 NLKRVSLELGGKSP 267



>gb:BA000043_739349 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 498

 Score =  213 bits (543), Expect(2) = 2e-55
 Identities = 109/224 (48%), Positives = 146/224 (65%), Gaps = 2/224 (0%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           II  DA++++A + A F +F+N GQ C AGSR  V   +Y+ FVE+   RA +  VG   
Sbjct: 269 IIFADADLEQAAKSALFGVFYNSGQVCQAGSRILVERTVYEPFVERLAERAKKLKVGPGT 328

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI--GSKGYFIQPTIFSDVKEDM 531
               + GP I  EQ+EKVLRYI  GK+ GA L  GG  +  G  GYFI+PT+F+DV   M
Sbjct: 329 NPRSDLGPVISREQYEKVLRYIEIGKQEGARLAAGGRALDGGGGGYFIEPTVFADVSPSM 388

Query: 530 VIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWI 351
            IA +EIFGPV  V+ F D +E ++ AN T YGLAA V+T+DI +A  LAR +++GTVW+
Sbjct: 389 RIACEEIFGPVAAVIPFADEEEAVRIANGTMYGLAAAVWTNDIKRALRLARRVKSGTVWL 448

Query: 350 NCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKN 219
           N Y V   T PFGGYK SG+GRE G+ +L+ YL+ K V+  L +
Sbjct: 449 NTYQVLSPTAPFGGYKQSGLGRELGMQALDAYLETKTVICDLND 492



 Score = 26.2 bits (56), Expect(2) = 2e-55
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           ++K VTLELGGKSP
Sbjct: 254 HIKRVTLELGGKSP 267



>gb:PAU40996_1698911 Hansenula polymorpha aldehyde dehydrogenase
           (ALD) gene, nuclear gene encoding mitochondrial protein,
           complete cds.
          Length = 518

 Score =  211 bits (536), Expect(2) = 3e-55
 Identities = 105/228 (46%), Positives = 142/228 (62%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA++  A+      +F+N G+ C AGSR +V E IY+E + + KA A    
Sbjct: 290 GKSANIVFDDADVKTAISALVAGIFYNSGEVCSAGSRVFVQEGIYEEILREFKAAAETLK 349

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF     QG Q    Q  K+L Y+    + G  L  GG+R+G+KG+F++PTIF+DV 
Sbjct: 350 VGDPFDLSTFQGAQTSQMQLNKILGYVDIAHQEGGRLITGGERLGNKGFFVKPTIFADVT 409

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            DM   ++EIFGP   +  FK  DEVI+ AN++ YGLAAGV+T  +D A  ++  L AG+
Sbjct: 410 PDMRAYKEEIFGPFAVITPFKTADEVIELANDSEYGLAAGVHTKSLDTATYVSNKLEAGS 469

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNP 216
           VWIN Y+ F   +PFGGYK SGIGRE G  +L+NY Q KAV   L+ P
Sbjct: 470 VWINTYNDFHQMVPFGGYKQSGIGREMGAQALDNYTQWKAVRIGLQKP 517



 Score = 28.1 bits (61), Expect(2) = 3e-55
 Identities = 13/14 (92%), Positives = 13/14 (92%)
 Frame = -1

Query: 933 SNLKPVTLELGGKS 892
           SNLK VTLELGGKS
Sbjct: 279 SNLKKVTLELGGKS 292



>gb:CR382125_1658255 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 507

 Score =  206 bits (525), Expect(2) = 4e-54
 Identities = 101/222 (45%), Positives = 144/222 (64%), Gaps = 1/222 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ +DANI + + +    +F N GQ C +GSR YV + IYD+ + + K      +
Sbjct: 281 GKSAHLVFEDANIKKTIPNLVNGIFKNAGQICSSGSRIYVQDTIYDQLLSEFKTYLETEI 340

Query: 719 -VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDV 543
            VG PF +   Q    +  QFE +L YI  GK+ GA++  GG+R+G+KGYFI+PT+F +V
Sbjct: 341 KVGSPFDESNFQAAINNKAQFETILNYIDIGKKEGASILTGGERVGNKGYFIKPTVFYNV 400

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
           KEDM I ++EIFGPV  + KF  +DE +  AN++ +GL AG+ T +I  A  +A+ L+AG
Sbjct: 401 KEDMRIVKEEIFGPVVTISKFSTVDEAVALANDSEFGLGAGIETENISVALKVAKRLKAG 460

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           TVWIN Y+ FDA +PFGGYK SG GRE G  +  +Y Q+KAV
Sbjct: 461 TVWINTYNDFDAAVPFGGYKQSGYGREMGEEAFESYTQIKAV 502



 Score = 28.5 bits (62), Expect(2) = 4e-54
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           +SNLK VTLELGGKS
Sbjct: 269 QSNLKKVTLELGGKS 283



>gb:PPU24215_159570 Pseudomonas putida p-cymene catabolism (cym) and
           p-cumate catabolism (cmt) operons and enol-coenzyme A
           hydratase gene, complete cds.
          Length = 494

 Score =  206 bits (525), Expect(2) = 5e-54
 Identities = 103/216 (47%), Positives = 139/216 (64%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++D+    A  A+FFN GQ C A SR +V + +YD+ VE   A A +  VG+  
Sbjct: 273 IVFADADLDQVGLGAALAVFFNSGQICFAASRLFVQDSVYDQVVEAVAAAAAQFKVGNGL 332

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                 GP +  +Q E+V+ Y++SG E GA L CGG  +G KGYF+QPT+F+D    M I
Sbjct: 333 DPDTLLGPLVSRKQQERVMGYVQSGIEQGARLVCGGKSVGEKGYFLQPTVFADAAPSMRI 392

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  V++FKD  E I+ AN+T YGLAA ++T DI KA+ +A  L+AG+VWINC
Sbjct: 393 AQEEIFGPVVSVIRFKDEAEAIRMANDTAYGLAANIWTRDIKKAHRVAHRLQAGSVWINC 452

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           + V D   PFGG+K SG GRE     L+ Y + K V
Sbjct: 453 HGVIDPAAPFGGFKQSGWGREVSEEGLSAYTETKTV 488



 Score = 28.1 bits (61), Expect(2) = 5e-54
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           N+K VTLELGGKSP
Sbjct: 258 NMKRVTLELGGKSP 271



>gb:AE017352_1759755 Cryptococcus neoformans var. neoformans JEC21
           chromosome 12, complete sequence.
          Length = 524

 Score =  203 bits (516), Expect(2) = 7e-54
 Identities = 105/223 (47%), Positives = 140/223 (62%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ D A+++ A + A  A++FN GQ CCAGSR YV E I+D+F+   K RA    
Sbjct: 290 GKSPVIVFDSADVEEAADWAALAIWFNSGQDCCAGSRLYVQEGIFDKFLAAMKKRAEACA 349

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI--GSKGYFIQPTIFSD 546
           +G P  +    GP I   Q +KVL YI SGKE GA +  GG +    + GY+I+PTI +D
Sbjct: 350 IGQPHDEKTSFGPLISEGQRDKVLNYIVSGKEQGARVVTGGQKWPESNDGYWIEPTILAD 409

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
              DM I ++EIFGPV     FK  +EV++ AN+T YGLAA V+T+D  +A  ++  L A
Sbjct: 410 TTPDMTIVKEEIFGPVVVAAPFKTEEEVLEVANDTSYGLAAAVFTNDTRQATRVSAALDA 469

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           GTVWIN Y +    +PFGG+K SGIGRE G Y L  Y+Q+KAV
Sbjct: 470 GTVWINQYALLHPGVPFGGFKQSGIGRELGTYGLEAYMQIKAV 512



 Score = 31.2 bits (69), Expect(2) = 7e-54
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLELGGKSP
Sbjct: 278 ESNLKKVTLELGGKSP 293



>gb:CR382139_1673028 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 502

 Score =  204 bits (519), Expect(2) = 1e-53
 Identities = 108/230 (46%), Positives = 145/230 (63%), Gaps = 5/230 (2%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEK-AKARAMRR 723
           G    I+  DA++++AV+ A   +  NQGQ C + SR YVHE +YD F+   AK      
Sbjct: 269 GKSPLIVRKDADLEQAVKWAAIGIMSNQGQICTSTSRVYVHESVYDTFLTMYAKHIKEEY 328

Query: 722 VVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG----SKGYFIQPTI 555
           V GD F+K    GPQ+  +QF+K+L YI  GK+ GA +  GG++      SKG+F++PTI
Sbjct: 329 VQGDMFEKNAIVGPQVSKQQFDKILSYIDIGKKEGARVILGGEKNSDGNMSKGFFVKPTI 388

Query: 554 FSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARG 375
           F+DVK DM I  +EIFGPV    KF   +E IK AN T YGL A ++TSDI KA+++A  
Sbjct: 389 FADVKPDMRIVNEEIFGPVVTCGKFASDEEAIKYANQTQYGLGAAIFTSDITKAHSMASD 448

Query: 374 LRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           ++AG VWIN  +  D  +PFGG KMSG+GRE G Y L+ Y Q KA+   L
Sbjct: 449 IQAGMVWINSSNDSDCHVPFGGVKMSGVGRELGEYGLSMYTQAKAIYVNL 498



 Score = 29.3 bits (64), Expect(2) = 1e-53
 Identities = 13/18 (72%), Positives = 14/18 (77%)
 Frame = -1

Query: 942 LQKSNLKPVTLELGGKSP 889
           +  SNLK VTLE GGKSP
Sbjct: 255 MASSNLKAVTLECGGKSP 272



>gb:BA000038_724595 Vibrio vulnificus YJ016 DNA, chromosome II,
           complete sequence.
          Length = 486

 Score =  202 bits (515), Expect(2) = 3e-53
 Identities = 110/229 (48%), Positives = 140/229 (61%), Gaps = 4/229 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II DDA++D AV  A  A F+ QG+ C  G+R YV   +YD FVE+ K R  + +
Sbjct: 250 GKSPLIIFDDADLDDAVSAAMVANFYTQGEVCTHGTRVYVQRAMYDAFVEQLKERTEKLI 309

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS----KGYFIQPTIF 552
           VGDP     + G  I     EKVL  I S KESGATL  GG ++      KG F+ PT+F
Sbjct: 310 VGDPMNMETQIGSLISKSHLEKVLGAISSAKESGATLLTGGFQVTERGLEKGCFVAPTVF 369

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
            D +++M   Q+EIFGPV  VL F D DEVI RANNT YGLAAGV+T ++ KA+ +   L
Sbjct: 370 VDCRDEMPHVQNEIFGPVMSVLVFDDEDEVIARANNTQYGLAAGVFTQNLSKAHRVIHQL 429

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           +AG  WIN +    A +P GGYK+SGIGRE G  +L +Y Q K+V   L
Sbjct: 430 QAGICWINTWGNSPAEMPVGGYKLSGIGRENGQETLLHYTQTKSVFVEL 478



 Score = 29.6 bits (65), Expect(2) = 3e-53
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           + LKPVT+ELGGKSP
Sbjct: 239 ATLKPVTMELGGKSP 253



>gb:AE016813_339333 Vibrio vulnificus CMCP6 chromosome II section 6
           of 6 of the complete sequence.>gb:AE016796_1049057
           Vibrio vulnificus CMCP6 chromosome II complete sequence.
          Length = 486

 Score =  202 bits (515), Expect(2) = 3e-53
 Identities = 110/229 (48%), Positives = 140/229 (61%), Gaps = 4/229 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II DDA++D AV  A  A F+ QG+ C  G+R YV   +YD FVE+ K R  + +
Sbjct: 250 GKSPLIIFDDADLDDAVSAAMVANFYTQGEVCTHGTRVYVQRAMYDAFVEQLKERTEKLI 309

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS----KGYFIQPTIF 552
           VGDP     + G  I     EKVL  I S KESGATL  GG ++      KG F+ PT+F
Sbjct: 310 VGDPMNMETQIGSLISKSHLEKVLGAISSAKESGATLLTGGFQVTERGLEKGCFVAPTVF 369

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
            D +++M   Q+EIFGPV  VL F D DEVI RANNT YGLAAGV+T ++ KA+ +   L
Sbjct: 370 VDCRDEMPHVQNEIFGPVMSVLVFDDEDEVIARANNTQYGLAAGVFTQNLSKAHRVIHQL 429

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           +AG  WIN +    A +P GGYK+SGIGRE G  +L +Y Q K+V   L
Sbjct: 430 QAGICWINTWGNSPAEMPVGGYKLSGIGRENGQETLLHYTQTKSVFVEL 478



 Score = 29.6 bits (65), Expect(2) = 3e-53
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           + LKPVT+ELGGKSP
Sbjct: 239 ATLKPVTMELGGKSP 253



>gb:BA000043_736776 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 513

 Score =  205 bits (521), Expect(2) = 6e-53
 Identities = 103/224 (45%), Positives = 145/224 (64%), Gaps = 4/224 (1%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+ +DA++D AV  + F +F + GQ C +G+R +V +R++DE VE+  A      +G P 
Sbjct: 267 ILLEDADLDLAVPGSLFGVFLHSGQLCESGTRLFVPDRLHDEVVERLVALTKTLQIGHPL 326

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG----SKGYFIQPTIFSDVKE 537
               + GP I   Q E VL YI +GK+ GAT+ CGG  +       G+F+ PTIFS+V  
Sbjct: 327 DPATDVGPVISKRQKETVLSYIEAGKQEGATIVCGGHEVEVPGCEGGHFVAPTIFSNVTN 386

Query: 536 DMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTV 357
           DM IAQ+EIFGPV  ++++ D++E +  AN+T YGLAAGV+T D++KA  +A  L+AG V
Sbjct: 387 DMKIAQEEIFGPVLSIIRYHDVEEAVTMANDTIYGLAAGVWTRDVNKAYAIAGRLQAGVV 446

Query: 356 WINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           WIN + +     PFGGYK SGIGRE G YSL+ Y Q+K V T +
Sbjct: 447 WINDWHMLRNDAPFGGYKQSGIGREMGKYSLDAYTQLKHVHTSM 490



 Score = 26.2 bits (56), Expect(2) = 6e-53
 Identities = 12/18 (66%), Positives = 13/18 (72%)
 Frame = -1

Query: 942 LQKSNLKPVTLELGGKSP 889
           L    +K VTLELGGKSP
Sbjct: 248 LAAETVKNVTLELGGKSP 265



>gb:BC048941_2099885 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A3, mRNA (cDNA clone IMAGE:6441903), partial
           cds.
          Length = 171

 Score =  209 bits (531), Expect = 8e-53
 Identities = 102/170 (60%), Positives = 127/170 (74%), Gaps = 2/170 (1%)
 Frame = -2

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           VGDPF    EQGPQID +QF+K+L  I SGK+ GA LECGG  +  +G FI+PT+FSDV 
Sbjct: 2   VGDPFDAKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDRGLFIKPTVFSDVT 61

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           ++M IA++EIFGPVQ +LKFK+++EVIKRAN+T YGL A V+T ++DKA  LA  L +GT
Sbjct: 62  DNMRIAKEEIFGPVQPILKFKNLEEVIKRANSTDYGLTAAVFTKNLDKALKLAAALESGT 121

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL--KNP 216
           VWINCY+ F A  PFGG+KMSG GRE G Y+L  Y +VK V   L  KNP
Sbjct: 122 VWINCYNAFYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLEEKNP 171



>gb:AY249529_602362 Rhodococcus ruber aldh6-adh6 operon, complete
           sequence.
          Length = 509

 Score =  203 bits (517), Expect(2) = 1e-52
 Identities = 100/221 (45%), Positives = 138/221 (62%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+  D + D AV  +  A  FN GQ C AG+R YV + IY++F +     A +  
Sbjct: 285 GKSANIVFADCDFDAAVAGSVAAWMFNHGQACTAGTRLYVEDSIYEKFTQAVADAAAQAT 344

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           +G       E GP +D +QF+KV  Y+R+G E G     GG R G  GYFIQPT+F DV+
Sbjct: 345 IGHGLDPATELGPLVDQDQFDKVSYYLRAGIEDGGRALTGGGRHGDTGYFIQPTVFVDVE 404

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            D  +  DEIFGPV   L+F D+D+ +++AN++ YGLAAGV+T DI KA+ +A  L AG+
Sbjct: 405 PDHRVVTDEIFGPVVAALRFSDMDDAVRQANDSIYGLAAGVWTKDISKAHKVASRLHAGS 464

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           VW+N Y+ FD  +PFGG+K SG GRE G  +L+ Y Q ++V
Sbjct: 465 VWVNQYNGFDTAMPFGGFKQSGWGRELGKGALDLYTQTRSV 505



 Score = 26.9 bits (58), Expect(2) = 1e-52
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           K NLK V+LELGGKS
Sbjct: 273 KGNLKKVSLELGGKS 287



>pir|B97460|B97460 betaine aldehyde dehydrogenase (badh) [imported]
           - Agrobacterium tumefaciens (strain C58,
           Cereon)>pir|AE2678|AE2678 betaine aldehyde dehydrogenase
           betB [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE008015_232575 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 73 of 254 of the
           complete sequence.>gb:AE009049_247870 Agrobacterium
           tumefaciens str. C58 circular chromosome, section 75 of
           256 of the complete sequence.>gb:AE007869_1082244
           Agrobacterium tumefaciens str. C58 circular chromosome,
           complete sequence.>gb:AE008688_1085713 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 493

 Score =  204 bits (518), Expect(2) = 1e-52
 Identities = 101/224 (45%), Positives = 139/224 (62%), Gaps = 3/224 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA+I+ AV  A    F++ GQ C  G+R +V ++    F+E  K R    +
Sbjct: 259 GKSPMIVFDDADIESAVGGAMLGNFYSSGQVCSNGTRVFVQKKAKARFLENLKRRTEAMI 318

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGG---DRIGSKGYFIQPTIFS 549
           +GDP       GP +   Q EKVL YI  GK  GATL  GG   + +  +G ++QPT+F+
Sbjct: 319 LGDPLDYATHLGPLVSKAQQEKVLSYIEKGKAEGATLITGGGIPNNVAGEGAYVQPTVFA 378

Query: 548 DVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR 369
           DV +DM IA++EIFGPV CVL F D DEV+ RAN T +GLA GV+T+D+ +A+ +  GL 
Sbjct: 379 DVTDDMTIAREEIFGPVMCVLDFDDEDEVLARANATEFGLAGGVFTADLARAHRVVDGLE 438

Query: 368 AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           AGT+WIN Y++    IPFGG K SG GRE    +L +Y ++K V
Sbjct: 439 AGTLWINTYNLCPVEIPFGGSKQSGFGRENSAAALEHYSELKTV 482



 Score = 26.2 bits (56), Expect(2) = 1e-52
 Identities = 11/14 (78%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           +LK VT+ELGGKSP
Sbjct: 249 HLKHVTMELGGKSP 262



>gb:CR382135_1667771 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 512

 Score =  197 bits (500), Expect(2) = 2e-52
 Identities = 102/228 (44%), Positives = 133/228 (58%), Gaps = 7/228 (3%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ D+A+ID+AV      + FN GQ CCAGSR +V + I D F+ K K      V
Sbjct: 268 GKSPVVVFDNADIDQAVNWVSQGILFNHGQDCCAGSRLFVQDTIKDVFLAKLKTNFESHV 327

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGD-RIG------SKGYFIQP 561
           +GDPF     QGPQ+  +Q EK+  YI+SG E GATL  GG+ R+         GY++ P
Sbjct: 328 IGDPFDIKTFQGPQVSKQQQEKIQSYIKSGIEEGATLFTGGEQRLAHLSAQFKNGYYVSP 387

Query: 560 TIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLA 381
           TIF+D K  M I  +EIFGPV  V  F   +E +++ANNT YGLAAGV++ +  +   + 
Sbjct: 388 TIFTDCKPGMKIVDEEIFGPVLTVQSFSTEEEAVEKANNTEYGLAAGVFSQNASQCMRMV 447

Query: 380 RGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
             LR GTVW N Y      +PFGG K SG GRE G+  L  Y Q KAV
Sbjct: 448 HALRGGTVWCNHYMALSNAVPFGGMKQSGFGRELGIEGLKEYTQTKAV 495



 Score = 32.7 bits (73), Expect(2) = 2e-52
 Identities = 15/16 (93%), Positives = 15/16 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSNLK VTLELGGKSP
Sbjct: 256 KSNLKKVTLELGGKSP 271



>gb:SCU56604_1710509 Saccharomyces cerevisiae cytosolic aldehyde
           dehydrogenase gene, complete cds.
          Length = 501

 Score =  200 bits (509), Expect(2) = 4e-52
 Identities = 100/222 (45%), Positives = 142/222 (63%), Gaps = 1/222 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ DDANI + + +    +F N GQ C +GSR YV E IYDE +   KA     +
Sbjct: 276 GKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSGSRIYVQEGIYDELLAAFKAYLETEI 335

Query: 719 -VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDV 543
            VG+PF K   QG   + +QF+ ++ YI  GK+ GA +  GG+++G KGYFI+PT+F DV
Sbjct: 336 KVGNPFDKANFQGAITNRQQFDTIMNYIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDV 395

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
            EDM I ++EIFGPV  V KFK ++E ++ AN++ +GL +G+ T  +     +A+ L+AG
Sbjct: 396 NEDMRIVKEEIFGPVVTVAKFKTLEEGVEMANSSEFGLGSGIETESLSTGLKVAKMLKAG 455

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           TVWIN Y+ FD+ +PFGG K SG GRE G    + Y +VKAV
Sbjct: 456 TVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYHAYTEVKAV 497



 Score = 28.1 bits (61), Expect(2) = 4e-52
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           +SNLK +TLELGGKS
Sbjct: 264 ESNLKKITLELGGKS 278



>pir|S60929|S60929 probable aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) YPL061w - yeast (Saccharomyces
           cerevisiae)>gb:SCU39205_1710244 Saccharomyces cerevisiae
           chromosome XVI, left arm, cosmid 8460.
          Length = 500

 Score =  200 bits (509), Expect(2) = 4e-52
 Identities = 100/222 (45%), Positives = 142/222 (63%), Gaps = 1/222 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ DDANI + + +    +F N GQ C +GSR YV E IYDE +   KA     +
Sbjct: 275 GKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSGSRIYVQEGIYDELLAAFKAYLETEI 334

Query: 719 -VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDV 543
            VG+PF K   QG   + +QF+ ++ YI  GK+ GA +  GG+++G KGYFI+PT+F DV
Sbjct: 335 KVGNPFDKANFQGAITNRQQFDTIMNYIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDV 394

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
            EDM I ++EIFGPV  V KFK ++E ++ AN++ +GL +G+ T  +     +A+ L+AG
Sbjct: 395 NEDMRIVKEEIFGPVVTVAKFKTLEEGVEMANSSEFGLGSGIETESLSTGLKVAKMLKAG 454

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           TVWIN Y+ FD+ +PFGG K SG GRE G    + Y +VKAV
Sbjct: 455 TVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYHAYTEVKAV 496



 Score = 28.1 bits (61), Expect(2) = 4e-52
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           +SNLK +TLELGGKS
Sbjct: 263 ESNLKKITLELGGKS 277



>sp|P54115|DHA6_YEAST Magnesium-activated aldehyde dehydrogenase,
           cytosolic (EC 1.2.1.3) (Mg(2+)-activated acetaldehyde
           dehydrogenase) (Mg(2+)-ACDH).
          Length = 499

 Score =  200 bits (509), Expect(2) = 4e-52
 Identities = 100/222 (45%), Positives = 142/222 (63%), Gaps = 1/222 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ DDANI + + +    +F N GQ C +GSR YV E IYDE +   KA     +
Sbjct: 274 GKSAHLVFDDANIKKTLPNLVNGIFKNAGQICSSGSRIYVQEGIYDELLAAFKAYLETEI 333

Query: 719 -VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDV 543
            VG+PF K   QG   + +QF+ ++ YI  GK+ GA +  GG+++G KGYFI+PT+F DV
Sbjct: 334 KVGNPFDKANFQGAITNRQQFDTIMNYIDIGKKEGAKILTGGEKVGDKGYFIRPTVFYDV 393

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
            EDM I ++EIFGPV  V KFK ++E ++ AN++ +GL +G+ T  +     +A+ L+AG
Sbjct: 394 NEDMRIVKEEIFGPVVTVAKFKTLEEGVEMANSSEFGLGSGIETESLSTGLKVAKMLKAG 453

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           TVWIN Y+ FD+ +PFGG K SG GRE G    + Y +VKAV
Sbjct: 454 TVWINTYNDFDSRVPFGGVKQSGYGREMGEEVYHAYTEVKAV 495



 Score = 28.1 bits (61), Expect(2) = 4e-52
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKS 892
           +SNLK +TLELGGKS
Sbjct: 262 ESNLKKITLELGGKS 276



>gb:BA000012_667762 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 498

 Score =  201 bits (510), Expect(2) = 4e-52
 Identities = 104/225 (46%), Positives = 140/225 (62%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA+ID+AV  A  A+F + GQ C AGSR +V   I+DEFV +    A R  
Sbjct: 269 GKSPIIVCRDADIDKAVPVAAMAVFVHSGQICIAGSRLFVAREIHDEFVRRVAEFAGRLR 328

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSK----GYFIQPTIF 552
           +G   +   E GP I++ Q  KV  YI++G + GA L  GG R+       G FI PT+F
Sbjct: 329 IGHGIEAETEIGPLINARQAGKVEGYIKAGSDEGAKLVAGGSRLTGALYDGGNFIAPTVF 388

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
             V + M IA++EIFGPV   + F  +DEV+ RAN T YGLAAG++T+ +  A+ LAR +
Sbjct: 389 GSVSDKMTIAREEIFGPVISAMPFDTLDEVVARANATPYGLAAGIFTTHLGTAHKLARRI 448

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           RAG+VW+N Y   D  +PFGG KMSG GRE G+  L+ YL+ K+V
Sbjct: 449 RAGSVWVNMYHAIDPAVPFGGMKMSGYGREGGIEHLHEYLETKSV 493



 Score = 27.7 bits (60), Expect(2) = 4e-52
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           +NLK V+LELGGKSP
Sbjct: 258 TNLKRVSLELGGKSP 272



>gb:BX571871_788594 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 13/17.
          Length = 494

 Score =  206 bits (523), Expect(2) = 4e-52
 Identities = 106/225 (47%), Positives = 143/225 (63%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II  DAN+ +AV+ A  A+  NQGQ C +GSR ++H+ I+DEF++  K       
Sbjct: 263 GKSANIIFPDANMKKAVKYAAKAILLNQGQACESGSRLFLHKDIHDEFLKSLKTEFESIQ 322

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGY----FIQPTIF 552
           VGDP +K  + G Q+  EQ EK+L Y+   K+ GAT+  GG RI  KGY    FIQPTI 
Sbjct: 323 VGDPLEKETQMGSQVSQEQMEKILEYVEIAKKEGATIFTGGKRITEKGYDEGFFIQPTII 382

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           +DV  DM +A++EIFGPV  V+ F + ++VI+ AN++ YGLA  V+T DID+A  +A+ +
Sbjct: 383 TDVTNDMRVAREEIFGPVLAVIPFSEEEDVIRMANDSDYGLAGAVWTQDIDRALRVAKAV 442

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           R G +WIN Y    A  PFGGYK SGIGRE     L+ Y QVK +
Sbjct: 443 RTGRMWINTYHELPAHAPFGGYKKSGIGRETHKMMLDAYTQVKNI 487



 Score = 22.7 bits (47), Expect(2) = 4e-52
 Identities = 10/12 (83%), Positives = 10/12 (83%)
 Frame = -1

Query: 927 LKPVTLELGGKS 892
           L P TLELGGKS
Sbjct: 254 LIPATLELGGKS 265



>gb:BA000040_732036 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 495

 Score =  205 bits (521), Expect(2) = 5e-52
 Identities = 99/221 (44%), Positives = 143/221 (64%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    +I DDA+++ A + A   +FFN GQ C AGSR  V E+ YDE VE+  ARA    
Sbjct: 269 GKSANVIFDDADLEAASKAAASGIFFNAGQVCSAGSRVLVQEKAYDEVVERLAARAKSLK 328

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           +GDP  +    GP I  +Q + +L Y+  G++ GA+L  GG R+G +GYFI P +F++V+
Sbjct: 329 IGDPLDRKTALGPVISEKQMKSILDYVDIGQKEGASLVTGGTRVGERGYFISPAVFANVE 388

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
            +M I+Q+EIFGPV  ++KF+D  + ++ AN T Y LAAGV++ DI K    A+  RAGT
Sbjct: 389 HEMRISQEEIFGPVVSIIKFRDEADALRIANGTAYSLAAGVWSRDIGKLQRFAKRARAGT 448

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           VW+N Y   D  +P+GG + SG+GRE G  +L+N+ + KAV
Sbjct: 449 VWMNTYGYTDVRLPWGGERDSGLGREHGTAALDNFTEPKAV 489



 Score = 23.1 bits (48), Expect(2) = 5e-52
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -1

Query: 930 NLKPVTLELGGKS 892
           N K V+LELGGKS
Sbjct: 259 NFKRVSLELGGKS 271



>gb:AY437859_617604 Brachymonas petroleovorans cyclohexanone gene
           cluster, partial sequence.
          Length = 484

 Score =  203 bits (516), Expect(2) = 5e-52
 Identities = 102/220 (46%), Positives = 136/220 (61%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DA++ RAV  A   +++NQGQ C AGSR  V + +YD+F+E   A       GDP 
Sbjct: 265 IVFADADLKRAVRGATTGIYYNQGQMCTAGSRILVQDSLYDKFLEAFTAAIADLRPGDPL 324

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
                 G  +  EQFE+V  Y+  G+E GATL  GG     +GYF  PTIF+DVK +  I
Sbjct: 325 DPKTRMGALVSQEQFERVSHYVALGQEDGATLLAGGQGSAERGYFFPPTIFTDVKPEHRI 384

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
           AQ+EIFGPV  V++F   +E ++ AN   YGLAAGV+T+D+ +A+ +A GLRAGTVW+N 
Sbjct: 385 AQEEIFGPVVSVMRFGSEEEALRLANGVSYGLAAGVWTADVGRAHRVAHGLRAGTVWVNT 444

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           Y+      PFGGYK SGIGRE G   +  Y +VK +   L
Sbjct: 445 YNALWNEAPFGGYKQSGIGREGGREGIEPYTEVKNICLSL 484



 Score = 25.0 bits (53), Expect(2) = 5e-52
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           LK V+LELGGKSP
Sbjct: 251 LKRVSLELGGKSP 263



>gb:AB024945_4167 Alcaligenes faecalis phenanthrene degradative gene
           cluster (phnAb to phnE genes), complete cds.
          Length = 511

 Score =  204 bits (518), Expect(2) = 1e-51
 Identities = 104/230 (45%), Positives = 147/230 (63%), Gaps = 4/230 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    IIC DA++D A E A  ++  N+G+ C A +R +VHE + D FVEK +    +  
Sbjct: 273 GKSANIICADADMDAAAESAAMSIVVNKGEICFAATRHFVHESVMDAFVEKVQNILRKIR 332

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG----SKGYFIQPTIF 552
           VGDP     + GPQ    QF+KVL Y+  G+  GAT   GG R       +GYFI+PT+F
Sbjct: 333 VGDPMIPSTQMGPQASRMQFDKVLGYLDIGRNEGATTAMGGKRATVSGFEQGYFIEPTLF 392

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           +DV+  M IAQ+EIFGPV  V+ +KD  +VI+ AN+T +GLAAG++T +I +A+ +AR +
Sbjct: 393 TDVRNKMRIAQEEIFGPVGVVIPWKDEAQVIREANDTEFGLAAGLWTKNITQAHRMAREI 452

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
            AGTVW+N Y      +PFGGYK SG GRE  +  L++Y Q+K+V+  L+
Sbjct: 453 EAGTVWVNRYFNMIPNVPFGGYKQSGFGREFSLDVLSHYTQLKSVIVSLQ 502



 Score = 23.1 bits (48), Expect(2) = 1e-51
 Identities = 10/13 (76%), Positives = 11/13 (84%)
 Frame = -1

Query: 930 NLKPVTLELGGKS 892
           N+ P TLELGGKS
Sbjct: 263 NVIPQTLELGGKS 275



>sp|P54114|DHA3_YEAST Aldehyde dehydrogenase [NAD(P)+] 2 (EC
           1.2.1.5).>pir|S54527|S54527 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) 3 - yeast  (Saccharomyces
           cerevisiae)>gb:SC8520X_1705677 S.cerevisiae chromosome
           XIII cosmid 8520.
          Length = 506

 Score =  197 bits (501), Expect(2) = 2e-51
 Identities = 105/223 (47%), Positives = 143/223 (64%), Gaps = 7/223 (3%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRR--VVG- 714
           ++ +DA++D+A+E     +FFN GQ C A SR YV   IYD+FVEK K  A +   V G 
Sbjct: 276 LVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGK 335

Query: 713 -DPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI---GSKGYFIQPTIFSD 546
            DPF +    GP I S Q++++  YI  GK+               G+KGYFI PTIF+D
Sbjct: 336 FDPFDEKCIVGPVISSTQYDRIKSYIERGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTD 395

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           V E   + +DEIFGPV  V KF + D+ +K AN+T YGLA+ V+T D+ KA+  AR ++A
Sbjct: 396 VPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKA 455

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           GTVWIN  +  +A +PFGG+KMSGIGRE G   ++NYLQ+K+V
Sbjct: 456 GTVWINQTNQEEAKVPFGGFKMSGIGRESGDTGVDNYLQIKSV 498



 Score = 28.9 bits (63), Expect(2) = 2e-51
 Identities = 12/16 (75%), Positives = 14/16 (87%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK +TLE GGKSP
Sbjct: 259 QSNLKDITLECGGKSP 274



>gb:PSP296087_161296 Pseudonocardia sp. K1 ORF y, thmS gene, thma
           gene, ORF x, thmD gene, thmB gene, thm C gene, ORF Q,
           ORF Z and thm H gene.
          Length = 500

 Score =  198 bits (504), Expect(2) = 2e-51
 Identities = 97/223 (43%), Positives = 141/223 (63%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+  D++I++AV  A  A+F+N GQ C AGSR YVH ++YD+ VE   + A    
Sbjct: 274 GKSPVIVFGDSDIEQAVAGASSAIFYNNGQTCTAGSRLYVHRKVYDKVVEGIASEASALP 333

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
           +G         GP I +EQ ++V  YI  G+E+GA +  GGD +G  GYFIQPTI +   
Sbjct: 334 IGHGLDPATRIGPLISAEQRDRVTGYIAQGREAGAEVIVGGDTVGDGGYFIQPTILTKTD 393

Query: 539 EDMVIAQDEIFGPVQCVLKFKD--IDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
             M + ++EIFGPV C + F +  ID V++ ANN+ YGLAA +YT DI  A+ +A+ L+A
Sbjct: 394 PSMSVVREEIFGPVLCAMAFDEDTIDSVVREANNSVYGLAASIYTRDISVAHRVAKRLKA 453

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           GT+ IN + V D  +PFGG+K SG GR+ G  +++ Y +VK++
Sbjct: 454 GTIGINTHHVVDVALPFGGFKQSGYGRDMGRDAIDQYTEVKSI 496



 Score = 27.7 bits (60), Expect(2) = 2e-51
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           NLK V+LELGGKSP
Sbjct: 264 NLKKVSLELGGKSP 277



>sp|P54222|DHAB_RHIME Betaine aldehyde dehydrogenase (EC 1.2.1.8)
           (BADH).>gb:SME591785_184966 Sinorhizobium meliloti 1021
           complete chromosome; segment 4/12.
          Length = 487

 Score =  200 bits (508), Expect(2) = 2e-51
 Identities = 99/224 (44%), Positives = 142/224 (63%), Gaps = 3/224 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA+++ A+  A    F++ GQ C  G+R +V  +I + F+ + K R    V
Sbjct: 253 GKSPLIVFDDADLESAIGGAMLGNFYSTGQVCSNGTRVFVQRKIKEPFLARLKERTEAIV 312

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGG---DRIGSKGYFIQPTIFS 549
           +GDP  +  + GP + + Q +KV  YI  GK  GA L  GG   + +  +G +IQPT+F+
Sbjct: 313 IGDPLDEATQLGPMVSAAQRDKVFSYIGKGKAEGARLVTGGGIPNNVSGEGTYIQPTVFA 372

Query: 548 DVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR 369
           DV + M IA++EIFGPV CVL F D  EVI RAN T +GL+AGV+T+D+ +A+ +A  L 
Sbjct: 373 DVTDGMTIAREEIFGPVMCVLDFDDEVEVIARANATEFGLSAGVFTADLTRAHRVADRLE 432

Query: 368 AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           AGT+WIN Y++    IPFGG K SG GRE  V +LN+Y ++K V
Sbjct: 433 AGTLWINTYNLCPVEIPFGGSKQSGFGRENSVAALNHYTELKTV 476



 Score = 26.2 bits (56), Expect(2) = 2e-51
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           + LK VT+ELGGKSP
Sbjct: 242 AELKHVTMELGGKSP 256



>gb:AE006189_216418 Pasteurella multocida subsp. multocida str. Pm70
           section 156 of 204 of the complete
           genome.>gb:AE004439_1119148 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 486

 Score =  201 bits (512), Expect(2) = 2e-51
 Identities = 110/240 (45%), Positives = 151/240 (62%), Gaps = 10/240 (4%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    +I DDA++DRA++ A F +F   G+ C AGSR ++ E +YDEFV++  ARA R +
Sbjct: 245 GKSPVLIFDDADLDRALDAALFTIFSLNGERCTAGSRIFIQETVYDEFVKQFAARAKRLI 304

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGG-DRIGS------KGYFIQP 561
           VGDP     + G  I  + ++KV  YIR G E GATL  GG +R  +      KG+FIQP
Sbjct: 305 VGDPQDFNTQVGSMITRQHYDKVTGYIRIGLEEGATLLAGGLERPQNLPAHLQKGHFIQP 364

Query: 560 TIFSDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLA 381
           T+F+DV   M IAQ+EIFGPV C++KFKD  E ++ AN+  YGLA+ ++T DI KA  L+
Sbjct: 365 TVFADVDNRMRIAQEEIFGPVVCLMKFKDEAEALRLANDVEYGLASYIWTKDIAKALRLS 424

Query: 380 RGLRAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKN---PAW 210
            G+ AG V++N  +V D   PFGG K SGIGRE G YS   + ++K V   + +   P W
Sbjct: 425 NGIEAGMVFVNSQNVRDLRQPFGGIKASGIGREGGEYSFEVFAELKNVCISMHDHPIPRW 484



 Score = 24.6 bits (52), Expect(2) = 2e-51
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = -1

Query: 942 LQKSNLKPVTLELGGKSP 889
           L+ + LK  ++ELGGKSP
Sbjct: 231 LKHAGLKKYSMELGGKSP 248



>gb:BA000032_709653 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 2, complete sequence.
          Length = 486

 Score =  200 bits (508), Expect(2) = 2e-51
 Identities = 105/231 (45%), Positives = 140/231 (60%), Gaps = 4/231 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA +D AV  A  A F+ QG+ C  G+R +VHE IYD+FV + K R  + V
Sbjct: 250 GKSPLIVFDDAKLDDAVSAAMVANFYTQGEVCTNGTRVFVHESIYDDFVAQLKTRTEKLV 309

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGY----FIQPTIF 552
           VGDP  +  + G  I  E   KVL  I S K SGATL  GG ++   G     F+ PT+F
Sbjct: 310 VGDPLDENTQIGALISKEHESKVLSAIESAKASGATLLTGGYKVTDNGLQNGNFVAPTVF 369

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
            D  + M   Q EIFGPV  VLKF +  EVI+RAN+T YGLAAGV+T ++ +A+ +   +
Sbjct: 370 IDCDDSMSHVQQEIFGPVMSVLKFSEEAEVIERANDTDYGLAAGVFTQNLSRAHRVIHKI 429

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKN 219
           +AG  W+N +    A +P GGYK SGIGRE GV +L +Y Q K+V+  L +
Sbjct: 430 QAGICWVNAWGDSPAEMPVGGYKQSGIGRENGVETLKHYTQTKSVLVQLSD 480



 Score = 26.2 bits (56), Expect(2) = 2e-51
 Identities = 11/13 (84%), Positives = 12/13 (92%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           LK VT+ELGGKSP
Sbjct: 241 LKQVTMELGGKSP 253



>gb:AE016947_364380 Enterococcus faecalis V583, section 1 of 11 of
           the complete genome.>gb:AE016830_990868 Enterococcus
           faecalis V583, complete genome.
          Length = 496

 Score =  203 bits (516), Expect(2) = 2e-51
 Identities = 105/233 (45%), Positives = 145/233 (62%), Gaps = 4/233 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    II +DAN +RA+E     + FNQGQ CCAGSR +V   IYD+FVE  K +  +  
Sbjct: 260 GKSANIIFEDANWERALEGVQLGILFNQGQVCCAGSRVFVQSGIYDQFVEALKEKFEQVN 319

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS----KGYFIQPTIF 552
           VG P++K VE G QI+  Q E++L+Y+  G + GATL  GG R+      KG F+ PT+ 
Sbjct: 320 VGFPWEKDVEMGAQINEHQLEEILKYVEIGVKEGATLITGGQRLTENGLDKGAFLAPTLL 379

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           ++    M +AQ+EIFGPV  V+KF+  +EVI+ AN++ YGL   V++ DI+ A  +ARG+
Sbjct: 380 ANGTNAMCVAQEEIFGPVATVIKFETEEEVIRLANDSEYGLGGAVFSQDINVALRVARGV 439

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPA 213
           R G +W+N Y+   A  PFGGYK SGIGRE     L+ Y Q+K +    K  A
Sbjct: 440 RTGRMWVNTYNQLPAGAPFGGYKKSGIGRETHKSMLDAYTQMKNIYIVTKEEA 492



 Score = 22.7 bits (47), Expect(2) = 2e-51
 Identities = 10/12 (83%), Positives = 10/12 (83%)
 Frame = -1

Query: 927 LKPVTLELGGKS 892
           L P TLELGGKS
Sbjct: 251 LIPATLELGGKS 262



>gb:BC034531_2097679 Mus musculus RIKEN cDNA D330038I09 gene, mRNA
            (cDNA clone MGC:19039 IMAGE:4188055), complete cds.
          Length = 923

 Score =  196 bits (498), Expect(2) = 3e-51
 Identities = 96/223 (43%), Positives = 143/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV     A+FFN+G+ C A  R +V E I+DEFV +      +  
Sbjct: 697  GKSPLIIFSDCDLEKAVRMGMGAVFFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMK 756

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            +GDP  +  + GPQ      EK+L+Y  +G + GATL  GG ++   G+F++PT+F+ V+
Sbjct: 757  IGDPLDRSTDHGPQNHRAHLEKLLQYCETGVQEGATLVYGGRQVQRPGFFMEPTVFTGVE 816

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M +A++E FGP+  + KF+  DID V++RANNT YGLA+GV+T DI+KA  ++  L A
Sbjct: 817  DHMYLAKEESFGPIMVISKFQNGDIDGVLQRANNTEYGLASGVFTRDINKAMYVSDKLEA 876

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV+IN Y+  D   PFGG K SG G++ G  +LN YL++K V
Sbjct: 877  GTVFINTYNKTDVAAPFGGMKQSGFGKDLGEEALNEYLKIKTV 919



 Score = 29.3 bits (64), Expect(2) = 3e-51
 Identities = 13/15 (86%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK V+LELGGKSP
Sbjct: 686 SNLKKVSLELGGKSP 700



>gb:AY351634_1601688 Brassica napus betaine aldehyde dehydrogenase
           mRNA, complete cds.
          Length = 503

 Score =  198 bits (503), Expect(2) = 3e-51
 Identities = 97/232 (41%), Positives = 138/232 (59%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DD  ID+AVE   F  F+  GQ C A SR  VHE+I DEF++K         
Sbjct: 263 GKSPIIVFDDVKIDKAVEWTMFGCFWTNGQICSATSRLLVHEKIADEFLDKLVKWTKNIK 322

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSD 546
           + DPF++G   GP +   Q+E+V++++ + ++ GAT+ CGG R G   KGYF++P I S+
Sbjct: 323 ISDPFEEGCRLGPVVSKGQYERVVKFVSNARKEGATVLCGGARPGHLKKGYFVEPAIISN 382

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           V   M I +DE+FGPV CV  F   DE I+ AN++ YGLA  V ++D+++ + +++   A
Sbjct: 383 VTTSMEIWRDEVFGPVLCVKTFSTEDEAIQLANDSQYGLAGAVLSNDLERCDRVSKAFEA 442

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NC        P+GG K SG GRE G + L NYL VK V   + N  W
Sbjct: 443 GIVWVNCSQPCFCQAPWGGTKRSGFGRELGEWGLENYLSVKQVTQYISNEPW 494



 Score = 27.3 bits (59), Expect(2) = 3e-51
 Identities = 11/13 (84%), Positives = 13/13 (100%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +KPV+LELGGKSP
Sbjct: 254 VKPVSLELGGKSP 266



>gb:BC082822_2562898 Xenopus tropicalis hypothetical LOC496436, mRNA
            (cDNA clone MGC:79668 IMAGE:6980483), complete cds.
          Length = 902

 Score =  203 bits (517), Expect = 4e-51
 Identities = 96/223 (43%), Positives = 145/223 (65%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++D+AV     ++FFN+G+ C A  R ++ E I+DEFV++      +  
Sbjct: 676  GKSPLIIFQDCDLDKAVRMGMSSVFFNKGENCIAAGRLFLEESIHDEFVKRVVGEVKKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            +GDP  +  + GPQ      +K++ Y ++G + GA L  GG ++   G+F +PTIF+DV 
Sbjct: 736  IGDPLDRSTDHGPQNHKAHLDKLIEYCQTGVKEGAKLVYGGKQVERPGFFFEPTIFTDVT 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            ++M IA++E FGP+  + KFK  D+DEV+KRANNT +GLA+GV+T DI KA  ++  L+A
Sbjct: 796  DEMFIAKEESFGPIMIISKFKDGDVDEVLKRANNTEFGLASGVFTKDISKALYVSEKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV++N Y+  D   PFGG+K SG G++ G  +LN YL+ KAV
Sbjct: 856  GTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLKTKAV 898



>gb:AE016787_332879 Pseudomonas putida KT2440 section 14 of 21 of
           the complete genome.>gb:AE015451_947956 Pseudomonas
           putida KT2440 complete genome.
          Length = 497

 Score =  199 bits (506), Expect(2) = 4e-51
 Identities = 94/220 (42%), Positives = 139/220 (63%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVVGDPF 705
           I+  DAN+  A   A  A+FFNQGQ CCAGSR YVH + +D  V      A    +G+  
Sbjct: 279 IVMPDANLQEAAAGAATAIFFNQGQVCCAGSRLYVHRKHFDNVVADIAGIANAMKLGNGL 338

Query: 704 KKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVKEDMVI 525
              V+ GP I ++Q ++V  YI  G+E GAT+ CGG+  G  GYF++PT+  DV +   +
Sbjct: 339 DPAVQMGPLISAKQQDRVTGYIELGRELGATIACGGEGFGP-GYFVKPTVIVDVDQRHRL 397

Query: 524 AQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGTVWINC 345
            Q+EIFGPV   + F DIDEVI  AN+  YGL A ++++D+   + +   +++G+VW+NC
Sbjct: 398 VQEEIFGPVLVAMPFDDIDEVIGMANDNPYGLGASIWSNDLAAVHRMIPRIKSGSVWVNC 457

Query: 344 YDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
           +   D  +PFGGYKMSG+GRE G  ++ +Y ++K+V+  L
Sbjct: 458 HSALDPALPFGGYKMSGVGREMGSAAIEHYTELKSVLIKL 497



 Score = 25.8 bits (55), Expect(2) = 4e-51
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           N+  VTLELGGKSP
Sbjct: 264 NMTRVTLELGGKSP 277



>gb:DDU70317_1377411 Dictyostelium discoideum HydA (hydA) gene,
           partial cds.
          Length = 272

 Score =  202 bits (515), Expect = 6e-51
 Identities = 109/223 (48%), Positives = 140/223 (62%), Gaps = 3/223 (1%)
 Frame = -2

Query: 896 NRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRVV 717
           N  F  CD  +I +  +D  FA   N  Q CCA SR +V E IY+ F++          V
Sbjct: 41  NIFFNGCDVNHIAQCSKDYVFA---NSMQSCCAPSRFFVQENIYEAFLQIFTENIKLLKV 97

Query: 716 GDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI---GSKGYFIQPTIFSD 546
           GDP   G   GP +  +Q ++VL YI+ GKE GAT   GG        KGYF+QPTIF++
Sbjct: 98  GDPNVNGTNLGPLVSKQQHDRVLGYIQKGKEEGATCHLGGGNYHHADGKGYFVQPTIFTN 157

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           V +DM I ++EIFGPV  +L FK +DEVIKRANNT YGLAAGV+T DI  A  ++  L++
Sbjct: 158 VTDDMTICKEEIFGPVVVILPFKTVDEVIKRANNTTYGLAAGVWTKDISLALNVSNKLKS 217

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           G+VWIN Y     +IPFGGYK SGIGR+   Y++ +YL VKAV
Sbjct: 218 GSVWINEYYSIMPSIPFGGYKQSGIGRDLSEYAIQSYLSVKAV 260



 Score = 36.6 bits (83), Expect = 0.75
 Identities = 17/23 (73%), Positives = 18/23 (78%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSPFHYMR*C 868
           KSNLKPVTLELGGKSP  +   C
Sbjct: 25  KSNLKPVTLELGGKSPNIFFNGC 47



>gb:CR543861_102996 Acinetobacter sp. ADP1 complete genome.
          Length = 490

 Score =  196 bits (499), Expect(2) = 7e-51
 Identities = 99/229 (43%), Positives = 142/229 (62%), Gaps = 4/229 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    IIC+DAN+DRA + A  A FF+ GQ C  G+R ++ +R+   F +    R  R  
Sbjct: 255 GKSPLIICEDANLDRAADIAVMANFFSSGQVCTNGTRVFIPQRLKAAFEQAVVERVKRIR 314

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDR----IGSKGYFIQPTIF 552
           +GDP       GP +     EKVL YI SGK+ GA +  GG+R    + ++G ++QPT+F
Sbjct: 315 MGDPQHTDTNFGPLVSFPHMEKVLSYIESGKQQGAKVLIGGERATTGLLAQGAYVQPTVF 374

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           +D  +DM I Q+EIFGPV  +L +  I+E I+RANNT++GLAAGV T +I +A+ +   L
Sbjct: 375 TDCHDDMKIVQEEIFGPVMSILTYDTIEEAIERANNTNFGLAAGVVTQNISQAHQIIHQL 434

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
            AG  WIN +    A +P GGYK SG+GRE G+ +LN+Y + K++   L
Sbjct: 435 EAGICWINTWGESPAEMPVGGYKESGVGRENGISTLNHYTRTKSIQVEL 483



 Score = 27.7 bits (60), Expect(2) = 7e-51
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           S LK VT+ELGGKSP
Sbjct: 244 STLKEVTMELGGKSP 258



>sp|P47771|DHA2_YEAST Aldehyde dehydrogenase [NAD(P)+] 1 (EC
           1.2.1.5).>gb:SC8520X_1705678 S.cerevisiae chromosome
           XIII cosmid 8520.
          Length = 506

 Score =  194 bits (494), Expect(2) = 9e-51
 Identities = 106/223 (47%), Positives = 143/223 (64%), Gaps = 7/223 (3%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRR--VVG- 714
           ++ +DA++D+A++     +F+N GQ C A SR YV   IYD+FVEK K  A +   V G 
Sbjct: 276 LVFEDADLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGK 335

Query: 713 -DPFKKGVEQGPQIDSEQFEKVLRYIRSGK--ESGATLECGGDRIG-SKGYFIQPTIFSD 546
            DPF +    GP I S Q++++  YI  GK  E     +     IG +KGYFI PTIF+D
Sbjct: 336 FDPFDEKCIVGPVISSTQYDRIKSYIERGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTD 395

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           V +   + QDEIFGPV  V KF + D+ +K AN+T YGLA+ V+T D+ KA+  AR ++A
Sbjct: 396 VPQTSKLLQDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKA 455

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           GTVWIN  +  D T+PFGG+KMSGIGRE G   ++ YLQ KAV
Sbjct: 456 GTVWINSSNDEDVTVPFGGFKMSGIGRELGQSGVDTYLQTKAV 498



 Score = 29.3 bits (64), Expect(2) = 9e-51
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLE GGKSP
Sbjct: 259 QSNLKDVTLECGGKSP 274



>gb:BX640417_806704 Bordetella pertussis strain Tohama I, complete
           genome; segment 7/12.
          Length = 497

 Score =  197 bits (501), Expect(2) = 9e-51
 Identities = 99/222 (44%), Positives = 138/222 (62%), Gaps = 3/222 (1%)
 Frame = -2

Query: 899 GNRLFIICDDA-NIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRR 723
           G    II DD  ++DRA   A   +F NQG+ C AGSR YV   IYD FV K +A A   
Sbjct: 270 GKSPHIIFDDCPDLDRAALAAAIGIFNNQGEVCIAGSRLYVQAGIYDTFVSKVEACARAM 329

Query: 722 VVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI--GSKGYFIQPTIFS 549
             G+P       G  +D  Q  +VL Y+ SG+  GA L  GG+R+   S GY+I+PTIF 
Sbjct: 330 QPGNPLDPASPMGAMVDERQMARVLEYVESGRREGARLRMGGERVRADSGGYYIEPTIFE 389

Query: 548 DVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR 369
             + D+ I ++EIFGPV  V +F   DEV+ +AN + YGL +G++T+D+ +A+ ++R LR
Sbjct: 390 CARPDLTIVREEIFGPVLAVTRFDGEDEVVAQANASAYGLGSGLWTADLSRAHRVSRRLR 449

Query: 368 AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVK 243
           AG VW+NCY   D T+PFGG K SG GR+K +++L+ Y  +K
Sbjct: 450 AGLVWVNCYFDGDVTVPFGGVKQSGFGRDKSLHALDKYTSLK 491



 Score = 26.6 bits (57), Expect(2) = 9e-51
 Identities = 12/16 (75%), Positives = 13/16 (81%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK V LE GGKSP
Sbjct: 258 QSNLKQVWLECGGKSP 273



>sp|P28237|DHAB_BETVU Betaine-aldehyde dehydrogenase, chloroplast
           precursor (EC 1.2.1.8) (BADH).>pir|S19135|S19135
           betaine-aldehyde dehydrogenase (EC 1.2.1.8) precursor -
           beet>gb:BVBADHAC_1643070 B.vulgaris mRNA for
           salt-inducible betaine aldehyd dehydrogenase.
          Length = 500

 Score =  194 bits (494), Expect(2) = 1e-50
 Identities = 93/232 (40%), Positives = 137/232 (59%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ +D +ID+ VE   F  F+  GQ C A SR  VHE I  EF+++         
Sbjct: 263 GKSPIIVFEDVDIDQVVEWTMFGCFWTNGQICSATSRLLVHESIAAEFIDRLVKWTKNIK 322

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSD 546
           + DPF++G   GP I   Q++K++++I + K  GAT+ CGG R     KGYFI+PTI SD
Sbjct: 323 ISDPFEEGCRLGPVISKGQYDKIMKFISTAKSEGATILCGGSRPEHLKKGYFIEPTIISD 382

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           +   M I ++E+FGPV CV  F   DE ++ AN+T YGLA+ V++ D+++   +++ L +
Sbjct: 383 ISTSMQIWREEVFGPVLCVKTFSSEDEALELANDTEYGLASAVFSKDLERCERVSKLLES 442

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NC        P+GG K SG GRE G + + NYL +K V + + N  W
Sbjct: 443 GAVWVNCSQPCFVHAPWGGIKRSGFGRELGEWGIENYLNIKQVTSDISNEPW 494



 Score = 28.9 bits (63), Expect(2) = 1e-50
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +KPVTLELGGKSP
Sbjct: 254 VKPVTLELGGKSP 266



>gb:BX640430_810674 Bordetella parapertussis strain 12822, complete
           genome; segment 8/14.>gb:BX640442_814526 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           6/16.
          Length = 497

 Score =  197 bits (501), Expect(2) = 1e-50
 Identities = 99/222 (44%), Positives = 138/222 (62%), Gaps = 3/222 (1%)
 Frame = -2

Query: 899 GNRLFIICDDA-NIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRR 723
           G    II DD  ++DRA   A   +F NQG+ C AGSR YV   IYD FV K +A A   
Sbjct: 270 GKSPHIIFDDCPDLDRAALAAAIGIFNNQGEVCIAGSRLYVQAGIYDTFVSKVEACARAM 329

Query: 722 VVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRI--GSKGYFIQPTIFS 549
             G+P       G  +D  Q  +VL Y+ SG+  GA L  GG+R+   S GY+I+PTIF 
Sbjct: 330 QPGNPLDPASPMGAMVDERQMARVLEYVESGRREGARLRMGGERVRADSGGYYIEPTIFE 389

Query: 548 DVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR 369
             + D+ I ++EIFGPV  V +F   DEV+ +AN + YGL +G++T+D+ +A+ ++R LR
Sbjct: 390 CARPDLTIVREEIFGPVLAVTRFDGEDEVVAQANASAYGLGSGLWTADLSRAHRVSRRLR 449

Query: 368 AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVK 243
           AG VW+NCY   D T+PFGG K SG GR+K +++L+ Y  +K
Sbjct: 450 AGLVWVNCYFDGDVTVPFGGVKQSGFGRDKSLHALDKYTSLK 491



 Score = 26.2 bits (56), Expect(2) = 1e-50
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK + LE GGKSP
Sbjct: 258 QSNLKQIWLECGGKSP 273



>gb:RMU39940_166496 Sinorhizobium meliloti bet operon, complete
           sequence.
          Length = 487

 Score =  197 bits (501), Expect(2) = 1e-50
 Identities = 98/224 (43%), Positives = 141/224 (62%), Gaps = 3/224 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA+++ A+  A    F++ GQ C  G+R +V  +I + F+ + K R    V
Sbjct: 253 GKSPLIVFDDADLESAIGGAMLGNFYSTGQVCSNGTRVFVQRKIKEPFLARLKERTEAIV 312

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGG---DRIGSKGYFIQPTIFS 549
           +GDP  +  + GP + + Q +KV  YI  GK  GA L  GG   + +  +G +IQPT+F+
Sbjct: 313 IGDPLDEATQLGPMVSAAQRDKVFSYIGKGKAEGARLVTGGGIPNNVSGEGTYIQPTVFA 372

Query: 548 DVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR 369
           D  + M IA++EIFGPV CVL F D  EVI RAN T +GL+AGV+T+D+ +A+ +A  L 
Sbjct: 373 DDTDGMTIAREEIFGPVMCVLDFDDEVEVIARANATEFGLSAGVFTADLTRAHRVADRLE 432

Query: 368 AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           AGT+WIN Y++    IPFGG K SG GRE  V +LN+Y ++K V
Sbjct: 433 AGTLWINTYNLCPVEIPFGGSKQSGFGRENSVAALNHYTELKTV 476



 Score = 26.2 bits (56), Expect(2) = 1e-50
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           + LK VT+ELGGKSP
Sbjct: 242 AELKHVTMELGGKSP 256



>gb:AY596297_631726 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 508

 Score =  199 bits (505), Expect(2) = 1e-50
 Identities = 97/225 (43%), Positives = 139/225 (61%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++  DA++++AV+    ++FFN G+CCCAGSR +VHE I DEF+++  A A    
Sbjct: 279 GKSPLVVFPDADLEQAVQTTITSIFFNTGECCCAGSRLFVHEDIKDEFLDELAAAAEDLT 338

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGG----DRIGSKGYFIQPTIF 552
           V DP  +  + GP++ +EQ E+ L YI   +  GA    GG    D   S G F+ PT+ 
Sbjct: 339 VDDPLLESTDLGPKVTAEQVERTLGYIEEAEREGAAFVTGGSQPDDEALSDGCFVAPTLI 398

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
            ++  D    Q+EIFGPVQ V  + + DE+I+ AN+  YGLAAGV T D+ KA+  A+ +
Sbjct: 399 DEIDHDSKAVQEEIFGPVQEVFSWSEYDEMIELANDVDYGLAAGVLTEDLSKAHQCAKDI 458

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            AG +W+N Y+ F A  PFGGYK SGIGRE G  ++++Y Q K V
Sbjct: 459 EAGNIWVNTYNDFPAGQPFGGYKQSGIGREIGQETIDHYTQTKTV 503



 Score = 24.3 bits (51), Expect(2) = 1e-50
 Identities = 10/14 (71%), Positives = 12/14 (85%)
 Frame = -1

Query: 930 NLKPVTLELGGKSP 889
           ++  VTLELGGKSP
Sbjct: 269 SITDVTLELGGKSP 282



>pir|T31265|T31265 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) -
           Sphingomonas aromaticivorans plasmid
           pNL1>gb:AF079317_477320 Sphingomonas aromaticivorans
           plasmid pNL1, complete plasmid sequence.
          Length = 501

 Score =  199 bits (505), Expect(2) = 2e-50
 Identities = 106/230 (46%), Positives = 139/230 (60%), Gaps = 4/230 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+C DA+ID AVE A  +   N+G+ C AGSR ++H+ I DEF+ K K       
Sbjct: 263 GKSAHIVCGDADIDAAVESATMSTVLNKGEVCLAGSRLFLHQSIQDEFLAKFKTALEGIR 322

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSK----GYFIQPTIF 552
            GDP     + G Q    QF+KV  Y+R   E GA +  GG R  +     G FI+PT+F
Sbjct: 323 QGDPLDMATQLGAQASKMQFDKVQSYLRLATEEGAEVLTGGSRSDAADLADGNFIKPTVF 382

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           ++V   M IAQ+EIFGPV  V+ + D D+++K+ANNT YGLA GV+T DI +A+ +AR L
Sbjct: 383 TNVNNSMRIAQEEIFGPVTSVITWSDEDDMMKQANNTTYGLAGGVWTKDIARAHRIARKL 442

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLK 222
             GTVWIN Y    A +P GGYK SG GRE     LN+Y Q K+VV  L+
Sbjct: 443 ETGTVWINRYYNLKANMPLGGYKQSGFGREFSHEVLNHYTQTKSVVVNLQ 492



 Score = 23.9 bits (50), Expect(2) = 2e-50
 Identities = 10/14 (71%), Positives = 12/14 (85%)
 Frame = -1

Query: 933 SNLKPVTLELGGKS 892
           +N+ P TLELGGKS
Sbjct: 252 ANIIPQTLELGGKS 265



>gb:BVBADHD_1643071 B.vulgaris mRNA for salt-inducible betaine
           aldehyd dehydrogenase.
          Length = 500

 Score =  194 bits (492), Expect(2) = 2e-50
 Identities = 93/232 (40%), Positives = 136/232 (58%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ +D +ID+ VE   F  F+  GQ C A SR  VHE I  EF+++         
Sbjct: 263 GKSPIIVFEDVDIDQVVEWTMFGCFWTNGQICSATSRLLVHESIAAEFIDRLVKWTKNIK 322

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSD 546
           + DPF++G   GP I   Q++K++++I + K  GAT+ CGG R     KGYFI+PTI SD
Sbjct: 323 ISDPFEEGCRLGPVISKGQYDKIMKFISTAKSEGATILCGGSRPEHLKKGYFIEPTIISD 382

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           +   M I ++E+FGPV CV  F   DE +  AN+T YGLA+ V++ D+++   +++ L +
Sbjct: 383 ISTSMQIWREEVFGPVLCVKTFSSEDEALDLANDTEYGLASAVFSKDLERCERVSKLLES 442

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NC        P+GG K SG GRE G + + NYL +K V + + N  W
Sbjct: 443 GAVWVNCSQPCFVHAPWGGIKRSGFGRELGEWGIENYLNIKQVTSDISNEPW 494



 Score = 28.9 bits (63), Expect(2) = 2e-50
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +KPVTLELGGKSP
Sbjct: 254 VKPVTLELGGKSP 266



>pir|T51172|T51172 betaine-aldehyde dehydrogenase (EC 1.2.1.8)
           [imported] - Amaranthus
           hypochondriacus>gb:AF017150_1761533 Amaranthus
           hypochondriacus betaine aldehyde dehydrogenase
           (ahybadh4) mRNA, complete cds.
          Length = 500

 Score =  194 bits (492), Expect(2) = 2e-50
 Identities = 95/232 (40%), Positives = 134/232 (57%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    +I +D ++D+A E   F  F+  GQ C A SR  VHE I  EF+++         
Sbjct: 263 GKSPIVIFEDVDLDKAAEWTAFGCFWTNGQICSATSRLLVHESIAAEFLDRLVKWCKNIK 322

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSD 546
           + DPF++G   GP +   Q+EKVL++I + K  GAT+ CGG R     KGY+++PTI SD
Sbjct: 323 ISDPFEEGCRLGPVVSKSQYEKVLKFISTAKSEGATILCGGSRPEHLKKGYYVEPTIISD 382

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           V   M I ++E+FGPV CV  F   DE I+ AN+T YGL A V + D+D+   + + L+A
Sbjct: 383 VSTSMQIWREEVFGPVLCVKTFGSEDEAIELANDTQYGLGAAVLSKDLDRCERITKALQA 442

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NC        P+GG K SG GRE G + + NYL +K V   + +  W
Sbjct: 443 GIVWVNCSQPCFCQAPWGGTKRSGFGRELGEWGIENYLNIKQVTEYISDEPW 494



 Score = 28.9 bits (63), Expect(2) = 2e-50
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +KPVTLELGGKSP
Sbjct: 254 VKPVTLELGGKSP 266



>gb:BT011186_1357793 Drosophila melanogaster RE12154 full insert cDNA.
          Length = 913

 Score =  195 bits (495), Expect(2) = 3e-50
 Identities = 97/224 (43%), Positives = 139/224 (62%), Gaps = 3/224 (1%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++D+AV+    ++FFN+G+ C A  R +V +RI+DEF+ +         
Sbjct: 686  GKSPLIIFADCDMDKAVKHGMSSVFFNKGEDCIAAGRLFVEDRIHDEFIRRVLKDLRTMT 745

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS-KGYFIQPTIFSDV 543
            +GDP  +    GPQ     F+K+L + R G + GA L  GG R+ + KGYF  PT+F++V
Sbjct: 746  IGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRVPNLKGYFFTPTVFTNV 805

Query: 542  KEDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR 369
             +DM IAQ+E FGP+  + KF   DID +++RAN T YGLA+GV+T DI KA   A  + 
Sbjct: 806  TDDMFIAQEESFGPIMIISKFNGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIE 865

Query: 368  AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            AGTV++N Y+  D   PFGG+K SG G++ G  +LN YL+ K V
Sbjct: 866  AGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEALNEYLKTKCV 909



 Score = 27.3 bits (59), Expect(2) = 3e-50
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK  +LELGGKSP
Sbjct: 675 SNLKKCSLELGGKSP 689



>gb:AE014134_1130036 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003670_1220143 Drosophila melanogaster
            chromosome 2L, section 79 of 83 of the complete sequence.
          Length = 913

 Score =  195 bits (495), Expect(2) = 3e-50
 Identities = 97/224 (43%), Positives = 139/224 (62%), Gaps = 3/224 (1%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++D+AV+    ++FFN+G+ C A  R +V +RI+DEF+ +         
Sbjct: 686  GKSPLIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFIRRVLKDLRTMT 745

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS-KGYFIQPTIFSDV 543
            +GDP  +    GPQ     F+K+L + R G + GA L  GG R+ + KGYF  PT+F++V
Sbjct: 746  IGDPLDRSTAHGPQNHKAHFDKLLEFCRRGVDEGAKLVYGGCRVPNLKGYFFTPTVFTNV 805

Query: 542  KEDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLR 369
             +DM IAQ+E FGP+  + KF   DID +++RAN T YGLA+GV+T DI KA   A  + 
Sbjct: 806  TDDMFIAQEESFGPIMIISKFNGSDIDSLMQRANRTEYGLASGVFTKDIGKALNFADRIE 865

Query: 368  AGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            AGTV++N Y+  D   PFGG+K SG G++ G  +LN YL+ K V
Sbjct: 866  AGTVFVNVYNKTDVAAPFGGFKQSGYGKDLGQEALNEYLKTKCV 909



 Score = 27.3 bits (59), Expect(2) = 3e-50
 Identities = 12/15 (80%), Positives = 13/15 (86%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SNLK  +LELGGKSP
Sbjct: 675 SNLKKCSLELGGKSP 689



>pir|T50272|T50272 probable aldehyde dehydrogenase [imported] -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC922_1718469 S.pombe chromosome I cosmid
           c922.
          Length = 496

 Score =  190 bits (483), Expect(2) = 3e-50
 Identities = 97/223 (43%), Positives = 140/223 (62%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRR- 723
           G   F++ +DA++D+AV+ A   + +N GQ C + SR YV + +YD+F+E  K   ++  
Sbjct: 266 GKSPFLVFEDADLDQAVKWAALGIMYNSGQICTSNSRIYVQDSVYDKFIELFKKHVIQDY 325

Query: 722 VVGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSK-GYFIQPTIFSD 546
           +VG PF      GP ++  Q+ ++  YI  GK+ GA L  G + +  K GYFI PTIF+D
Sbjct: 326 IVGMPFDDNTVVGPVVNKTQYNRIKNYIEQGKKEGAKLVLGDEPLPLKQGYFISPTIFAD 385

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
             E+M I ++EIFGPV  + KFK  DE I++ANNT YGLAA  +T D+++A+ ++  L A
Sbjct: 386 CSENMTIVKEEIFGPVVAISKFKTEDEAIEKANNTTYGLAAMCFTKDLERAHRVSDELEA 445

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           G V+IN  +  D   PFGG KMSGIG E G   +  Y Q+KAV
Sbjct: 446 GMVFINSTENSDIQAPFGGIKMSGIGNELGSNGIEMYTQIKAV 488



 Score = 32.0 bits (71), Expect(2) = 3e-50
 Identities = 15/19 (78%), Positives = 15/19 (78%)
 Frame = -1

Query: 942 LQKSNLKPVTLELGGKSPF 886
           L  SNLK VTLE GGKSPF
Sbjct: 252 LAASNLKAVTLECGGKSPF 270



>gb:BA000012_671964 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 487

 Score =  196 bits (499), Expect(2) = 3e-50
 Identities = 99/225 (44%), Positives = 142/225 (63%), Gaps = 4/225 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ DDA+I+ A+  A    F++ GQ C  G+R +V   I+D FVE+   R  +  
Sbjct: 252 GKSPLIVFDDADIENAIGGAMLGNFYSTGQICSNGTRVFVQSGIHDRFVERLVERTKKIR 311

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGY----FIQPTIF 552
           +G+P     + GP +   Q EKV+ YI  GK+ GA L CGG+    +G+    F++PT+F
Sbjct: 312 IGNPLDPETQMGPLVSKAQHEKVVGYIGIGKQDGAVLACGGNVPSLQGFDGGFFVEPTVF 371

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           + V + M IA++EIFGPV  VLKF   DEVI RAN+T +GLAAGV+T D+ +A+ +   L
Sbjct: 372 TGVTDTMRIAREEIFGPVMSVLKFDGEDEVIDRANDTEFGLAAGVFTRDLPRAHRVIAEL 431

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           +AGT WIN Y++    IPFGG+K SGIGRE  + +L  Y Q+K++
Sbjct: 432 QAGTCWINAYNLTPVEIPFGGFKQSGIGRENSLAALALYSQLKSI 476



 Score = 25.4 bits (54), Expect(2) = 3e-50
 Identities = 11/18 (61%), Positives = 13/18 (72%)
 Frame = -1

Query: 942 LQKSNLKPVTLELGGKSP 889
           L  S +K  T+ELGGKSP
Sbjct: 238 LAGSKMKHATMELGGKSP 255



>gb:CR857124_1181376 Pongo pygmaeus mRNA; cDNA DKFZp469I2021 (from
            clone DKFZp469I2021).
          Length = 902

 Score =  193 bits (491), Expect(2) = 4e-50
 Identities = 93/223 (41%), Positives = 143/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV+    ++FFN+G+ C A  R +V + I+DEFV +      +  
Sbjct: 676  GKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDP  +  + GPQ       K++ Y + G + GATL CGG+++   G+F +PT+F+DV+
Sbjct: 736  VGDPLDRDTDHGPQNHHAHLMKLMEYCQRGVKEGATLVCGGNQVPRPGFFFEPTVFTDVE 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGPV  + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 796  DHMFIAKEESFGPVMIISRFADGDVDTVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV++N Y+  D   PFGG+K SG G++ G  +LN YL+VK V
Sbjct: 856  GTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTV 898



 Score = 28.1 bits (61), Expect(2) = 4e-50
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SN+K V+LELGGKSP
Sbjct: 665 SNVKKVSLELGGKSP 679



>gb:CR858605_1182772 Pongo pygmaeus mRNA; cDNA DKFZp469C068 (from
            clone DKFZp469C068).
          Length = 811

 Score =  193 bits (491), Expect(2) = 4e-50
 Identities = 93/223 (41%), Positives = 143/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV+    ++FFN+G+ C A  R +V + I+DEFV +      +  
Sbjct: 585  GKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMK 644

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VGDP  +  + GPQ       K++ Y + G + GATL CGG+++   G+F +PT+F+DV+
Sbjct: 645  VGDPLDRDTDHGPQNHHAHLMKLMEYCQRGVKEGATLVCGGNQVPRPGFFFEPTVFTDVE 704

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGPV  + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 705  DHMFIAKEESFGPVMIISRFADGDVDTVLSRANATEFGLASGVFTRDINKALYVSDKLQA 764

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV++N Y+  D   PFGG+K SG G++ G  +LN YL+VK V
Sbjct: 765  GTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTV 807



 Score = 28.1 bits (61), Expect(2) = 4e-50
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SN+K V+LELGGKSP
Sbjct: 574 SNVKKVSLELGGKSP 588



>gb:AE016793_334442 Pseudomonas putida KT2440 section 20 of 21 of
           the complete genome.>gb:AE015451_949519 Pseudomonas
           putida KT2440 complete genome.
          Length = 490

 Score =  193 bits (490), Expect(2) = 6e-50
 Identities = 99/229 (43%), Positives = 139/229 (60%), Gaps = 4/229 (1%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    IIC DA++D+A + A  A F++ GQ C  G+R ++   +   F  K   R  R  
Sbjct: 255 GKSPLIICADADLDKAADIAMMANFYSSGQVCTNGTRVFIPAEMKAAFEAKIAERVARIR 314

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGS----KGYFIQPTIF 552
           VG+P  +    GP +  +  E VL YI  GKE GA + CGG+R+ +    KG F+ PT+F
Sbjct: 315 VGNPEDENTNFGPLVSFQHMESVLGYIAKGKEEGARVLCGGERLTAGDFAKGAFVAPTVF 374

Query: 551 SDVKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGL 372
           +D  +DM I ++EIFGPV  +L ++  +EVI+RAN+T YGLAAGV T+DI +A+ +   L
Sbjct: 375 TDCTDDMTIVKEEIFGPVMSILTYETEEEVIRRANDTDYGLAAGVCTNDITRAHRIIHKL 434

Query: 371 RAGTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPL 225
            AG  WIN +    A +P GGYK SG+GRE GV SL  Y ++K+V   L
Sbjct: 435 EAGICWINAWGESPAEMPVGGYKQSGVGRENGVSSLAQYTRIKSVQVEL 483



 Score = 28.1 bits (61), Expect(2) = 6e-50
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           S+LK VT+ELGGKSP
Sbjct: 244 SSLKEVTMELGGKSP 258



>pir|S70189|S54615 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) 2 -
           yeast  (Saccharomyces cerevisiae)>gb:SCALD2_1706491
           S.cerevisiae ALD2 gene.
          Length = 506

 Score =  191 bits (486), Expect(2) = 7e-50
 Identities = 105/223 (47%), Positives = 143/223 (64%), Gaps = 7/223 (3%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRR--VVG- 714
           ++ +DA++D+A++     +F+N GQ C A SR YV   IYD+FVEK K  A +   V G 
Sbjct: 276 LVFEDADLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGK 335

Query: 713 -DPFKKGVEQGPQIDSEQFEKVLRYIRSGK--ESGATLECGGDRIG-SKGYFIQPTIFSD 546
            DPF +    GP I S Q++++  YI  GK  E     +     IG +KGYFI PTIF+D
Sbjct: 336 FDPFDEKCIVGPVISSTQYDRIKSYIERGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTD 395

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           V +   + QDEIFGPV  V KF + D+ +K AN+T YGLA+ V+T D+ KA+  AR ++A
Sbjct: 396 VPQTSKLLQDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKA 455

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           GTVWIN  +  D T+PFGG+KMSGIGRE G   ++ YLQ K+V
Sbjct: 456 GTVWINQSNDEDVTVPFGGFKMSGIGRELGDNVVDTYLQTKSV 498



 Score = 29.3 bits (64), Expect(2) = 7e-50
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           +SNLK VTLE GGKSP
Sbjct: 259 QSNLKDVTLECGGKSP 274



>gb:BC089101_2110709 Rattus norvegicus formyltetrahydrofolate
            dehydrogenase, mRNA (cDNA clone MGC:105431
            IMAGE:7306458), complete cds.
          Length = 902

 Score =  192 bits (488), Expect(2) = 9e-50
 Identities = 91/223 (40%), Positives = 144/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV+    ++FFN+G+ C A  R +V E I+++FV+K      +  
Sbjct: 676  GKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIHNQFVQKVVEEVEKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            +G+P ++    GPQ       K++ Y + G + GATL CGG+++   G+F QPT+F+DV+
Sbjct: 736  IGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVE 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGP+  + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 796  DHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV+IN Y+  D   PFGG+K SG G++ G  +LN YL++K V
Sbjct: 856  GTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTV 898



 Score = 28.1 bits (61), Expect(2) = 9e-50
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SN+K V+LELGGKSP
Sbjct: 665 SNVKKVSLELGGKSP 679



>pir|A23709|A60560 formyltetrahydrofolate dehydrogenase (EC 1.5.1.6) /
            aldehyde dehydrogenase (NADP) (EC 1.2.1.4) - rat
          Length = 902

 Score =  192 bits (488), Expect(2) = 9e-50
 Identities = 91/223 (40%), Positives = 144/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV+    ++FFN+G+ C A  R +V E I+++FV+K      +  
Sbjct: 676  GKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIHNQFVQKVVEEVEKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            +G+P ++    GPQ       K++ Y + G + GATL CGG+++   G+F QPT+F+DV+
Sbjct: 736  IGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVE 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGP+  + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 796  DHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV+IN Y+  D   PFGG+K SG G++ G  +LN YL++K V
Sbjct: 856  GTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTV 898



 Score = 28.1 bits (61), Expect(2) = 9e-50
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SN+K V+LELGGKSP
Sbjct: 665 SNVKKVSLELGGKSP 679



>sp|P28037|FTDH_RAT 10-formyltetrahydrofolate dehydrogenase (EC
            1.5.1.6) (10-FTHFDH) (FBP- CI).>gb:RAT10HCO_2131260
            Rattus norvegicus 10-formyltetrahydrofolate dehydrogenase
            mRNA, complete cds.
          Length = 902

 Score =  192 bits (488), Expect(2) = 9e-50
 Identities = 91/223 (40%), Positives = 144/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV+    ++FFN+G+ C A  R +V E I+++FV+K      +  
Sbjct: 676  GKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIHNQFVQKVVEEVEKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            +G+P ++    GPQ       K++ Y + G + GATL CGG+++   G+F QPT+F+DV+
Sbjct: 736  IGNPLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVE 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGP+  + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 796  DHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV+IN Y+  D   PFGG+K SG G++ G  +LN YL++K V
Sbjct: 856  GTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTV 898



 Score = 28.1 bits (61), Expect(2) = 9e-50
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SN+K V+LELGGKSP
Sbjct: 665 SNVKKVSLELGGKSP 679



>sp|O75891|FTDH_HUMAN 10-formyltetrahydrofolate dehydrogenase (EC
            1.5.1.6) (10-FTHFDH).>gb:AF052732_1879268 Homo sapiens
            10-formyltetrahydrofolate dehydrogenase mRNA, complete
            cds.
          Length = 902

 Score =  191 bits (486), Expect(2) = 9e-50
 Identities = 92/223 (41%), Positives = 144/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G   FII  D ++++AV+    ++FF++G+ C A  R +V + I+DEFV +      +  
Sbjct: 676  GESPFIIFADCDLNKAVQMGMSSVFFSKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            VG+P  +  + GPQ       K++ Y + G + GATL CGG+++   G+F +PT+F+DV+
Sbjct: 736  VGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGATLVCGGNQVPRPGFFFEPTVFTDVE 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGPV  + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 796  DHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV++N Y+  D   PFGG+K SG G++ G  +LN YL+VK V
Sbjct: 856  GTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTV 898



 Score = 28.9 bits (63), Expect(2) = 9e-50
 Identities = 12/16 (75%), Positives = 15/16 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSPF 886
           SN+K V+LELGG+SPF
Sbjct: 665 SNVKKVSLELGGESPF 680



>gb:CR380952_1650556 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 504

 Score =  190 bits (483), Expect(2) = 1e-49
 Identities = 102/221 (46%), Positives = 135/221 (61%), Gaps = 5/221 (2%)
 Frame = -2

Query: 884 IICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFV----EKAKARAMRRVV 717
           ++  DA+ID A+E     +F+N GQ C A SR YV E IYD+F+    E  K        
Sbjct: 276 VVFQDADIDNAIEYIANGIFYNSGQNCTANSRVYVQEDIYDDFIKRFTEHTKENWKFGSK 335

Query: 716 GDPFKKGVEQGPQIDSEQFEKVLRYIRSGKES-GATLECGGDRIGSKGYFIQPTIFSDVK 540
            DPF K    GP +  +QFE V  YIR GKE     +    ++   KGYFI PTIF+DV 
Sbjct: 336 CDPFDKDCTVGPVVSEKQFETVNDYIRHGKEEENLQIHQTVEKCDCKGYFISPTIFTDVP 395

Query: 539 EDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAGT 360
           +   + ++EIFGPV  V KFKD  E IK AN+T+YGLA+ V+T +I  AN  AR +++GT
Sbjct: 396 QGSKLMKEEIFGPVVVVAKFKDYKEAIKLANDTNYGLASMVFTKNISVANWFARDIKSGT 455

Query: 359 VWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           VWIN  +  D T+PFGG+K SGIGRE G   + +Y+Q+K V
Sbjct: 456 VWINSSNEEDPTVPFGGFKQSGIGRELGETGVESYMQIKTV 496



 Score = 30.0 bits (66), Expect(2) = 1e-49
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -1

Query: 936 KSNLKPVTLELGGKSP 889
           KSN+K VTLE GGKSP
Sbjct: 259 KSNMKDVTLECGGKSP 274



>gb:AF170094_1774243 Avicennia marina betaine aldehyde dehydrogenase
           (BADH) mRNA, complete cds.
          Length = 496

 Score =  191 bits (486), Expect(2) = 1e-49
 Identities = 98/232 (42%), Positives = 133/232 (57%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ +D ++D A E   F  F+  GQ C A SR  VHE I   F+EK      +  
Sbjct: 259 GKSPIVVFEDVDLDTAAEWTLFGCFWTNGQICSATSRLLVHESIATTFLEKLVKWCEKIK 318

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSD 546
           + DP ++G   GP +   Q+EKV++YI + KE GAT+ CGG R     KGYF+QPTI +D
Sbjct: 319 ISDPLEEGCRLGPIVSRRQYEKVMKYISTAKEEGATILCGGARPEHLEKGYFVQPTIITD 378

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           VK  M I  +E+FGPV CV  F   DE ++ AN+THYGLAA V + D+D+   +A+  + 
Sbjct: 379 VKTSMQIWIEEVFGPVLCVKTFATEDEAVELANDTHYGLAAAVISKDLDRCERMAKAFQV 438

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NC        P+GG K SG GRE G   L+ YL VK V   + +  W
Sbjct: 439 GAVWVNCSQPCFYQAPWGGKKRSGFGRELGERGLDIYLNVKQVTRYVSSEPW 490



 Score = 28.9 bits (63), Expect(2) = 1e-49
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +KPVTLELGGKSP
Sbjct: 250 VKPVTLELGGKSP 262



>gb:CR380954_1651278 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 497

 Score =  192 bits (489), Expect(2) = 1e-49
 Identities = 94/222 (42%), Positives = 140/222 (63%), Gaps = 1/222 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ +DAN+++ + +    +F N GQ C +GSR Y    IYD  +++ KA   + +
Sbjct: 272 GKSAHLVFNDANLEKTLPNLVNGIFKNAGQICSSGSRIYAQAGIYDRLLKEFKAYIEKNI 331

Query: 719 -VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDV 543
            VG+PF +   QG   + EQ+  +L+YI  GKE GA +  GG+    KGYFI+PT+F DV
Sbjct: 332 KVGNPFDESNFQGAITNKEQYNTILKYINIGKEEGAKVLTGGETAAEKGYFIKPTVFYDV 391

Query: 542 KEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRAG 363
           KEDM + ++EIFGP   + KF++I++ +  AN++ +GL AG+ T ++  A  +A+ L +G
Sbjct: 392 KEDMRVVKEEIFGPCVTISKFEEIEDGVAMANDSEFGLGAGIETENLSTALKVAKMLHSG 451

Query: 362 TVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
           TVWIN Y+ FD+ +PFGGYK SG GRE G      Y Q KAV
Sbjct: 452 TVWINTYNDFDSRVPFGGYKQSGYGREMGSEVYECYTQTKAV 493



 Score = 27.7 bits (60), Expect(2) = 1e-49
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = -1

Query: 933 SNLKPVTLELGGKS 892
           SNLK +TLELGGKS
Sbjct: 261 SNLKKITLELGGKS 274



>gb:BC024055_2094353 Mus musculus formyltetrahydrofolate
            dehydrogenase, mRNA (cDNA clone MGC:36387 IMAGE:5098789),
            complete cds.
          Length = 902

 Score =  192 bits (487), Expect(2) = 1e-49
 Identities = 90/223 (40%), Positives = 144/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV+    ++FFN+G+ C A  R +V + I+D+FV+K      +  
Sbjct: 676  GKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDQFVQKVVEEVGKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            +G+P  +    GPQ       K++ Y + G + GATL CGG+++   G+F QPT+F+DV+
Sbjct: 736  IGNPLDRDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVE 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGP++ + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 796  DHMYIAKEESFGPIRIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV++N Y+  D   PFGG+K SG G++ G  +LN YL++K V
Sbjct: 856  GTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTV 898



 Score = 28.1 bits (61), Expect(2) = 1e-49
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SN+K V+LELGGKSP
Sbjct: 665 SNVKKVSLELGGKSP 679



>sp|Q8R0Y6|FTDH_MOUSE 10-formyltetrahydrofolate dehydrogenase (EC
            1.5.1.6) (10-FTHFDH).>gb:BC025939_2095237 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:37834 IMAGE:5099360), complete
            cds.>gb:BC028817_2096325 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:36396 IMAGE:5101815), complete
            cds.>gb:BC030722_2096853 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:36386 IMAGE:5098671), complete
            cds.>gb:BC030723_2096854 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:36390 IMAGE:5100007), complete
            cds.>gb:BC030727_2096858 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:37826 IMAGE:5099026), complete
            cds.>gb:BC030730_2096861 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:37892 IMAGE:5101835), complete cds.
          Length = 902

 Score =  191 bits (486), Expect(2) = 2e-49
 Identities = 90/223 (40%), Positives = 143/223 (64%), Gaps = 2/223 (0%)
 Frame = -2

Query: 899  GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
            G    II  D ++++AV+    ++FFN+G+ C A  R +V + I+D+FV+K      +  
Sbjct: 676  GKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDQFVQKVVEEVGKMK 735

Query: 719  VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIGSKGYFIQPTIFSDVK 540
            +G+P  +    GPQ       K++ Y + G + GATL CGG+++   G+F QPT+F+DV+
Sbjct: 736  IGNPLDRDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVE 795

Query: 539  EDMVIAQDEIFGPVQCVLKFK--DIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
            + M IA++E FGP+  + +F   D+D V+ RAN T +GLA+GV+T DI+KA  ++  L+A
Sbjct: 796  DHMYIAKEESFGPIMIISRFADGDVDAVLSRANATEFGLASGVFTRDINKALYVSDKLQA 855

Query: 365  GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAV 237
            GTV++N Y+  D   PFGG+K SG G++ G  +LN YL++K V
Sbjct: 856  GTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRIKTV 898



 Score = 28.1 bits (61), Expect(2) = 2e-49
 Identities = 12/15 (80%), Positives = 14/15 (93%)
 Frame = -1

Query: 933 SNLKPVTLELGGKSP 889
           SN+K V+LELGGKSP
Sbjct: 665 SNVKKVSLELGGKSP 679



>gb:AB043539_1520004 Avicennia marina mRNA for betaine aldehyde
           dehydrogenase, complete cds.
          Length = 503

 Score =  191 bits (484), Expect(2) = 2e-49
 Identities = 99/232 (42%), Positives = 132/232 (56%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    ++ +D ++D A E   F  F+  GQ C A SR  VHE I   F+EK      +  
Sbjct: 266 GKSPIVVFEDVDLDTAAEWTLFGCFWTNGQICSATSRLLVHESIAATFLEKLVKWCEKIK 325

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSD 546
           + DP ++G   GP +   Q+EKV++YI + KE GAT+ CGG R     KGYF+QPTI +D
Sbjct: 326 ISDPLEEGCRLGPIVSRRQYEKVMKYISTAKEEGATILCGGARPEHLEKGYFVQPTIITD 385

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           VK  M I  +E+FGPV CV  F   DE I  AN+THYGLAA V + D+D+   +A+  + 
Sbjct: 386 VKTSMQIWIEEVFGPVLCVKTFATEDEAIDLANDTHYGLAAAVISKDLDRCERMAKAFQV 445

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NC        P+GG K SG GRE G   L+ YL VK V   + +  W
Sbjct: 446 GAVWVNCSQPCFYQAPWGGKKRSGFGRELGERGLDIYLNVKQVTQYVSSEPW 497



 Score = 28.9 bits (63), Expect(2) = 2e-49
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +KPVTLELGGKSP
Sbjct: 257 VKPVTLELGGKSP 269



>sp|P42757|DHAB_ATRHO Betaine-aldehyde dehydrogenase, chloroplast
           precursor (EC 1.2.1.8) (BADH).>pir|S49205|S49205
           betaine-aldehyde dehydrogenase (EC 1.2.1.8) precursor -
           Atriplex hortensis>gb:AHBADH_1811110 A.hortensis mRNA
           for betaine-aldehyde dehydrogenase.
          Length = 502

 Score =  191 bits (484), Expect(2) = 2e-49
 Identities = 93/232 (40%), Positives = 136/232 (58%), Gaps = 2/232 (0%)
 Frame = -2

Query: 899 GNRLFIICDDANIDRAVEDAHFALFFNQGQCCCAGSRTYVHERIYDEFVEKAKARAMRRV 720
           G    I+ +D +I+ AVE   F +F+  GQ C A SR  VHE I  EFV++         
Sbjct: 265 GKSPVIMFEDIDIETAVEWTLFGVFWTNGQICSATSRLLVHESIAAEFVDRMVKWTKNIK 324

Query: 719 VGDPFKKGVEQGPQIDSEQFEKVLRYIRSGKESGATLECGGDRIG--SKGYFIQPTIFSD 546
           + DPF++G   GP I   Q++K++++I + K  GAT+ CGG R     KGY+I+PTI +D
Sbjct: 325 ISDPFEEGCRLGPVISKGQYDKIMKFISTAKSEGATILCGGSRPEHLKKGYYIEPTIITD 384

Query: 545 VKEDMVIAQDEIFGPVQCVLKFKDIDEVIKRANNTHYGLAAGVYTSDIDKANTLARGLRA 366
           +   M I ++E+FGPV CV  FK  DE I+ AN+T YGLA  V++ D+++   + + L  
Sbjct: 385 ITTSMQIWKEEVFGPVICVKTFKTEDEAIELANDTEYGLAGAVFSKDLERCERVTKALEV 444

Query: 365 GTVWINCYDVFDATIPFGGYKMSGIGREKGVYSLNNYLQVKAVVTPLKNPAW 210
           G VW+NC        P+GG K SG GRE G + + NYL +K V + + +  W
Sbjct: 445 GAVWVNCSQPCFVHAPWGGVKRSGFGRELGEWGIENYLNIKQVTSDISDEPW 496



 Score = 28.9 bits (63), Expect(2) = 2e-49
 Identities = 12/13 (92%), Positives = 13/13 (100%)
 Frame = -1

Query: 927 LKPVTLELGGKSP 889
           +KPVTLELGGKSP
Sbjct: 256 VKPVTLELGGKSP 268


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,046,135,923
Number of Sequences: 1806583
Number of extensions: 23520706
Number of successful extensions: 57189
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 52074
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 55190
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 69432926502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)