BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12486
         (855 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY714244_1624016 Pisum sativum MtN19-like protein mRNA, compl...   189   4e-47   
gb:AP004464_1841443 Oryza sativa (japonica cultivar-group) genom...   171   1e-41   
gb:MTY15367_1687720 Medicago truncatula mRNA for MtN19 gene.          171   2e-41   
gb:AY081281_1568627 Arabidopsis thaliana putative protein (At5g6...   165   9e-40   
gb:AY065363_1566475 Arabidopsis thaliana unknown protein (At5g61...   165   9e-40   
gb:AB010069_1510861 Arabidopsis thaliana genomic DNA, chromosome...   159   5e-38   
gb:AY487545_2154888 Uncultured organism clone 2A33 nitrilase (BD...    35   1.8     
gb:CEY43F8C_1370033 Caenorhabditis elegans YAC Y43F8C, complete ...    35   2.4     
gb:AE014186_938059 Plasmodium falciparum 3D7 chromosome 11 compl...    34   3.1     
gb:CR382129_1662171 Yarrowia lipolytica chromosome C of strain C...    34   4.1     
sp|P05046|LEC_SOYBN|LEC_SOYBN Lectin precursor (Agglutinin) (SBA).>pir|S27...    34   4.1     Glycine max [soybeans]
gb:PFMAL4P1_1394687 Plasmodium falciparum MAL4P1.                      33   5.3     
gb:AY221982_1590565 Cicer arietinum lectin mRNA, partial cds.          33   6.9     
gb:A14134_1447529 promoter and lectin gene.                            33   6.9     
sp|P02867|LEC_PEA|LEC_PEA Lectin precursor.>pir|A26844|LNPM lectin precu...    33   6.9     Pisum sativum [garden pea]
sp|Q03100|CYAA_DICDI|CYAA_DICDI Adenylate cyclase, aggregation specific (EC...    33   6.9     Dictyostelium discoideum


>gb:AY714244_1624016 Pisum sativum MtN19-like protein mRNA, complete
           cds.
          Length = 435

 Score =  189 bits (481), Expect = 4e-47
 Identities = 89/136 (65%), Positives = 109/136 (80%), Gaps = 1/136 (0%)
 Frame = -2

Query: 851 GYNSMHHCKIEYSVEPCSTAAAK-SGCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLY 675
           G NS H+CKIEY V+ CST   + +GCV   + S+   +GG VIYGVAHQH+GG GSTLY
Sbjct: 277 GINSDHNCKIEYRVDSCSTDHKEGNGCVDVMKTSLPLQTGGYVIYGVAHQHSGGIGSTLY 336

Query: 674 GEDGRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSH 495
           G+DGR ICSS+P YG G E GNESGYIVGM+TCYP+PG++KI DGE+LT+ SNY+S + H
Sbjct: 337 GQDGRVICSSIPSYGNGNEAGNESGYIVGMSTCYPKPGSMKIMDGETLTLESNYNSTKEH 396

Query: 494 TGVMGLFYILVADPVP 447
           TGVMGLFYILVA+ +P
Sbjct: 397 TGVMGLFYILVAEQLP 412



>gb:AP004464_1841443 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0665C04.>gb:AP004592_1842023 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0666G10.
          Length = 424

 Score =  171 bits (434), Expect = 1e-41
 Identities = 78/133 (58%), Positives = 102/133 (76%), Gaps = 4/133 (3%)
 Frame = -2

Query: 830 CKIEYSVEPCSTA-AAKSGCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLYGEDGRAI 654
           CK+EY VE CS    AK+ C+  K      P GGD+++GVAHQH+GG G++L+G+DGR +
Sbjct: 271 CKVEYQVEECSPENRAKNECIDVKVTKEVIPCGGDIVFGVAHQHSGGIGASLHGQDGRLL 330

Query: 653 CSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGVMGLF 474
           C+S+P YG+G E GNE  YIVGM+TCYP+PG+VK++DGE LT+VSNYSS + HTGVMGL 
Sbjct: 331 CASIPSYGKGEEAGNEDNYIVGMSTCYPKPGSVKVSDGEVLTVVSNYSSDRQHTGVMGLL 390

Query: 473 YILVAD---PVPE 444
           YILVA+   P P+
Sbjct: 391 YILVAEQEQPAPK 403



>gb:MTY15367_1687720 Medicago truncatula mRNA for MtN19 gene.
          Length = 411

 Score =  171 bits (433), Expect = 2e-41
 Identities = 79/139 (56%), Positives = 102/139 (73%), Gaps = 1/139 (0%)
 Frame = -2

Query: 851 GYNSMHHCKIEYSVEPCSTAAA-KSGCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLY 675
           G    H CK+EY VEPC+T+   +S CV  KR S    +GG VIYGV HQH+G  GSTLY
Sbjct: 272 GMRPNHDCKLEYEVEPCNTSFVNRSSCVDVKRASFPMQNGGYVIYGVGHQHSGAIGSTLY 331

Query: 674 GEDGRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSH 495
           G+DGR IC+S+P YG+G   G+E GY+VGM+TCYP PG++KI DGE LT+ +N+SS+  +
Sbjct: 332 GQDGRVICTSIPKYGKGRRAGDEKGYVVGMSTCYPIPGSIKIFDGEILTLEANHSSNIRY 391

Query: 494 TGVMGLFYILVADPVPESR 438
           +GVMGLFY LVA+ +P  R
Sbjct: 392 SGVMGLFYFLVAEKLPPYR 410



>gb:AY081281_1568627 Arabidopsis thaliana putative protein
           (At5g61820) mRNA, complete cds.
          Length = 475

 Score =  165 bits (418), Expect = 9e-40
 Identities = 88/190 (46%), Positives = 120/190 (63%), Gaps = 2/190 (1%)
 Frame = -2

Query: 851 GYNSMHHCKIEYSVEPCSTAAAKSGCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLYG 672
           G +  H C +EY V+PC T     GCV  K+ S+  P  G ++YGVAHQH GG G  LY 
Sbjct: 288 GDSQEHICHVEYEVKPCKTNG--DGCVDVKKKSLVMPFDGYIVYGVAHQHAGGIGGALYR 345

Query: 671 EDGRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHT 492
           E+G  IC+S+P YG G EPGNE+GYIVGM++CYP    VK++ GE+LT+ SNYS+   HT
Sbjct: 346 ENGEGICASMPKYGNGDEPGNEAGYIVGMSSCYP-ADPVKVSYGETLTLESNYSNAVGHT 404

Query: 491 GVMGLFYILVADPVPESRSFL--RSQIKGGEMMILPNAILILAFVGIAVLGVAVIMSRRR 318
           GVMGLFYILVA  +PE  S L  +   +     +   AI  +  V   V+ +A ++ RR+
Sbjct: 405 GVMGLFYILVAQQLPEPDSSLPNKQHFEAPARSLSFLAIFAVTVVVAVVVLIAAVIYRRQ 464

Query: 317 GERENDYEPI 288
            +RE+ Y+ +
Sbjct: 465 -KREDGYQSL 473



>gb:AY065363_1566475 Arabidopsis thaliana unknown protein
           (At5g61820) mRNA, complete cds.>gb:AY117191_1579232
           Arabidopsis thaliana unknown protein (At5g61820) mRNA,
           complete cds.
          Length = 475

 Score =  165 bits (418), Expect = 9e-40
 Identities = 88/190 (46%), Positives = 120/190 (63%), Gaps = 2/190 (1%)
 Frame = -2

Query: 851 GYNSMHHCKIEYSVEPCSTAAAKSGCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLYG 672
           G +  H C +EY V+PC T     GCV  K+ S+  P  G ++YGVAHQH GG G  LY 
Sbjct: 288 GDSQEHICHVEYEVKPCKTNG--DGCVDVKKKSLVMPFDGYIVYGVAHQHAGGIGGALYR 345

Query: 671 EDGRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHT 492
           E+G  IC+S+P YG G EPGNE+GYIVGM++CYP    VK++ GE+LT+ SNYS+   HT
Sbjct: 346 ENGEGICASMPKYGNGDEPGNEAGYIVGMSSCYP-ADPVKVSYGETLTLESNYSNAVGHT 404

Query: 491 GVMGLFYILVADPVPESRSFL--RSQIKGGEMMILPNAILILAFVGIAVLGVAVIMSRRR 318
           GVMGLFYILVA  +PE  S L  +   +     +   AI  +  V   V+ +A ++ RR+
Sbjct: 405 GVMGLFYILVAQQLPEPDSSLPNKQHFEAPARSLSFLAIFAVTVVVAVVVLIAAVIYRRQ 464

Query: 317 GERENDYEPI 288
            +RE+ Y+ +
Sbjct: 465 -KREDGYQSL 473



>gb:AB010069_1510861 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MAC9.
          Length = 517

 Score =  159 bits (403), Expect = 5e-38
 Identities = 78/141 (55%), Positives = 97/141 (68%)
 Frame = -2

Query: 851 GYNSMHHCKIEYSVEPCSTAAAKSGCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLYG 672
           G +  H C +EY V+PC T     GCV  K+ S+  P  G ++YGVAHQH GG G  LY 
Sbjct: 294 GDSQEHICHVEYEVKPCKTNG--DGCVDVKKKSLVMPFDGYIVYGVAHQHAGGIGGALYR 351

Query: 671 EDGRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHT 492
           E+G  IC+S+P YG G EPGNE+GYIVGM++CYP    VK++ GE+LT+ SNYS+   HT
Sbjct: 352 ENGEGICASMPKYGNGDEPGNEAGYIVGMSSCYP-ADPVKVSYGETLTLESNYSNAVGHT 410

Query: 491 GVMGLFYILVADPVPESRSFL 429
           GVMGLFYILVA  +PE  S L
Sbjct: 411 GVMGLFYILVAQQLPEPDSSL 431



>gb:AY487545_2154888 Uncultured organism clone 2A33 nitrilase
           (BD5326) gene, complete cds.
          Length = 335

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = -2

Query: 704 HTGGTGSTLYGEDGRAICSSLPIYGEGM 621
           H GG  + +YG DGRA+C  LP   EG+
Sbjct: 249 HAGGGHAIIYGPDGRALCEKLPENQEGL 276



>gb:CEY43F8C_1370033 Caenorhabditis elegans YAC Y43F8C, complete
           sequence.
          Length = 422

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 32/113 (28%), Positives = 50/113 (44%), Gaps = 10/113 (8%)
 Frame = -2

Query: 815 SVEPCSTAAAKS--GCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLYGEDGRAICS-- 648
           S +P S +   S  G  H KR+++S   GG    G +    G + S   G  G A+ S  
Sbjct: 235 SEDPSSISGGPSAGGSHHPKRMAMSSSGGGAGASGPSSSAPGPSSSYSTGAGGGALLSTG 294

Query: 647 -SLPIYGEGMEPGNES-----GYIVGMTTCYPQPGTVKIADGESLTIVSNYSS 507
            ++PI G G   G++      G +V      P   TV  +   S  I++++SS
Sbjct: 295 HAVPIMGAGGTGGHKRIMQPIGKMVATRAVIPTRYTVAPSSSTSTVILNSHSS 347



>gb:AE014186_938059 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014837_1228793 Plasmodium falciparum 3D7
           chromosome 11 section 2 of 8 of the complete sequence.
          Length = 1812

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
 Frame = +3

Query: 312 FTPTPTHNNSNTKHCNSNKC*NQNSI---W*YHHLTTLNLRTKERTRFWYR 455
           FT TP HNN+N  + N+N   N N+I       H   LN+ T E+ +F+ +
Sbjct: 439 FTTTPIHNNNNNNNNNNNN--NNNNISMDGLSPHSNILNINTNEKNQFFLK 487



>gb:CR382129_1662171 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 2465

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 31/111 (27%), Positives = 48/111 (43%), Gaps = 2/111 (1%)
 Frame = -2

Query: 806  PCSTAAAKSGCVHTKRLSVSFPSGGDVIYGVAHQHTGGTGSTLYGEDGRAICSSLPIYGE 627
            P + A   +G VHTK  +  FP+     Y  ++Q  G TGST  G++          YG 
Sbjct: 1564 PENPAVNPTGEVHTKLRADGFPTEETPRYAPSNQFDGFTGSTPLGQN----------YGS 1613

Query: 626  GMEPGNESGYIVGMTTCYP--QPGTVKIADGESLTIVSNYSSHQSHTGVMG 480
                 + +   +  T+ YP  Q  T+ + +  +  I + Y S Q   GV G
Sbjct: 1614 DYTGDSHN---LNSTSPYPQHQNQTIGMPEENARNISAPYESTQEGPGVAG 1661



>sp|P05046|LEC_SOYBN Lectin precursor (Agglutinin)
           (SBA).>pir|S27365|S27365 lectin precursor -
           soybean>gb:SOYLEA_1716036 Soybean lectin (Le1) gene,
           complete cds.
          Length = 285

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 19/64 (29%), Positives = 33/64 (51%)
 Frame = -2

Query: 665 GRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGV 486
           GRA+ S+ PI+    E G+ + +       +  P T ++ADG +  +    +  Q+H G 
Sbjct: 81  GRALYST-PIHIWDKETGSVASFAASFNFTFYAPDTKRLADGLAFFLAPIDTKPQTHAGY 139

Query: 485 MGLF 474
           +GLF
Sbjct: 140 LGLF 143



>gb:PFMAL4P1_1394687 Plasmodium falciparum MAL4P1.
          Length = 4138

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 243  LSINSQSKAKPPSHHYRFIIILPFTPTPTHNNSNTKHCNSNKC*NQNSIW*YHH 404
            +++N+++K K  +++   +I    T T T+NN+N  + N+N   N N+I  YH+
Sbjct: 869  MNLNNRNKNKNNTNNKNNVITTTTTTTTTNNNNNNNNNNNNNNNNNNNI--YHN 920



>gb:AY221982_1590565 Cicer arietinum lectin mRNA, partial cds.
          Length = 212

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 20/64 (31%), Positives = 32/64 (50%)
 Frame = -2

Query: 665 GRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGV 486
           GRA+ SS PI+    E GN + ++   T     P +  +ADG +  I    +  Q+  G 
Sbjct: 9   GRALYSS-PIHIWDRETGNVANFVTSFTFVINAPNSYNVADGFTFFIAPVDTKPQTGGGY 67

Query: 485 MGLF 474
           +G+F
Sbjct: 68  LGVF 71



>gb:A14134_1447529 promoter and lectin gene.
          Length = 275

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 20/64 (31%), Positives = 32/64 (50%)
 Frame = -2

Query: 665 GRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGV 486
           GRA+ SS PI+    E GN + ++   T     P +  +ADG +  I    +  Q+  G 
Sbjct: 72  GRALYSS-PIHIWDRETGNVANFVTSFTFVINAPNSYNVADGFTFFIAPVDTKPQTGGGY 130

Query: 485 MGLF 474
           +G+F
Sbjct: 131 LGVF 134



>sp|P02867|LEC_PEA Lectin precursor.>pir|A26844|LNPM lectin
           precursor - garden pea>gb:PEALECB_1699705 Pea PSL1 gene
           encoding lectin, complete cds.>gb:PSLECA_1702201 Pisum
           sativum lecA gene for lectin.>gb:PSLLECTIN_1702223
           P.sativum psl gene for Psl lectin.
          Length = 275

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 20/64 (31%), Positives = 32/64 (50%)
 Frame = -2

Query: 665 GRAICSSLPIYGEGMEPGNESGYIVGMTTCYPQPGTVKIADGESLTIVSNYSSHQSHTGV 486
           GRA+ SS PI+    E GN + ++   T     P +  +ADG +  I    +  Q+  G 
Sbjct: 72  GRALYSS-PIHIWDRETGNVANFVTSFTFVINAPNSYNVADGFTFFIAPVDTKPQTGGGY 130

Query: 485 MGLF 474
           +G+F
Sbjct: 131 LGVF 134



>sp|Q03100|CYAA_DICDI Adenylate cyclase, aggregation specific (EC
            4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl
            cyclase).>pir|B42239|B42239 adenylate cyclase (EC
            4.6.1.1) aggregation stage - slime mold (Dictyostelium
            discoideum)>gb:DDIADCYA04_1377014 Dictyostelium
            discoideum adenylyl cyclase aggregation protein (ACA)
            gene, exon 4 and complete cds.
          Length = 1407

 Score = 33.1 bits (74), Expect = 6.9
 Identities = 18/72 (25%), Positives = 36/72 (50%)
 Frame = +3

Query: 309  PFTPTPTHNNSNTKHCNSNKC*NQNSIW*YHHLTTLNLRTKERTRFWYRISN*NVEKPHD 488
            P   T  +NN+N  + N+N   NQN+I+  ++    + + K ++   + I   N++KP  
Sbjct: 840  PILDTTVNNNNNNNNTNNNNK-NQNNIYGNNNNNEEDFKIKSKSNSSFEIEMSNIKKPKS 898

Query: 489  SGMALMAAIIRH 524
              +  +  I+ H
Sbjct: 899  RFIDRVMGILHH 910


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 914,998,448
Number of Sequences: 1806583
Number of extensions: 20292980
Number of successful extensions: 62213
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 57799
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 61908
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 57913030826
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)