BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12396
         (623 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY099869_1576894 Arabidopsis thaliana FKBP-type peptidyl-prol...   157   1e-37   
gb:AY086603_1571650 Arabidopsis thaliana clone 26144 mRNA, compl...   157   2e-37   
gb:AC069474_1540939 Arabidopsis thaliana chromosome 3 BAC T2E22 ...   144   1e-33   
gb:AP004742_1844194 Oryza sativa (japonica cultivar-group) genom...    99   4e-20   
gb:BA000045_741518 Gloeobacter violaceus PCC 7421 DNA, complete ...    49   7e-05   
gb:BA000045_742789 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   8e-04   
pir|S77269|S77269 CAB/ELIP/HLIP-related protein - Synechocystis ...    45   0.001   Synechocystis sp. PCC 6803
pir|AC2100|AC2100 CAB/ELIP/HLIP-related protein [imported] - Nos...    44   0.002   Nostoc sp. PCC 7120
pir|S75295|S75295 high light-inducible protein ssl2542 - Synecho...    44   0.003   Synechocystis sp. PCC 6803
gb:BA000039_727700 Thermosynechococcus elongatus BP-1 DNA, compl...    43   0.005   
gb:BA000039_726230 Thermosynechococcus elongatus BP-1 DNA, compl...    42   0.008   
pir|AG2271|AG2271 CAB/ELIP/HLIP superfamily [imported] - Nostoc ...    42   0.011   Nostoc sp. PCC 7120
gb:BA000039_727992 Thermosynechococcus elongatus BP-1 DNA, compl...    41   0.014   
gb:AP008231_580965 Synechococcus elongatus PCC 6301 DNA, complet...    41   0.014   
pir|AI1870|AI1870 CAB/ELIP/HLIP superfamily [imported] - Nostoc ...    41   0.014   Nostoc sp. PCC 7120
pir|S77366|S77366 high light-inducible protein ssr2595 - Synecho...    41   0.014   Synechocystis sp. PCC 6803
pir|A55916|A55916 high light-inducible protein - Synechococcus s...    41   0.014   Synechococcus elongatus PCC 7942
gb:AB022223_1515184 Arabidopsis thaliana genomic DNA, chromosome...    40   0.024   
pir|AF2463|AF2463 CAB/ELIP/HLIP superfamily of protein [imported...    40   0.024   Anabaena sp.
gb:BA000039_727539 Thermosynechococcus elongatus BP-1 DNA, compl...    40   0.032   
gb:AY433944_1605993 Brassica rapa subsp. pekinensis ELIP mRNA, c...    40   0.041   
gb:AC016163_1538116 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    40   0.041   
gb:AB159049_1528427 Chlamydomonas reinhardtii mRNA for Lhc-like ...    39   0.054   
gb:BX572099_798936 Prochlorococcus marinus MIT9313 complete geno...    39   0.054   
gb:AP008231_579918 Synechococcus elongatus PCC 6301 DNA, complet...    39   0.070   
pir|JC5876|JC5876 early light-inducible protein precursor - soyb...    39   0.070   Glycine max [soybeans]
gb:AF439279_1799933 Retama raetam early light-induced protein-li...    39   0.092   
gb:BX569692_776233 Synechococcus sp. WH8102 complete genome; seg...    38   0.12    
gb:AP008231_580124 Synechococcus elongatus PCC 6301 DNA, complet...    38   0.12    
gb:AE017161_394568 Prochlorococcus marinus subsp. marinus str. C...    38   0.12    
pir|S74798|S74798 high light-inducible protein ssr1789 - Synecho...    38   0.12    Synechocystis sp. PCC 6803
sp|P51355|YC17_PORPU|YC17_PORPU Hypothetical 5.5 kDa protein ycf17 (ORF48)....    38   0.12    Porphyra purpurea
sp|P48367|YC17_CYAPA|YC17_CYAPA Hypothetical 5.5 kDa protein ycf17.>pir|T06...    38   0.16    Cyanophora paradoxa
sp|Q8YQR8|HEMZ_ANASP|HEMZ_ANASP Ferrochelatase (EC 4.99.1.1) (Protoheme fer...    38   0.16    Anabaena sp.
gb:AB002583_1508809 Cyanidioschyzon merolae chloroplast DNA, com...    37   0.20    
gb:BX569689_775232 Synechococcus sp. WH8102 complete genome; seg...    37   0.20    
gb:AF479309_1803522 Arachis hypogaea putative early light induce...    37   0.27    
gb:BX572099_798846 Prochlorococcus marinus MIT9313 complete geno...    37   0.27    
gb:BX572090_795690 Prochlorococcus marinus MED4 complete genome;...    37   0.27    
gb:BX569694_777082 Synechococcus sp. WH8102 complete genome; seg...    37   0.27    
gb:BX569690_775518 Synechococcus sp. WH8102 complete genome; seg...    37   0.27    
gb:AE017161_394536 Prochlorococcus marinus subsp. marinus str. C...    37   0.35    
pir|AF1915|AF1915 CAB/ELIP/HLIP superfamily [imported] - Nostoc ...    37   0.35    Nostoc sp. PCC 7120
gb:AF383622_1793885 Medicago sativa early light inducible protei...    36   0.46    
gb:HAELIP_1681413 H.annuus mRNA for homologous early light induc...    36   0.46    
gb:AY340640_1600675 Trifolium pratense early light inducible pro...    36   0.46    
gb:AY088811_1573821 Arabidopsis thaliana clone 95834 mRNA, compl...    36   0.46    
gb:BX572090_795719 Prochlorococcus marinus MED4 complete genome;...    36   0.46    
gb:BA000039_728000 Thermosynechococcus elongatus BP-1 DNA, compl...    36   0.46    
pir|F90096|F90096 high light inducible protein [imported] - Guil...    36   0.46    Guillardia theta
pir|S71560|S71560 early light-induced protein homolog SDi-1, dro...    36   0.46    Helianthus annuus
sp|Q8DGU6|HEMZ_SYNEL|HEMZ_SYNEL Ferrochelatase (EC 4.99.1.1) (Protoheme fer...    36   0.46    Synechococcus elongatus
gb:AF365951_1791622 Zea mays early light-inducible protein ELIP ...    36   0.60    
gb:AC134348_1741778 Oryza sativa (japonica cultivar-group) chrom...    36   0.60    
gb:BX572099_798982 Prochlorococcus marinus MIT9313 complete geno...    36   0.60    
gb:BX572092_796443 Prochlorococcus marinus MED4 complete genome;...    36   0.60    
gb:AE017165_396092 Prochlorococcus marinus subsp. marinus str. C...    36   0.60    
pir|S01056|S01056 early light-induced protein precursor - garden...    36   0.60    Pisum sativum [garden pea]
sp|O22101|HEMZ_ORYSA|HEMZ_ORYSA Ferrochelatase II, chloroplast precursor (E...    36   0.60    Oryza sativa [red rice]
sp|P11432|ELI_PEA|ELI_PEA Early light-induced protein, chloroplast precu...    36   0.60    Pisum sativum [garden pea]
gb:AF332962_1787293 Chlamydomonas reinhardtii ferrochelatase mRN...    35   0.78    
gb:ATFERROCH_1551836 Arabidopsis thaliana mRNA for ferrochelatase.     35   0.78    
gb:BX572093_796761 Prochlorococcus marinus MED4 complete genome;...    35   0.78    
sp|O04921|HMZ2_ARATH|HMZ2_ARATH Ferrochelatase II, chloroplast precursor (E...    35   0.78    Arabidopsis thaliana [mouse-ear cress]
sp|P27516|CBR_DUNBA|CBR_DUNBA Carotene biosynthesis-related protein CBR, c...    35   0.78    
gb:AF521143_1807880 Kandelia candel early light-induced protein ...    35   1.0     
gb:AY063083_1565659 Arabidopsis thaliana unknown protein (At4g14...    35   1.0     
gb:BX572094_797108 Prochlorococcus marinus MED4 complete genome;...    35   1.0     
gb:AP008231_582028 Synechococcus elongatus PCC 6301 DNA, complet...    35   1.0     
pir|F71409|F71409 probable light induced protein - Arabidopsis t...    35   1.0     Arabidopsis thaliana [mouse-ear cress]
pir|T52309|T52309 early light-inducable protein [imported] - Ara...    35   1.0     Arabidopsis thaliana [mouse-ear cress]
sp|P53739|KN8R_YEAST|KN8R_YEAST Probable serine/threonine-protein kinase YN...    35   1.0     Saccharomyces cerevisiae [brewer's yeast]
sp|P54225|HEMZ_SYNY3|HEMZ_SYNY3 Ferrochelatase (EC 4.99.1.1) (Protoheme fer...    35   1.0     Synechocystis sp.
sp|Q01931|DS22_CRAPL|DS22_CRAPL Desiccation stress protein DSP-22, chloropl...    35   1.0     Craterostigma plantagineum
gb:AP003235_1825894 Oryza sativa (japonica cultivar-group) genom...    35   1.3     
gb:OSJN00076_1694426 Oryza sativa genomic DNA, chromosome 4, BAC...    34   1.7     
gb:NTA316569_1691343 Nicotiana tabacum mRNA for ferrochelatase p...    34   1.7     
gb:AB037113_1519092 Cucumis sativus hemH mRNA for ferrochelatase...    34   1.7     
pir|JC6204|JC6204 photosystem II 22-K chlorophyll-binding protei...    34   1.7     Oryza sativa Japonica Group [Japonica rice]
gb:AY291061_1595613 Zea mays photosystem II subunit PsbS precurs...    34   1.8     
gb:AE016818_1748549 Ashbya gossypii (= Eremothecium gossypii) AT...    34   2.3     
gb:LMFLCHR4A_1388499 Leishmania major Friedlin chromosome 4, lef...    34   2.3     
gb:AP008231_581063 Synechococcus elongatus PCC 6301 DNA, complet...    34   2.3     
pir|AD2186|AD2186 CAB/ELIP/HLIP related proteins [imported] - No...    34   2.3     Nostoc sp. PCC 7120
gb:AP003826_1833888 Oryza sativa (japonica cultivar-group) genom...    33   3.0     
gb:AP003826_1833887 Oryza sativa (japonica cultivar-group) genom...    33   3.0     
gb:BT002251_1635854 Arabidopsis thaliana At1g44575/T18F15 mRNA, ...    33   3.0     
gb:AB019617_1514321 Triticum aestivum wcr (wheat cold-regulated)...    33   3.0     
pir|AH1862|AH1862 CAB/ELIP/HLIP-related protein [imported] - Nos...    33   3.0     Nostoc sp. PCC 7120
sp|Q9SMB4|PSBS_TOBAC|PSBS_TOBAC Photosystem II 22 kDa protein, chloroplast ...    33   3.0     Nicotiana tabacum [American tobacco]
sp|Q9XF91|PSBS_ARATH|PSBS_ARATH Photosystem II 22 kDa protein, chloroplast ...    33   3.0     Arabidopsis thaliana [mouse-ear cress]
gb:AB159047_1528425 Chlamydomonas reinhardtii mRNA for Lhc-like ...    33   3.9     
gb:AE017164_395632 Prochlorococcus marinus subsp. marinus str. C...    33   3.9     
pir|S14305|S14305 chlorophyll a/b-binding protein (cab-11) - tomato    33   3.9     Solanum lycopersicum
sp|Q9FPP4|PSBS_SOLSG|PSBS_SOLSG Photosystem II 22 kDa protein, chloroplast ...    33   3.9     Solanum sogarandinum
sp|P54773|PSBS_LYCES|PSBS_LYCES Photosystem II 22 kDa protein, chloroplast ...    33   3.9     Solanum lycopersicum
sp|P14895|ELI5_HORVU|ELI5_HORVU High molecular mass early light-inducible p...    33   3.9     Hordeum vulgare [barley]
gb:AY547273_1612977 Lycopersicon esculentum early light inducibl...    33   5.0     
gb:AK079906_1172831 Mus musculus 0 day neonate thymus cDNA, RIKE...    33   5.0     
gb:BX569693_776351 Synechococcus sp. WH8102 complete genome; seg...    33   5.0     
gb:BX569691_775719 Synechococcus sp. WH8102 complete genome; seg...    33   5.0     
pir|T02034|T02034 early light-induced protein, low molecular wei...    33   5.0     Oryza sativa [red rice]
sp|P27521|CB24_ARATH|CB24_ARATH Chlorophyll a-b binding protein 4, chloropl...    33   5.0     Arabidopsis thaliana [mouse-ear cress]
gb:AE017346_1757364 Cryptococcus neoformans var. neoformans JEC2...    32   6.6     
gb:AC121366_1740210 Oryza sativa (japonica cultivar-group) chrom...    32   6.6     
gb:PCU58680_1699486 Porphyridium cruentum light-harvesting compl...    32   6.6     
gb:CR380958_1653152 Candida glabrata strain CBS138 chromosome L ...    32   6.6     
gb:AJ630128_1494711 Bacteriophage S-PM2 complete genome.               32   6.6     
sp|P14897|ELI9_HORVU|ELI9_HORVU Low molecular mass early light-inducible pr...    32   6.6     Hordeum vulgare [barley]
gb:AB015859_1512731 Arabidopsis thaliana psbS mRNA for photosyst...    32   8.6     
gb:BX640430_810734 Bordetella parapertussis strain 12822, comple...    32   8.6     
pir|T14520|T14520 probable S-receptor kinase (EC 2.7.1.-) SFR3 p...    32   8.6     Brassica oleracea
sp|Q02060|PSBS_SPIOL|PSBS_SPIOL Photosystem II 22 kDa protein, chloroplast ...    32   8.6     Spinacia oleracea


>gb:AY099869_1576894 Arabidopsis thaliana FKBP-type peptidyl-prolyl
           cis-trans isomerase, putative (At3g12340) mRNA, complete
           cds.>gb:BT000331_1634609 Arabidopsis thaliana FKBP-type
           peptidyl-prolyl cis-trans isomerase, putative
           (At3g12340) mRNA, complete cds.>gb:AK175198_1817186
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL21-61-K06.>gb:AK175322_1817310
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL21-76-H05.>gb:AK175376_1817364
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL21-81-M19.>gb:AK176669_1818657
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL25-20-L09.>gb:AK176766_1818754
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL25-31-E08.>gb:AP002047_1821641
           Arabidopsis thaliana genomic DNA, chromosome 3, P1
           clone: MQC3.
          Length = 186

 Score =  157 bits (397), Expect = 1e-37
 Identities = 77/124 (62%), Positives = 94/124 (75%)
 Frame = -2

Query: 469 RLSNVRIKYRSGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPF 290
           RLSN+R++YRSG GKKAE RKS++G   +   G+G+YLPPVSL+EAVS GL VE GF+PF
Sbjct: 63  RLSNIRLRYRSGTGKKAEVRKSKKGSSGSPSKGTGIYLPPVSLKEAVSGGLKVEPGFSPF 122

Query: 289 SERVNGRIAILGITALVLVELATGQGVIKYHTPSIVLIQXXXXXXXXXXXXXYEKEKVSV 110
           SER+NGRIA LG+TAL+LVELATG+ V+ YHTPS+V +Q              EKEKVSV
Sbjct: 123 SERINGRIAGLGLTALLLVELATGKSVLNYHTPSVVFLQIYFVAAVSAMFVKIEKEKVSV 182

Query: 109 WPSD 98
           WP D
Sbjct: 183 WPKD 186



>gb:AY086603_1571650 Arabidopsis thaliana clone 26144 mRNA, complete
           sequence.
          Length = 186

 Score =  157 bits (396), Expect = 2e-37
 Identities = 77/124 (62%), Positives = 93/124 (75%)
 Frame = -2

Query: 469 RLSNVRIKYRSGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPF 290
           RLSN+R++YRSG GKKAE RKS++G   +   G+G+YLPPVSL+EAVS GL VE GF+PF
Sbjct: 63  RLSNIRLRYRSGTGKKAEVRKSKKGSSGSPSKGTGIYLPPVSLKEAVSGGLKVEPGFSPF 122

Query: 289 SERVNGRIAILGITALVLVELATGQGVIKYHTPSIVLIQXXXXXXXXXXXXXYEKEKVSV 110
           SER+NGRIA LG+TAL+LVELATG  V+ YHTPS+V +Q              EKEKVSV
Sbjct: 123 SERINGRIAGLGLTALLLVELATGNSVLNYHTPSVVFLQIYFVAAVSAMFVKIEKEKVSV 182

Query: 109 WPSD 98
           WP D
Sbjct: 183 WPKD 186



>gb:AC069474_1540939 Arabidopsis thaliana chromosome 3 BAC T2E22
           genomic sequence, complete sequence.
          Length = 647

 Score =  144 bits (363), Expect = 1e-33
 Identities = 71/120 (59%), Positives = 90/120 (75%)
 Frame = -2

Query: 469 RLSNVRIKYRSGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPF 290
           RLSN+R++YRSG GKKAE RKS++G   +   G+G+YLPPVSL+EAVS GL VE GF+PF
Sbjct: 63  RLSNIRLRYRSGTGKKAEVRKSKKGSSGSPSKGTGIYLPPVSLKEAVSGGLKVEPGFSPF 122

Query: 289 SERVNGRIAILGITALVLVELATGQGVIKYHTPSIVLIQXXXXXXXXXXXXXYEKEKVSV 110
           SER+NGRIA LG+TAL+LVELATG+ V+ YHTPS+V +Q              EKEK ++
Sbjct: 123 SERINGRIAGLGLTALLLVELATGKSVLNYHTPSVVFLQIYFVAAVSAMFVKIEKEKATL 182



>gb:AP004742_1844194 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0026F02.
          Length = 214

 Score = 99.4 bits (246), Expect = 4e-20
 Identities = 54/121 (44%), Positives = 78/121 (64%), Gaps = 3/121 (2%)
 Frame = -2

Query: 457 VRIKYRSGLGKK--AERRKSRQGKKVASESGSGMYLPPVSLREAVSE-GLSVEFGFTPFS 287
           +RIK R G  K+  A  RK + G   +S+S + + LPPV LREA S  G+ VEFGF+ +S
Sbjct: 82  LRIKSRVGPKKRGSAAARKRKGGAGASSKSKAAVTLPPVPLREARSSVGVPVEFGFSAYS 141

Query: 286 ERVNGRIAILGITALVLVELATGQGVIKYHTPSIVLIQXXXXXXXXXXXXXYEKEKVSVW 107
           ER+NG +A +G+ AL+LVEL +G+ ++KYH P+ + +Q             YEKE++SVW
Sbjct: 142 ERLNGALAAVGLAALLLVELGSGKALVKYHQPATLFLQVYTVAAAGAVFVKYEKERISVW 201

Query: 106 P 104
           P
Sbjct: 202 P 202



>gb:BA000045_741518 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 52

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 19/37 (51%), Positives = 31/37 (83%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           +FGF P++E +NGR+A++G  A ++VELATG+GV+ +
Sbjct: 12  KFGFNPYAELLNGRLAMIGFAAALVVELATGKGVLSF 48



>gb:BA000045_742789 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 53

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 16/36 (44%), Positives = 29/36 (80%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           FGFTPF+E++NGR+A++G    +++E  TGQ ++++
Sbjct: 14  FGFTPFAEQLNGRLAMIGFVLTLIIEAQTGQSLLRW 49



>pir|S77269|S77269 CAB/ELIP/HLIP-related protein - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_688382 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 70

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 17/37 (45%), Positives = 30/37 (81%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           +FGFT F+E  NGR+A++G ++ +++EL +GQGV+ +
Sbjct: 30  KFGFTAFAENWNGRLAMIGFSSALILELVSGQGVLHF 66



>pir|AC2100|AC2100 CAB/ELIP/HLIP-related protein [imported] - Nostoc
           sp.  (strain PCC 7120)>gb:BA000019_683343 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 56

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 17/37 (45%), Positives = 28/37 (75%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           +FGF  ++ER+NGR A++G   +V++E AT QGV+ +
Sbjct: 16  KFGFNEYAERLNGRAAMIGFLLMVVIEYATNQGVLSW 52



>pir|S75295|S75295 high light-inducible protein ssl2542 -
           Synechocystis sp.  (strain PCC 6803)>gb:BA000022_687988
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 70

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 17/37 (45%), Positives = 30/37 (81%)
 Frame = -2

Query: 316 SVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           SV+ G+T ++E++NGR A++G  +L+++E+ TG GVI
Sbjct: 28  SVQAGWTKYAEKMNGRFAMIGFASLLIMEVVTGHGVI 64



>gb:BA000039_727700 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 57

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 17/37 (45%), Positives = 29/37 (78%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           ++GF  F+ER+NGR A++G+ AL+L E  TG+G++ +
Sbjct: 17  KYGFNTFAERINGRAAMVGLVALLLWEYWTGEGLLHW 53



>gb:BA000039_726230 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 56

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 19/36 (52%), Positives = 26/36 (72%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           FGFTP +E  NGR+A++G  A +L EL T QGV+ +
Sbjct: 17  FGFTPQAEIWNGRLAMIGFVAALLTELITKQGVLHF 52



>pir|AG2271|AG2271 CAB/ELIP/HLIP superfamily [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_684715 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 59

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 22/57 (38%), Positives = 35/57 (61%)
 Frame = -2

Query: 370 SGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           SG   P  ++ E+ +   +V FGFT  SE  NGR A++G  ++VL+E  +GQG + +
Sbjct: 2   SGFKNPKSTVTESPN---AVRFGFTSESESWNGRFAMIGFLSIVLIEAFSGQGFLHF 55



>gb:BA000039_727992 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 69

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 16/35 (45%), Positives = 27/35 (77%)
 Frame = -2

Query: 304 GFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           GFTP++E  NGR+A++G  +L+ +E+ TG G+I +
Sbjct: 31  GFTPYAELFNGRLAMIGFISLLALEVITGHGLIGF 65



>gb:AP008231_580965 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 47

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 17/37 (45%), Positives = 26/37 (70%)
 Frame = -2

Query: 316 SVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           + +FGFT F+E  NGR+A++G    +  EL TGQG++
Sbjct: 5   NTKFGFTAFAETWNGRLAMIGFVVGLATELLTGQGIL 41



>pir|AI1870|AI1870 CAB/ELIP/HLIP superfamily [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_681506 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 72

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 15/32 (46%), Positives = 27/32 (84%)
 Frame = -2

Query: 304 GFTPFSERVNGRIAILGITALVLVELATGQGV 209
           GFTP++E +NGR+A++G  +L+ +E+ TG+G+
Sbjct: 33  GFTPYAEILNGRLAMIGFISLIALEVFTGKGI 64



>pir|S77366|S77366 high light-inducible protein ssr2595 -
           Synechocystis sp.  (strain PCC 6803)>gb:BA000022_688248
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 70

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 15/37 (40%), Positives = 29/37 (78%)
 Frame = -2

Query: 316 SVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           SV+ G+T ++E++NGR A++G  +L+ +E+ TG G++
Sbjct: 28  SVQAGWTEYAEKMNGRFAMIGFVSLLAMEVITGHGIV 64



>pir|A55916|A55916 high light-inducible protein - Synechococcus sp.
           (strain PCC 7942)>gb:SSU12333_191078 Synechococcus sp.
           (PCC 7942) (hliA) gene, complete cds.>gb:AP008231_581794
           Synechococcus elongatus PCC 6301 DNA, complete genome.
          Length = 72

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 20/52 (38%), Positives = 33/52 (63%)
 Frame = -2

Query: 355 PPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           P V + EA        +GF   +E++NGR+A++G  AL+L E+A GQG++ +
Sbjct: 20  PQVVVAEA-----DASWGFHDRAEKLNGRLAMIGFVALILTEVALGQGLLPF 66



>gb:AB022223_1515184 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MWI23.>gb:ATU89014_1557366 Arabidopsis
           thaliana early light-induced protein mRNA, complete
           cds.>gb:AY057560_1563977 Arabidopsis thaliana
           AT3g22840/MWI23_21 mRNA, complete
           cds.>gb:AY075672_1567811 Arabidopsis thaliana
           AT3g22840/MWI23_21 mRNA, complete
           cds.>gb:AY085317_1570389 Arabidopsis thaliana clone
           14490 mRNA, complete sequence.>gb:AY097423_1576418
           Arabidopsis thaliana AT3g22840/MWI23_21 mRNA, complete
           cds.
          Length = 195

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = -2

Query: 460 NVRIKYRSGLGKKAERRKSRQGKKVASESGSGMYLP-----PVSLREAVSEGLSVEFGFT 296
           N++  Y  G+   AE   + +    A  + +   LP     P  ++  VS   S    F+
Sbjct: 34  NLKRNYPVGVRCMAEGGPTNEDSSPAPSTSAAQPLPKSPSPPPPMKPKVSTKFSDLLAFS 93

Query: 295 -PFSERVNGRIAILGITALVLVELATGQGVI 206
            P  ER+NGR+A++G  A + VEL+ G+ V+
Sbjct: 94  GPAPERINGRLAMVGFVAALAVELSKGENVL 124



>pir|AF2463|AF2463 CAB/ELIP/HLIP superfamily of protein [imported] -
           Nostoc sp. (strain PCC 7120)>gb:ANASIGA_553379 Anabaena
           sp. RNA polymerase sigma factor (sigA) gene, complete
           cds.>gb:BA000019_686251 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 59

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = -2

Query: 331 VSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           V +  S  +GFTP +E  NGR+A++G  A  L+EL +GQG + +
Sbjct: 12  VEDRNSWRWGFTPQAEIWNGRLAMIGFLAATLIELFSGQGFLHF 55



>gb:BA000039_727539 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 52

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 16/43 (37%), Positives = 31/43 (72%)
 Frame = -2

Query: 343 LREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQ 215
           + E   + L+ +FG++ ++ER+NGR A++G  AL+L+E  +G+
Sbjct: 1   MSEPTPDDLTPQFGWSRYAERMNGRFAMIGFIALLLLEWVSGE 43



>gb:AY433944_1605993 Brassica rapa subsp. pekinensis ELIP mRNA,
           complete cds.
          Length = 194

 Score = 39.7 bits (91), Expect = 0.041
 Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = -2

Query: 460 NVRIKYRSGLGKKAERRKSRQGKKVAS----ESGSGMYLPPVSLREAVSEGLSVEFGFT- 296
           N++  Y  G+   AE  K       ++     S S    PP   +  VS   S    F+ 
Sbjct: 34  NLKRNYPVGVRCMAEGMKDESTPSTSAAQPLSSSSSPPPPPPPTKPKVSTKFSDLLAFSG 93

Query: 295 PFSERVNGRIAILGITALVLVELATGQGVI 206
           P  ER+NGR+A++G  A + VEL+ G+ V+
Sbjct: 94  PAPERINGRLAMVGFVAALAVELSKGENVL 123



>gb:AC016163_1538116 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.>gb:AY087227_1572261
           Arabidopsis thaliana clone 33022 mRNA, complete
           sequence.>gb:AY093031_1574985 Arabidopsis thaliana
           unknown protein (At1g71500) mRNA, complete
           cds.>gb:AY128934_1581014 Arabidopsis thaliana unknown
           protein (At1g71500) mRNA, complete
           cds.>gb:AK119109_1817050 Arabidopsis thaliana At1g71500
           mRNA for unknown protein, complete cds, clone:
           RAFL21-46-D09.
          Length = 287

 Score = 39.7 bits (91), Expect = 0.041
 Identities = 21/47 (44%), Positives = 31/47 (65%)
 Frame = -2

Query: 343 LREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVIK 203
           +R  V EG S  FGFT  +E +NG+ A++G   L+  EL TG+G++K
Sbjct: 226 VRMIVDEG-SEGFGFTKKNEVINGKAAVIGFLLLLDFELLTGKGLLK 271



>gb:AB159049_1528427 Chlamydomonas reinhardtii mRNA for Lhc-like
           protein Lhl4, complete cds.>gb:AB159050_1528428
           Chlamydomonas reinhardtii gene for Lhc-like protein
           Lhl4, complete cds.
          Length = 285

 Score = 39.3 bits (90), Expect = 0.054
 Identities = 22/60 (36%), Positives = 36/60 (60%)
 Frame = -2

Query: 385 ASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           A +SG   +   V +    S+G+   FGFTPF+E   GR +++G  + ++VE ATG+G +
Sbjct: 32  AEKSGFAKWADSVGMDS--SDGV---FGFTPFAETWVGRWSMMGFVSSIVVEFATGKGTL 86



 Score = 35.4 bits (80), Expect = 0.78
 Identities = 15/28 (53%), Positives = 20/28 (71%)
 Frame = -2

Query: 286 ERVNGRIAILGITALVLVELATGQGVIK 203
           E  NGR A+LG  A +LVE  TG+G+I+
Sbjct: 240 EMTNGRAAMLGFLAAILVEAGTGEGIIR 267



>gb:BX572099_798936 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 88

 Score = 39.3 bits (90), Expect = 0.054
 Identities = 20/60 (33%), Positives = 38/60 (63%)
 Frame = -2

Query: 400 QGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELAT 221
           +G +  SES      PP++   + + G    FG++ ++ERVNGR A++G+ A++L+E+ +
Sbjct: 22  EGSEQGSESSEVQ--PPIN---SATTGDPPTFGWSAYAERVNGRFAMIGLAAVLLIEVVS 76



>gb:AP008231_579918 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 58

 Score = 38.9 bits (89), Expect = 0.070
 Identities = 16/36 (44%), Positives = 27/36 (75%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           FG++ ++ER+NGR A++G  AL+L+E  T Q +I +
Sbjct: 18  FGWSAYAERINGRFAMVGFVALLLLEFFTHQDLITW 53



>pir|JC5876|JC5876 early light-inducible protein precursor -
           soybean>gb:GMU82810_1680749 Glycine max early
           light-induced protein (ELIP) mRNA, complete cds.
          Length = 192

 Score = 38.9 bits (89), Expect = 0.070
 Identities = 16/31 (51%), Positives = 24/31 (77%)
 Frame = -2

Query: 295 PFSERVNGRIAILGITALVLVELATGQGVIK 203
           P  ER+NGR+A++G  A + VE+A GQGV++
Sbjct: 92  PAPERINGRLAMIGFVAAMAVEVAIGQGVLE 122



>gb:AF439279_1799933 Retama raetam early light-induced protein-like
           protein mRNA, partial cds.
          Length = 141

 Score = 38.5 bits (88), Expect = 0.092
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 2/51 (3%)
 Frame = -2

Query: 355 PPVSLREA-VSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGV 209
           PP S R   +S   +    F+ P  ER+NGR+A++G  A + VELA GQ V
Sbjct: 19  PPASTRSPKISTKFTDVLAFSGPAPERINGRLAMIGFVAAIAVELAKGQDV 69



>gb:BX569692_776233 Synechococcus sp. WH8102 complete genome;
           segment 4/7.
          Length = 77

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/29 (58%), Positives = 23/29 (79%)
 Frame = -2

Query: 292 FSERVNGRIAILGITALVLVELATGQGVI 206
           F ER+NGR A++G +A VL EL TGQG++
Sbjct: 35  FVERLNGRAAMVGFSAAVLGELFTGQGIV 63



>gb:AP008231_580124 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 119

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 18/41 (43%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = -2

Query: 325 EGLSVEFGFTPF-SERVNGRIAILGITALVLVELATGQGVI 206
           +GL   +GFT   +ER NGR A++G+   +L E+ TGQG++
Sbjct: 73  QGLDPNYGFTSVRAERWNGRFAMMGLLIGLLTEVLTGQGIL 113



>gb:AE017161_394568 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030237 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 49

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 17/40 (42%), Positives = 26/40 (65%)
 Frame = -2

Query: 325 EGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           E +   +GF  ++E  NGR+A+LGI   +  EL TGQG++
Sbjct: 4   EDIEPRYGFVNYAEIWNGRLAMLGIVIGLSTELLTGQGIL 43



>pir|S74798|S74798 high light-inducible protein ssr1789 -
           Synechocystis sp.  (strain PCC 6803)>gb:BA000022_687728
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 57

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 14/37 (37%), Positives = 27/37 (72%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           +FGF  ++E++NGR A++G   ++++E  T QGV+ +
Sbjct: 17  KFGFNNYAEKLNGRAAMVGFLLILVIEYFTNQGVLAW 53



>sp|P51355|YC17_PORPU Hypothetical 5.5 kDa protein ycf17
           (ORF48).>pir|S73276|S73276 hypothetical protein 17 - red
           alga (Porphyra purpurea) chloroplast>gb:PPU38804_1701671
           Porphyra purpurea chloroplast, complete genome.
          Length = 48

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 15/34 (44%), Positives = 25/34 (73%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           +GFT  +E  NGR A++G  A++ +EL TG+G++
Sbjct: 8   WGFTDSAETWNGRFAMIGFMAVIFIELVTGKGLL 41



>sp|P48367|YC17_CYAPA Hypothetical 5.5 kDa protein
           ycf17.>pir|T06923|T06923 high light-inducible protein
           homolog - Cyanophora paradoxa
           cyanelle>gb:CPU30821_1648834 Cyanophora paradoxa
           cyanelle, complete genome.
          Length = 49

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/36 (47%), Positives = 24/36 (66%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           +GFT  +E  NGR+A+LG  A +L E  TGQG + +
Sbjct: 10  WGFTSGAENWNGRLAMLGFIAALLTESLTGQGTLHF 45



>sp|Q8YQR8|HEMZ_ANASP Ferrochelatase (EC 4.99.1.1) (Protoheme
           ferro-lyase) (Heme synthetase).>pir|AH2274|AH2274
           ferrochelatase [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_684740 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 388

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 20/37 (54%), Positives = 27/37 (72%)
 Frame = -2

Query: 316 SVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           S E+G T  +E  NGRIA+LG  AL+ +EL TGQG++
Sbjct: 346 SWEWGMTSSAEVWNGRIAMLGFIALI-IELVTGQGLL 381



>gb:AB002583_1508809 Cyanidioschyzon merolae chloroplast DNA,
           complete genome, strain:10D.
          Length = 43

 Score = 37.4 bits (85), Expect = 0.20
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           + GF   +E +NGR+A+LG  A +L E  TG+GV+ +
Sbjct: 3   KLGFNNNAEMLNGRLAMLGFVAALLTEALTGKGVLHF 39



>gb:BX569689_775232 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 66

 Score = 37.4 bits (85), Expect = 0.20
 Identities = 14/30 (46%), Positives = 25/30 (83%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATG 218
           FG++ ++ERVNGR A++G TA++++E  +G
Sbjct: 26  FGWSGYAERVNGRFAMVGFTAILVIEAISG 55



>gb:AF479309_1803522 Arachis hypogaea putative early light induced
           protein (Gsi-39) mRNA, partial cds.
          Length = 189

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%)
 Frame = -2

Query: 415 RRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFT-----PFSERVNGRIAILGI 251
           R  + + +K  S   +    PP    +  S  +S +F        P  ER+NGR+A++G 
Sbjct: 47  RSMAEEEQKEQSTEPTSPVTPPPPKPQPRSPKMSTKFSDVLAFSGPAPERINGRLAMIGF 106

Query: 250 TALVLVELATGQGVI 206
            A + VEL+ GQ ++
Sbjct: 107 VAALAVELSNGQDLL 121



>gb:BX572099_798846 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 50

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 15/34 (44%), Positives = 25/34 (73%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           +GF   +E++NGR+A+LG  AL++VE   G G++
Sbjct: 15  YGFHSHNEKLNGRMAMLGFIALMVVEATLGHGLL 48



>gb:BX572090_795690 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 77

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 15/37 (40%), Positives = 26/37 (70%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           EFG++ +SE  NGR A+LG  A++L+EL + +  + +
Sbjct: 37  EFGWSNYSEITNGRFAMLGFLAIILIELISQKSFLNW 73



>gb:BX569694_777082 Synechococcus sp. WH8102 complete genome;
           segment 6/7.
          Length = 46

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 16/37 (43%), Positives = 24/37 (64%)
 Frame = -2

Query: 316 SVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           +  FGF  F+E  NGR+A++G    +  EL TGQG++
Sbjct: 4   NARFGFVNFAETWNGRLAMMGFVIGLGTELLTGQGIL 40



>gb:BX569690_775518 Synechococcus sp. WH8102 complete genome;
           segment 2/7.
          Length = 50

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGF   +E++NGR A+LG  AL+ VE+  G G++
Sbjct: 15  FGFHGHTEKLNGRAAMLGFIALLAVEIKLGHGLL 48



>gb:AE017161_394536 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030205 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 82

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 14/36 (38%), Positives = 26/36 (72%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           FG++ ++ERVNGR A++G  A++L+E  +  G + +
Sbjct: 42  FGWSGYAERVNGRFAMIGFIAILLIETISKSGFLHW 77



>pir|AF1915|AF1915 CAB/ELIP/HLIP superfamily [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_681864 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 67

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 24/57 (42%), Positives = 31/57 (54%), Gaps = 3/57 (5%)
 Frame = -2

Query: 364 MYLPPVSLREAVSEGL---SVEFGFTPFSERVNGRIAILGITALVLVELATGQGVIK 203
           M L P    E    G    + EFGFTP SE  NGR+A+LG  A +L +L  G  V++
Sbjct: 1   MELYPTDKTETAYNGKDRNAFEFGFTPQSELWNGRLAMLGFLAYLLWDL-NGYSVVR 56



>gb:AF383622_1793885 Medicago sativa early light inducible protein
           mRNA, complete cds.
          Length = 199

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = -2

Query: 295 PFSERVNGRIAILGITALVLVELATGQGV 209
           P  ER+NGR+A++G  A + VE+A GQG+
Sbjct: 99  PAPERINGRLAMIGFVAAMGVEIANGQGL 127



>gb:HAELIP_1681413 H.annuus mRNA for homologous early light induced
           protein.
          Length = 174

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 22/67 (32%), Positives = 37/67 (55%)
 Frame = -2

Query: 409 KSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVE 230
           + +Q    AS++ S    PP + + +      + FG  P  ER+NGR+A++G  + + VE
Sbjct: 37  QDQQPSTDASKTPSAPPPPPPAPKVSTKFSDVLAFG-GPAPERINGRLAMIGFVSAMTVE 95

Query: 229 LATGQGV 209
           L+ GQ V
Sbjct: 96  LSNGQDV 102



>gb:AY340640_1600675 Trifolium pratense early light inducible
           protein mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 198

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 15/31 (48%), Positives = 23/31 (74%)
 Frame = -2

Query: 295 PFSERVNGRIAILGITALVLVELATGQGVIK 203
           P  ER+NGR+A++G  A + VE+A GQG+ +
Sbjct: 98  PAPERINGRLAMIGFVAAMGVEIAKGQGLFE 128



>gb:AY088811_1573821 Arabidopsis thaliana clone 95834 mRNA, complete
           sequence.
          Length = 193

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 21/50 (42%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -2

Query: 355 PPVSLREAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGV 209
           PPVS +  VS        F+ P  ER+NGR+A++G  A + VEL+ G+ V
Sbjct: 73  PPVS-KPKVSTKFGDLLAFSGPAPERINGRLAMVGFVAAIAVELSKGENV 121



>gb:BX572090_795719 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 48

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 17/43 (39%), Positives = 27/43 (62%)
 Frame = -2

Query: 331 VSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVIK 203
           ++E     FGF  F+E  NGR+A++GI   +  EL TGQ +++
Sbjct: 1   MNEDNQPRFGFVNFAETWNGRMAMMGILIGLGTELITGQSILR 43



>gb:BA000039_728000 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 392

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 18/33 (54%), Positives = 25/33 (75%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQG 212
           E+G T  +ER NGR+A+LG  AL ++EL +GQG
Sbjct: 353 EWGMTSAAERWNGRLAMLGFLAL-MIELISGQG 384



>pir|F90096|F90096 high light inducible protein [imported] -
           Guillardia theta nucleomorph>gb:AF165818_1773855
           Guillardia theta nucleomorph chromosome 1, complete
           sequence.
          Length = 127

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 18/34 (52%), Positives = 24/34 (70%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGF+ +SE +NGRIA+  IT  +L EL T Q +I
Sbjct: 80  FGFSKYSEIINGRIAMFFITTGLLTELWTKQSLI 113



>pir|S71560|S71560 early light-induced protein homolog SDi-1,
           drought-induced - common sunflower
          Length = 175

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 22/67 (32%), Positives = 37/67 (55%)
 Frame = -2

Query: 409 KSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVE 230
           + +Q    AS++ S    PP + + +      + FG  P  ER+NGR+A++G  + + VE
Sbjct: 38  QDQQPSTDASKTPSAPPPPPPAPKVSTKFSDVLAFG-GPAPERINGRLAMIGFVSAMTVE 96

Query: 229 LATGQGV 209
           L+ GQ V
Sbjct: 97  LSNGQDV 103



>sp|Q8DGU6|HEMZ_SYNEL Ferrochelatase (EC 4.99.1.1) (Protoheme
           ferro-lyase) (Heme synthetase).
          Length = 388

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 18/33 (54%), Positives = 25/33 (75%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQG 212
           E+G T  +ER NGR+A+LG  AL ++EL +GQG
Sbjct: 349 EWGMTSAAERWNGRLAMLGFLAL-MIELISGQG 380



>gb:AF365951_1791622 Zea mays early light-inducible protein ELIP
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 182

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 4/57 (7%)
 Frame = -2

Query: 364 MYLPPVSLREAVSE---GLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGVI 206
           M LPP   R A +    GL     F+ P  ER+NGR+A++G  + + VE   G G++
Sbjct: 53  MTLPPTRARAAPAARKLGLWDALAFSGPAPERINGRLAMVGFVSALAVEATRGDGIL 109



>gb:AC134348_1741778 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0530H10, complete
           sequence.>gb:AC135929_1742924 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0692D12, complete
           sequence.
          Length = 526

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           E+G+T  +E  NGR A+L + AL+++E+ TG+G +
Sbjct: 482 EWGWTKSAETWNGRAAMLAVLALLVLEVTTGEGFL 516



>gb:BX572099_798982 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 73

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGF  F+E  NGR+A++G+   +  EL TGQ ++
Sbjct: 34  FGFVNFAETWNGRLAMMGVIIGLSTELLTGQSIL 67



>gb:BX572092_796443 Prochlorococcus marinus MED4 complete genome;
           segment 3/5.>gb:BX572093_797024 Prochlorococcus marinus
           MED4 complete genome; segment 4/5.
          Length = 69

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 20/56 (35%), Positives = 32/56 (57%)
 Frame = -2

Query: 382 SESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQ 215
           +ESG    + P   R  + E +S + G+   +E+VNGR A++G  AL+   + TGQ
Sbjct: 9   TESGGRQNMFPSETRPYIDESVSYD-GYPQNAEKVNGRWAMIGFVALLGAYVTTGQ 63



>gb:AE017165_396092 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 5 of 6 of the complete
           genome.>gb:AE017126_1031761 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 50

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           +GF   +E +NGR A++G  ALV+VE   G G++
Sbjct: 15  YGFHNHTENLNGRWAMIGFIALVIVEFKLGHGIL 48



>pir|S01056|S01056 early light-induced protein precursor - garden
           pea
          Length = 196

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = -2

Query: 295 PFSERVNGRIAILGITALVLVELATGQGV 209
           P  ER+NGR+A++G  A + VE+A GQG+
Sbjct: 96  PAPERINGRLAMIGFVAAMGVEIAKGQGL 124



>sp|O22101|HEMZ_ORYSA Ferrochelatase II, chloroplast precursor (EC
           4.99.1.1) (Protoheme ferro-lyase) (Heme synthetase)
           (Fragment).>gb:AB007120_1510088 Oryza sativa mRNA for
           ferrochelatase, partial cds.
          Length = 494

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           E+G+T  +E  NGR A+L + AL+++E+ TG+G +
Sbjct: 450 EWGWTKSAETWNGRAAMLAVLALLVLEVTTGEGFL 484



>sp|P11432|ELI_PEA Early light-induced protein, chloroplast
           precursor (ELIP).>gb:PSELIP_1702129 Pea ELIP gene for
           plastid early-light-induced protein.
          Length = 196

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 15/29 (51%), Positives = 22/29 (75%)
 Frame = -2

Query: 295 PFSERVNGRIAILGITALVLVELATGQGV 209
           P  ER+NGR+A++G  A + VE+A GQG+
Sbjct: 96  PAPERINGRLAMIGFVAAMGVEIAKGQGL 124



>gb:AF332962_1787293 Chlamydomonas reinhardtii ferrochelatase mRNA,
           complete cds.
          Length = 493

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 15/36 (41%), Positives = 26/36 (72%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIK 203
           E+G+T  +E  NGRIA++ I  ++ +E A+GQ ++K
Sbjct: 452 EWGWTKSAETWNGRIAMIAIIIILALEAASGQSILK 487



>gb:ATFERROCH_1551836 Arabidopsis thaliana mRNA for ferrochelatase.
          Length = 511

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           E+G+T  +E  NGR A+L + AL+++E+ TG+G +
Sbjct: 468 EWGWTKSAETWNGRAAMLAVLALLVLEVTTGKGFL 502



>gb:BX572093_796761 Prochlorococcus marinus MED4 complete genome;
           segment 4/5.
          Length = 68

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 20/59 (33%), Positives = 33/59 (55%)
 Frame = -2

Query: 391 KVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQ 215
           +V +ESG    + P   R  + E +S +  +   +E+VNGR A++G  AL+   + TGQ
Sbjct: 5   QVTTESGGRQNMFPSETRPYIDESVSYD-SYPKNAEKVNGRWAMIGFVALLGAYVTTGQ 62



>sp|O04921|HMZ2_ARATH Ferrochelatase II, chloroplast precursor (EC
           4.99.1.1) (Protoheme ferro-lyase) (Heme
           synthetase).>pir|H84707|H84707 probable ferrochelatase
           precursor [imported] - Arabidopsis
           thaliana>gb:AC002338_1530495 Arabidopsis thaliana
           chromosome 2 clone T9D9 map m283, complete
           sequence.>gb:BT000465_1634743 Arabidopsis thaliana
           putative ferrochelatase precusor (At2g30390) mRNA,
           complete cds.>gb:BT008877_1640073 Arabidopsis thaliana
           At2g30390 mRNA, complete cds.>gb:U93215_1726565
           Arabidopsis thaliana chromosome 2 BAC T6B20 genomic
           sequence, complete sequence.
          Length = 512

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 15/35 (42%), Positives = 26/35 (74%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           E+G+T  +E  NGR A+L + AL+++E+ TG+G +
Sbjct: 469 EWGWTKSAETWNGRAAMLAVLALLVLEVTTGKGFL 503



>sp|P27516|CBR_DUNBA Carotene biosynthesis-related protein CBR,
           chloroplast precursor.>pir|A39458|A39458 carotene
           biosynthesis-related protein cbr - green alga
           (Dunaliella bardawil)>gb:DUNCBR02_1676199 Dunaliella
           bardawil novel carotenoid-binding protein (cbr) gene,
           complete cds.
          Length = 172

 Score = 35.4 bits (80), Expect = 0.78
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = -2

Query: 355 PPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           PP      V+E +    GF+   E +NGR+A+LG  A +  EL+TG+ V+
Sbjct: 59  PPTPAAPTVTEVM----GFSGAPEIINGRLAMLGFVAALGAELSTGESVL 104



>gb:AF521143_1807880 Kandelia candel early light-induced protein
           mRNA, partial cds.
          Length = 74

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = -2

Query: 352 PVSLREAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGV 209
           PV+    VS   S    F  P  ER+NGR+A++G  A + +EL+ GQ V
Sbjct: 7   PVTPAPKVSTKFSDVLAFGGPGPERINGRLAMIGFVAAMAIELSKGQDV 55



>gb:AY063083_1565659 Arabidopsis thaliana unknown protein
           (At4g14690) mRNA, complete cds.>gb:AF370266_1792151
           Arabidopsis thaliana unknown protein (At4g14690) mRNA,
           complete cds.
          Length = 193

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -2

Query: 355 PPVSLREAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGV 209
           PPVS +  VS        F+ P  ER+NGR+A++G  A + +EL+ G+ V
Sbjct: 73  PPVS-KPKVSTKFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV 121



>gb:BX572094_797108 Prochlorococcus marinus MED4 complete genome;
           segment 5/5.
          Length = 50

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 14/34 (41%), Positives = 25/34 (73%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           +GF  ++E++NGR+A++G  AL+L EL    G++
Sbjct: 15  YGFHFYNEKLNGRMAMIGFIALILTELFLKHGLL 48



>gb:AP008231_582028 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 56

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           FGF   +E++NGR+A+L    L+  EL T +G + +
Sbjct: 17  FGFNETAEKLNGRLAMLAFVTLIAFELTTHEGFLHW 52



>pir|F71409|F71409 probable light induced protein - Arabidopsis
           thaliana>gb:ATCHRIV39_1545233 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 39.>gb:ATFCA1_1551519
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 1.
          Length = 318

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -2

Query: 355 PPVSLREAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGV 209
           PPVS +  VS        F+ P  ER+NGR+A++G  A + +EL+ G+ V
Sbjct: 73  PPVS-KPKVSTKFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV 121



>pir|T52309|T52309 early light-inducable protein [imported] -
           Arabidopsis thaliana>gb:AF134132_1771000 Arabidopsis
           thaliana chromosome IV early light-inducable protein
           (Elip) mRNA, complete cds.
          Length = 186

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = -2

Query: 355 PPVSLREAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGV 209
           PPVS +  VS        F+ P  ER+NGR+A++G  A + +EL+ G+ V
Sbjct: 66  PPVS-KPKVSTKFGDLLAFSGPAPERINGRLAMVGFVAAIAMELSKGENV 114



>sp|P53739|KN8R_YEAST Probable serine/threonine-protein kinase
           YNR047W (EC 2.7.1.37).>pir|S63378|S63378 hypothetical
           protein YNR047w - yeast (Saccharomyces
           cerevisiae)>gb:SCYNR047W_1714008 S.cerevisiae chromosome
           XIV reading frame ORF YNR047w.
          Length = 893

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 12/81 (14%)
 Frame = +3

Query: 237 NTKAVMPRIAIRPLTRSE---NGVNPNSTLSPSETASRSDTG---------GRYIPDPDS 380
           N KA  PRI I PL R+    NG+   S  SP+ +++R  +G         G+ +P P+S
Sbjct: 397 NGKATHPRIKI-PLRRAASEPNGLQLASATSPTSSSARKTSGSSNINDKIPGQSVPPPNS 455

Query: 381 DATFFPCRDFLRSAFFPSPLR 443
              FFP     + + FP P R
Sbjct: 456 ---FFPQEPSPKISDFPEPRR 473



>sp|P54225|HEMZ_SYNY3 Ferrochelatase (EC 4.99.1.1) (Protoheme
           ferro-lyase) (Heme synthetase).>pir|S75788|S75788
           ferrochelatase (EC 4.99.1.1) hemH - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_689912 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 387

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 19/37 (51%), Positives = 26/37 (70%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           E+G T  +E  NGR+A+LG  AL LVEL +GQG + +
Sbjct: 348 EWGLTTAAEVWNGRLAMLGFIAL-LVELISGQGPLHF 383



>sp|Q01931|DS22_CRAPL Desiccation stress protein DSP-22, chloroplast
           precursor.>pir|S23379|S23379 desiccation stress-induced
           protein dsp-22 precursor - Craterostigma
           plantagineum>gb:CPDSP22_1648587 C.plantagineum mRNA
           dsp-22.
          Length = 199

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query: 460 NVRIKYRSGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVE-FGFTPFS- 287
           N +   RS + +  E+ + +Q K+  +  G     P    R  V+   +V+ F F   + 
Sbjct: 44  NAKFTVRS-MREDNEKEEQQQQKQQQTHDGGPDLTPN---RTEVTTKRTVDLFSFDGLAP 99

Query: 286 ERVNGRIAILGITALVLVELATGQGV 209
           ER+NGR A++G  A V VELATG+ V
Sbjct: 100 ERINGRSAMIGFVAAVGVELATGRDV 125



>gb:AP003235_1825894 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP003286_1827296 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0677H08.
          Length = 268

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A+LG  A +L E  TG+G++
Sbjct: 81  GTSGGIGFTKENELFVGRVAMLGFAASILGEAITGKGIL 119



 Score = 32.3 bits (72), Expect(2) = 1.4
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGFT  +E   GR+A LGI   ++ E+ TG+G +
Sbjct: 191 FGFTKANELFVGRLAQLGIAFSIIGEIITGKGAL 224



 Score = 21.2 bits (43), Expect(2) = 1.4
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -1

Query: 110 VAIRQMKIIVAFNLFFFF 57
           V I +++ +V FN+ FFF
Sbjct: 233 VPINEIEPLVLFNVVFFF 250



>gb:OSJN00076_1694426 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039K24, complete sequence.
          Length = 248

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A+LG  A +L E  TG+G++
Sbjct: 62  GTSGGIGFTKENELFVGRVAMLGFAASLLGEAVTGKGIL 100



 Score = 31.6 bits (70), Expect(2) = 3.0
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGFT  +E   GR+A LGI   ++ E+ TG+G +
Sbjct: 170 FGFTKANELFVGRLAQLGIAFSLIGEIITGKGAL 203



 Score = 20.8 bits (42), Expect(2) = 3.0
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = -1

Query: 110 VAIRQMKIIVAFNLFFFF 57
           V I +++ ++ FN+ FFF
Sbjct: 212 VPINEIEPLLLFNILFFF 229



>gb:NTA316569_1691343 Nicotiana tabacum mRNA for ferrochelatase
           precursor (FeCh gene).
          Length = 497

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           E+G+T  +E  NGR A+L +  L+++E+ TG+G +
Sbjct: 453 EWGWTKSAETWNGRAAMLAVLVLLVLEVTTGEGFL 487



>gb:AB037113_1519092 Cucumis sativus hemH mRNA for ferrochelatase,
           complete cds.
          Length = 522

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 14/35 (40%), Positives = 25/35 (71%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           E+G+T  +E  NGR A+L +  L+++E+ TG+G +
Sbjct: 477 EWGWTKSAETWNGRAAMLAVLVLLVLEVTTGEGFL 511



>pir|JC6204|JC6204 photosystem II 22-K chlorophyll-binding protein -
           rice>gb:D84392_1674857 Oryza sativa (japonica
           cultivar-group) PSII-S mRNA for 22 kDa protein of
           photosystem II precursor, complete cds.
          Length = 254

 Score = 34.3 bits (77), Expect = 1.7
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A+LG  A +L E  TG+G++
Sbjct: 68  GTSGGIGFTKENELFVGRVAMLGFAASLLGEAVTGKGIL 106



 Score = 30.4 bits (67), Expect(2) = 6.5
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGFT  +E   GR+A +GI   ++ E+ TG+G +
Sbjct: 176 FGFTKANELFVGRLAHVGIAFSLIGEIITGKGAL 209



 Score = 20.8 bits (42), Expect(2) = 6.5
 Identities = 7/18 (38%), Positives = 13/18 (72%)
 Frame = -1

Query: 110 VAIRQMKIIVAFNLFFFF 57
           V I +++ ++ FN+ FFF
Sbjct: 218 VPINEIEPLLLFNILFFF 235



>gb:AY291061_1595613 Zea mays photosystem II subunit PsbS precursor,
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 265

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 17/39 (43%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A+LG  A +L E  TG+G++
Sbjct: 79  GTSGGIGFTKENELFVGRVAMLGFAASLLGEAITGKGIL 117



 Score = 31.6 bits (70), Expect(2) = 1.8
 Identities = 14/34 (41%), Positives = 22/34 (64%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGFT  +E   GR+A LG+   ++ E+ TG+G +
Sbjct: 188 FGFTKSNELFVGRMAQLGVAFSIIGEIITGKGAL 221



 Score = 21.6 bits (44), Expect(2) = 1.8
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -1

Query: 110 VAIRQMKIIVAFNLFFFF 57
           V I +++ +V FN+ FFF
Sbjct: 230 VPINEIEPLVIFNVLFFF 247



>gb:AE016818_1748549 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 572

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 22/63 (34%), Positives = 33/63 (52%)
 Frame = +3

Query: 273 PLTRSENGVNPNSTLSPSETASRSDTGGRYIPDPDSDATFFPCRDFLRSAFFPSPLRYLI 452
           PL ++   + P++TL+P   A   DT    + DPD  + + P R  +R+  F  P R L 
Sbjct: 484 PLDQASRALLPSATLAPRAVA---DT----VTDPDFFSAYLPARTDVRANGFLEPWRALD 536

Query: 453 RTL 461
           RTL
Sbjct: 537 RTL 539



>gb:LMFLCHR4A_1388499 Leishmania major Friedlin chromosome 4, left
           end.
          Length = 290

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = -2

Query: 448 KYRSGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEG-LSVEFGFTPFSERVNG 272
           +YR G+ +K    K ++ ++  S SGSGM     SL+ AVS+  +++E G    S R   
Sbjct: 41  QYRRGVAEKRAALKQKEARRQMSSSGSGML---ASLKSAVSQAVMTMEKGAADVSTRTES 97

Query: 271 RI 266
           ++
Sbjct: 98  QV 99



>gb:AP008231_581063 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 387

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 20/33 (60%), Positives = 24/33 (72%)
 Frame = -2

Query: 310 EFGFTPFSERVNGRIAILGITALVLVELATGQG 212
           E+G T  +E  NGRIA+LG  AL LVEL TG+G
Sbjct: 348 EWGITLNAEVWNGRIAMLGFLAL-LVELLTGRG 379



>pir|AD2186|AD2186 CAB/ELIP/HLIP related proteins [imported] -
           Nostoc sp.  (strain PCC 7120)>gb:BA000019_684032 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 67

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 21/52 (40%), Positives = 32/52 (61%)
 Frame = -2

Query: 358 LPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVIK 203
           LPPV+      +  +  FG+TP SE  NGR+A++G  A +L +LA G  V++
Sbjct: 9   LPPVAPAYNGVDRNAFLFGWTPQSEIWNGRLAMIGFLAYLLWDLA-GYSVLR 59



>gb:AP003826_1833888 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1361_E02.
          Length = 187

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = -2

Query: 340 REAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGVIK 203
           + A S GL     F+ P  ER+NGR+A++G  + + VE + G G+++
Sbjct: 68  KPAASTGLWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLE 114



>gb:AP003826_1833887 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1361_E02.
          Length = 200

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 1/47 (2%)
 Frame = -2

Query: 340 REAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGVIK 203
           + A S GL     F+ P  ER+NGR+A++G  + + VE + G G+++
Sbjct: 81  KPAASTGLWDVLAFSGPAPERINGRLAMVGFVSALAVEASRGGGLLE 127



>gb:BT002251_1635854 Arabidopsis thaliana At1g44575/T18F15 mRNA,
           complete cds.>gb:AF410304_1797118 Arabidopsis thaliana
           unknown protein mRNA, complete cds.
          Length = 265

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A++G  A +L E  TG+G++
Sbjct: 78  GTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGIL 116



 Score = 32.0 bits (71), Expect = 8.6
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 12/62 (19%)
 Frame = -2

Query: 355 PPVSLREAV---------SEGLSVE---FGFTPFSERVNGRIAILGITALVLVELATGQG 212
           PP  L +AV         + GL  +   FGFT  +E   GR+A LGI   ++ E+ TG+G
Sbjct: 159 PPTGLEKAVIPPGKNVRSALGLKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKG 218

Query: 211 VI 206
            +
Sbjct: 219 AL 220



>gb:AB019617_1514321 Triticum aestivum wcr (wheat cold-regulated) 12
           mRNA for early light-inducible protein (ELIP), complete
           cds.
          Length = 174

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 21/78 (26%), Positives = 38/78 (48%)
 Frame = -2

Query: 439 SGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAI 260
           S  G ++     R+   V +++G     PP   + + S   ++ F   P  ER+NGR+A+
Sbjct: 24  SRFGAQSLPALGRRALVVRAQTGGPSAPPPNKPKASTSIWDALAFS-GPAPERINGRLAM 82

Query: 259 LGITALVLVELATGQGVI 206
           +G    + VE   G G++
Sbjct: 83  VGFVTALAVEAGRGDGLL 100



>pir|AH1862|AH1862 CAB/ELIP/HLIP-related protein [imported] - Nostoc
           sp.  (strain PCC 7120)>gb:BA000019_681441 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 40

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = -2

Query: 304 GFTPFSERVNGRIAILGITALVLVELATGQGVIKY 200
           GF   SE  NGR+A++G  A + +E  +GQG + +
Sbjct: 2   GFNHQSESWNGRLAMIGFLAAIAIEFFSGQGFLHF 36



>sp|Q9SMB4|PSBS_TOBAC Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>gb:NTPHIIPRC_1691683 N.tabacum mRNA
           for precursor of photosysten II 22 kDa protein.
          Length = 274

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 3/48 (6%)
 Frame = -2

Query: 340 REAVSEGL---SVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           +E V +G+   S   GFT  +E   GR+A++G  A +L E  TG+G++
Sbjct: 77  KEKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGIL 124



>sp|Q9XF91|PSBS_ARATH Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>pir|T52313|T52313 photosystem II
           protein [imported] - Arabidopsis
           thaliana>gb:AC084807_1733815 Arabidopsis thaliana
           chromosome 1 BAC T18F15 genomic sequence, complete
           sequence.>gb:AF134131_1770999 Arabidopsis thaliana PsbS
           protein (PsbS) mRNA, complete cds.
          Length = 265

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A++G  A +L E  TG+G++
Sbjct: 78  GTSGGIGFTKANELFVGRVAMIGFAASLLGEALTGKGIL 116



 Score = 32.0 bits (71), Expect = 8.6
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 12/62 (19%)
 Frame = -2

Query: 355 PPVSLREAV---------SEGLSVE---FGFTPFSERVNGRIAILGITALVLVELATGQG 212
           PP  L +AV         + GL  +   FGFT  +E   GR+A LGI   ++ E+ TG+G
Sbjct: 159 PPTGLEKAVIPPGKNVRSALGLKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKG 218

Query: 211 VI 206
            +
Sbjct: 219 AL 220



>gb:AB159047_1528425 Chlamydomonas reinhardtii mRNA for Lhc-like
           protein Lhl2, complete cds.
          Length = 108

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 14/34 (41%), Positives = 24/34 (70%)
 Frame = -2

Query: 304 GFTPFSERVNGRIAILGITALVLVELATGQGVIK 203
           GF  ++ER+N R A++G  AL+ VE   G+G+++
Sbjct: 61  GFVDYAERMNSRAAMIGFFALLAVEGIFGKGLLE 94



>gb:AE017164_395632 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031301 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 69

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/59 (32%), Positives = 33/59 (55%)
 Frame = -2

Query: 391 KVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQ 215
           ++ +ESG+   + PV  +  + E  S   G+   +E+ NGR A++G  AL+   L +GQ
Sbjct: 8   QITTESGNRQNMFPVEAQPQLVENYS---GYIEDAEKANGRWAMIGFIALLGAYLTSGQ 63



>pir|S14305|S14305 chlorophyll a/b-binding protein (cab-11) - tomato
          Length = 251

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 20/103 (19%)
 Frame = -2

Query: 454 RIKYRSGLGKKAERRKSRQGKKVAS------ESGSGMYLPPVSLREAVSEGLSVEFGFTP 293
           R ++ +G   K  R  S +    +S      E+  G +LP ++  + +   L  + GF P
Sbjct: 19  RTRFLTGSSGKLNREVSFRPSTSSSYNSFKVEAKKGQWLPGLASPDYLDGSLPGDNGFDP 78

Query: 292 F--------------SERVNGRIAILGITALVLVELATGQGVI 206
                          +E VNGR A+LG+  ++L E+ T  G++
Sbjct: 79  LGLVEDPENLKWFIQAELVNGRWAMLGVAGMLLPEVFTSIGIL 121



>sp|Q9FPP4|PSBS_SOLSG Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>gb:AF311720_1785071 Solanum
           sogarandinum line 1 photosystem II 22 kDa protein
           precursor (psbS) mRNA, complete cds; nuclear gene for
           chloroplast product.
          Length = 276

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A++G  A +L E  TG+G++
Sbjct: 88  GTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGIL 126



 Score = 32.3 bits (72), Expect = 6.6
 Identities = 15/34 (44%), Positives = 22/34 (64%)
 Frame = -2

Query: 307 FGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           FGFT  +E   GR+A LGI   ++ E+ TG+G +
Sbjct: 199 FGFTKANELFVGRLAQLGIAFSIIGEIITGKGAL 232



>sp|P54773|PSBS_LYCES Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>pir|T06331|T06331 photosystem II 22K
           protein - tomato>gb:LEU04336_1684690 Lycopersicon
           esculentum photosystem II 22 kDa component (psbS) gene,
           complete cds.
          Length = 276

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 13/63 (20%)
 Frame = -2

Query: 355 PPVSLREAV-------------SEGLSVEFGFTPFSERVNGRIAILGITALVLVELATGQ 215
           PP  L +AV             SEG  + FGFT  +E   GR+A LGI   ++ E+ TG+
Sbjct: 171 PPTGLEKAVIPPGKSFKSALGLSEGGPL-FGFTKANELFVGRLAQLGIAFSIIGEIITGK 229

Query: 214 GVI 206
           G +
Sbjct: 230 GAL 232



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A++G  A +L E  TG+G++
Sbjct: 88  GTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGIL 126



>sp|P14895|ELI5_HORVU High molecular mass early light-inducible
           protein HV58, chloroplast precursor
           (ELIP).>pir|S07475|S07475 early light-induced protein,
           high molecular weight, precursor (clone HV58) - barley
           chloroplast>gb:HVLP58_1682445 Barley mRNA for
           chloroplast high molecular mass early light-inducible
           protein (ELIP) (clone HV58).
          Length = 231

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = -2

Query: 295 PFSERVNGRIAILGITALVLVELATGQGVI 206
           P  ER+NGR+A++G  A + VE A G G++
Sbjct: 127 PAPERINGRLAMVGFVAALSVEAARGGGLL 156



>gb:AY547273_1612977 Lycopersicon esculentum early light inducible
           protein (ELIP) gene, complete cds.
          Length = 191

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 22/80 (27%), Positives = 34/80 (42%), Gaps = 1/80 (1%)
 Frame = -2

Query: 454 RIKYRSGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFT-PFSERV 278
           R+   S +  K    +  +     S   S     P   +   S      F F+ P  ER+
Sbjct: 35  RLHRTSRVSVKCMAEEGEKESSTPSTDYSATVPKPTPAKPKPSTNFIDIFSFSGPAPERI 94

Query: 277 NGRIAILGITALVLVELATG 218
           NGR+A++G  A + +ELA G
Sbjct: 95  NGRLAMIGFVAAIGMELANG 114



>gb:AK079906_1172831 Mus musculus 0 day neonate thymus cDNA, RIKEN
            full-length enriched library, clone:A430110N23
            product:hypothetical Speract receptor (Scavenger
            receptor) containing protein, full insert sequence.
          Length = 1371

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 2/84 (2%)
 Frame = +3

Query: 213  PCPVASSTNTKAVMPRIAIRPLTRSENGVNPNSTLSPSETASRSDTGG--RYIPDPDSDA 386
            P P A + + +   P    RPL  S    +P S+ SP  + SR  +G   + IPD   + 
Sbjct: 961  PAPRARAGSPRKPTPER--RPLPTSATTSSPASSSSPEPSGSRQTSGSWPQLIPDSKQEG 1018

Query: 387  TFFPCRDFLRSAFFPSPLRYLIRT 458
            T    +  L +   PSP  + + T
Sbjct: 1019 TSSSPKPSLLTPGLPSPATFALST 1042



>gb:BX569693_776351 Synechococcus sp. WH8102 complete genome;
           segment 5/7.
          Length = 67

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -2

Query: 289 SERVNGRIAILGITALVLVELATGQGV 209
           +E +NGRIA+LG    +L EL TGQG+
Sbjct: 29  AELLNGRIAMLGFLIGLLTELITGQGI 55



>gb:BX569691_775719 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 84

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 21/61 (34%), Positives = 32/61 (52%)
 Frame = -2

Query: 400 QGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERVNGRIAILGITALVLVELAT 221
           +G  V +E G  +       R  V E     +GF   +E++NGR+A+LG  AL+  E+A 
Sbjct: 13  RGATVTTEDGGRLNAFASEPRMQVVEA-EQGWGFHERAEKLNGRMAMLGFIALLATEIAL 71

Query: 220 G 218
           G
Sbjct: 72  G 72



>pir|T02034|T02034 early light-induced protein, low molecular weight
           - rice>gb:AF017356_1761538 Oryza sativa low molecular
           early light-inducible protein mRNA, complete cds.
          Length = 157

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = -2

Query: 340 REAVSEGLSVEFGFT-PFSERVNGRIAILGITALVLVELATGQGVI 206
           + A S GL     F  P  ER+NGR+A++G  + + VE + G G++
Sbjct: 73  KPAASTGLWDVLAFNGPAPERINGRLAMVGFVSALAVEASRGGGLL 118



>sp|P27521|CB24_ARATH Chlorophyll a-b binding protein 4, chloroplast
           precursor (LHCI type III CAB-4)
           (LHCP).>pir|T45707|T45707 CHLOROPHYLL A-B BINDING
           PROTEIN 4 PRECURSOR homolog - Arabidopsis
           thaliana>gb:ATF1P2_1549417 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F1P2.>gb:ATHCABM_1553083
           Arabidopsis thaliana light-harvesting chlorophyll
           a/b-binding protein (Cab4) mRNA, complete
           cds.>gb:AY086470_1571518 Arabidopsis thaliana clone 2531
           mRNA, complete sequence.>gb:AY093080_1575034 Arabidopsis
           thaliana chlorophyll A-B binding protein 4 precursor
           homolog (At3g47470) mRNA, complete
           cds.>gb:BT000093_1634371 Arabidopsis thaliana
           chlorophyll A-B binding protein 4 precursor homolog
           (At3g47470) mRNA, complete cds.
          Length = 251

 Score = 32.7 bits (73), Expect = 5.0
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 14/72 (19%)
 Frame = -2

Query: 379 ESGSGMYLPPVSLREAVSEGLSVEFGFTPF--------------SERVNGRIAILGITAL 242
           E+  G +LP ++  + ++  L+ + GF P               +E VNGR A+LG+  +
Sbjct: 51  EAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGM 110

Query: 241 VLVELATGQGVI 206
           +L E+ T  G+I
Sbjct: 111 LLPEVFTKIGII 122



>gb:AE017346_1757364 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 749

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +3

Query: 219 PVASSTNTKAVMPRIAIRPLTRSENGVNPNSTLSPSETASRSD 347
           P  SST T    P+IA RPL  +     P+++ +P  ++SRSD
Sbjct: 595 PDRSSTPTPHSSPQIAFRPLKDTSPASLPHTSATPRPSSSRSD 637



>gb:AC121366_1740210 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0111K12, complete sequence.
          Length = 199

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 14/35 (40%), Positives = 17/35 (48%)
 Frame = -3

Query: 441 GAGWGRKQSAESLGKGRRWRRSRDPECTSRRCRCG 337
           G GWG   S  ++ +GR WRR       SRR   G
Sbjct: 161 GCGWGAAVSVSAVARGRPWRRRPHARTPSRRRHSG 195



>gb:PCU58680_1699486 Porphyridium cruentum light-harvesting complex
           I polypeptide (Lhca2) mRNA, complete cds.
          Length = 203

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 14/29 (48%), Positives = 21/29 (72%)
 Frame = -2

Query: 289 SERVNGRIAILGITALVLVELATGQGVIK 203
           SE  NGR+A++  TA  + ++ TG+GVIK
Sbjct: 166 SELKNGRLAMIAWTAFAIQQIVTGKGVIK 194



>gb:CR380958_1653152 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 1053

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 10/84 (11%)
 Frame = -2

Query: 394 KKVASESGSGMYLPPVSLREAVSEGLSVEFGFTPFSERV----------NGRIAILGITA 245
           K VAS  G+  +  P   +E V EGL  E  FT  S+++          NG+++I G   
Sbjct: 487 KTVASFLGALAHELPAQSKEHVIEGLLNEMDFTSLSDKITSMWISSNLLNGKLSISGSNG 546

Query: 244 LVLVELATGQGVIKYHTPSIVLIQ 173
           + +  L TG G+  Y +   V  Q
Sbjct: 547 VAMDSL-TGTGLNSYASYPTVAYQ 569



>gb:AJ630128_1494711 Bacteriophage S-PM2 complete genome.
          Length = 39

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = -2

Query: 313 VEFGFTPFSERVNGRIAILGITALVLVELATGQ 215
           ++FGFTP +E +N R+A+LG    V     TGQ
Sbjct: 1   MKFGFTPEAEILNARLAMLGFVIAVGTYATTGQ 33



>sp|P14897|ELI9_HORVU Low molecular mass early light-inducible
           protein HV90, chloroplast precursor
           (ELIP).>pir|S07474|S07474 early light-induced protein,
           low molecular weight, precursor (clone HV90) - barley
           chloroplast>gb:HVLP90_1682447 Barley mRNA for
           chloroplast low molecular mass early light-inducible
           protein (ELIP) (clone HV90).
          Length = 172

 Score = 32.3 bits (72), Expect = 6.6
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 1/79 (1%)
 Frame = -2

Query: 439 SGLGKKAERRKSRQGKKVASESGSGMYLPPVSLREAVSEGLSVEFGFT-PFSERVNGRIA 263
           S  G ++     R+   V +++  G   PP +  +A S  +  E  F+ P  ER+NGR+A
Sbjct: 22  SSFGARSLPALGRRALVVRAQT-EGPSAPPPNKPKA-STSIWDEMAFSGPAPERINGRLA 79

Query: 262 ILGITALVLVELATGQGVI 206
           ++G    + VE   G G++
Sbjct: 80  MVGFVTALAVEAGRGDGLL 98



>gb:AB015859_1512731 Arabidopsis thaliana psbS mRNA for photosystem
           II 22 kDa protein, partial cds.
          Length = 155

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 22/62 (35%), Positives = 32/62 (51%), Gaps = 12/62 (19%)
 Frame = -2

Query: 355 PPVSLREAV---------SEGLSVE---FGFTPFSERVNGRIAILGITALVLVELATGQG 212
           PP  L +AV         + GL  +   FGFT  +E   GR+A LGI   ++ E+ TG+G
Sbjct: 49  PPTGLEKAVIPPGKNVRSALGLKEQGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKG 108

Query: 211 VI 206
            +
Sbjct: 109 AL 110



>gb:BX640430_810734 Bordetella parapertussis strain 12822, complete
           genome; segment 8/14.
          Length = 486

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = -2

Query: 373 GSGMYLPPVSLREAVSEGLSVEF---GFTPFSERVNGRIAILGITAL 242
           GSG   P + L EAV  GL  +F   G + FS+R+  R+A  G+T +
Sbjct: 258 GSGW--PGILLHEAVGHGLEGDFNRKGSSVFSDRIGERVASSGVTVI 302



>pir|T14520|T14520 probable S-receptor kinase (EC 2.7.1.-) SFR3
           precursor - wild cabbage>gb:BOY14286_1633937 Brassica
           oleracea SFR3 gene, partial.
          Length = 841

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 21/61 (34%), Positives = 26/61 (42%), Gaps = 2/61 (3%)
 Frame = -3

Query: 435 GWGRKQSAESLGKGRRWRRSRDPECT--SRRCRCGRRFPKG*AWNSGSPRFRNGSTAGLR 262
           GW RK         R WR   DP     S +    R FP+  AWN     +R+G  +G R
Sbjct: 166 GWDRKTGLNRYL--RSWRNPDDPSSGDFSTKLETTRGFPEFYAWNKDEIIYRSGPWSGNR 223

Query: 261 F 259
           F
Sbjct: 224 F 224



>sp|Q02060|PSBS_SPIOL Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>pir|S26953|S26953 photosystem II 22K
           protein precursor - spinach>gb:S49864_1704239
           psbS=photosystem II 22 kda polypeptide [spinach, mRNA,
           1012 nt].>gb:SOPSII_1715862 S.oleracea mRNA for
           photosystem II 22kDa protein.
          Length = 274

 Score = 32.0 bits (71), Expect = 8.6
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = -2

Query: 322 GLSVEFGFTPFSERVNGRIAILGITALVLVELATGQGVI 206
           G S   GFT  +E   GR+A++G  A +L E  TG+G++
Sbjct: 87  GTSGGIGFTKENELFVGRVAMIGFAASLLGEGITGKGIL 125


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 569,476,536
Number of Sequences: 1806583
Number of extensions: 10275915
Number of successful extensions: 33115
Number of sequences better than 10.0: 113
Number of HSP's better than 10.0 without gapping: 31996
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33090
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 32290244624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)