BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12386
         (1229 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT004819_1637853 Arabidopsis thaliana At3g58830 gene, complet...   342   9e-93   
pir|T49166|T49166 hypothetical protein T20N10.180 - Arabidopsis ...   342   9e-93   Arabidopsis thaliana [mouse-ear cress]
gb:AP003299_1827630 Oryza sativa (japonica cultivar-group) genom...   213   5e-54   
gb:CR382125_1657962 Kluyveromyces lactis strain NRRL Y-1140 chro...    81   5e-14   
gb:AE016818_1748535 Ashbya gossypii (= Eremothecium gossypii) AT...    77   9e-13   
gb:AE017333_448594 Bacillus licheniformis DSM 13, complete genom...    69   2e-10   
gb:CR382138_1671407 Debaryomyces hansenii chromosome F of strain...    68   4e-10   
gb:AE017343_1755732 Cryptococcus neoformans var. neoformans JEC2...    67   6e-10   
gb:NC15E6_1688347 Neurospora crassa DNA linkage group V Cosmid c...    67   6e-10   
pir|T48794|T48794 hypothetical protein 15E6.20 [imported] - Neur...    67   6e-10   Neurospora crassa
sp|P54452|YQEG_BACSU|YQEG_BACSU Hypothetical protein yqeG.>pir|C69951|C6995...    67   7e-10   Bacillus subtilis
sp|P38812|YHQ0_YEAST|YHQ0_YEAST Hypothetical 20.9 kDa protein in HXT5-NRK1 ...    67   7e-10   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380954_1651245 Candida glabrata strain CBS138 chromosome H ...    65   3e-09   
pir|T41519|T41519 hypothetical protein SPCC645.02 - fission yeas...    60   9e-08   Schizosaccharomyces pombe
gb:CR382127_1660052 Yarrowia lipolytica chromosome A of strain C...    59   2e-07   
gb:AE017038_384513 Bacillus anthracis str. Ames section 15 of 18...    58   3e-07   
gb:AE017012_379202 Bacillus cereus ATCC 14579 section 15 of 18 o...    57   8e-07   
gb:AE017278_425617 Bacillus cereus ATCC 10987, section 15 of 18 ...    56   2e-06   
gb:AE013088_288909 Thermoanaerobacter tengcongensis MB4, section...    56   2e-06   
pir|E89941|E89941 conserved hypothetical protein SA1426 [importe...    55   2e-06   Staphylococcus aureus subsp. aureus Mu50
gb:AP006627_563955 Bacillus clausii KSM-K16 DNA, complete genome.      55   3e-06   
gb:CP000046_91773 Staphylococcus aureus subsp. aureus COL, compl...    55   3e-06   
pir|B83815|B83815 hypothetical protein BH1322 [imported] - Bacil...    55   3e-06   Bacillus halodurans
gb:AP008231_581404 Synechococcus elongatus PCC 6301 DNA, complet...    54   5e-06   
gb:CP000029_81769 Staphylococcus epidermidis RP62A, complete gen...    53   1e-05   
gb:BX569691_775683 Synechococcus sp. WH8102 complete genome; seg...    52   2e-05   
gb:AP006840_569142 Symbiobacterium thermophilum DNA, complete ge...    52   2e-05   
pir|S76105|S76105 hypothetical protein - Synechocystis sp. (stra...    51   6e-05   Synechocystis sp. PCC 6803
gb:BX572092_796415 Prochlorococcus marinus MED4 complete genome;...    50   9e-05   
gb:AP006628_566736 Onion yellows phytoplasma OY-M DNA, complete ...    50   9e-05   
gb:AE017204_404799 Lactobacillus johnsonii NCC 533, section 5 of...    49   2e-04   
gb:AE017306_437257 Thermus thermophilus HB27 section 6 of 7 of t...    48   4e-04   
gb:BA000028_696376 Oceanobacillus iheyensis HTE831 DNA, complete...    47   8e-04   
gb:AE016956_366825 Enterococcus faecalis V583, section 10 of 11 ...    46   0.001   
gb:CP000003_860213 Streptococcus pyogenes MGAS10394, complete ge...    45   0.002   
gb:AE006496_219492 Streptococcus pyogenes M1 GAS, section 25 of ...    45   0.002   
gb:BX572096_797870 Prochlorococcus marinus MIT9313 complete geno...    45   0.003   
gb:BA000043_739103 Geobacillus kaustophilus HTA426 DNA, complete...    44   0.005   
pir|A95204|A95204 conserved hypothetical protein SP1750 [importe...    43   0.011   Streptococcus pneumoniae
pir|AG2193|AG2193 hypothetical protein alr3102 [imported] - Nost...    43   0.015   Nostoc sp. PCC 7120
gb:BA000045_741204 Gloeobacter violaceus PCC 7421 DNA, complete ...    42   0.020   
pir|F75330|F75330 conserved hypothetical protein - Deinococcus r...    42   0.026   Deinococcus radiodurans
pir|A98071|A98071 conserved hypothetical protein spr1595 [import...    42   0.033   Streptococcus pneumoniae R6
pir|T52063|T52063 ran GTPase-activating protein [imported] - alf...    41   0.044   Medicago sativa subsp. x varia
gb:AE017163_395321 Prochlorococcus marinus subsp. marinus str. C...    40   0.074   
gb:SSP440366_190887 Synechococcus sp. PCC 7942 ORF1, gltX gene, ...    40   0.13    
gb:AE014267_306962 Streptococcus agalactiae 2603V/R section 77 o...    39   0.17    
gb:SAG766852_171237 Streptococcus agalactiae NEM316 complete gen...    39   0.17    
gb:BA000031_706722 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    39   0.22    
gb:BA000039_726279 Thermosynechococcus elongatus BP-1 DNA, compl...    38   0.37    
gb:AL935256_551325 Lactobacillus plantarum strain WCFS1 complete...    38   0.37    
pir|E86902|E86902 hypothetical protein yxaC [imported] - Lactoco...    38   0.37    Lactococcus lactis subsp. lactis
gb:AE015007_314100 Streptococcus mutans UA159 section 155 of 185...    38   0.48    
gb:CP000033_89766 Lactobacillus acidophilus NCFM, complete genome.     38   0.48    
sp|Q8VD52|PLPP_RAT|PLPP_RAT Pyridoxal phosphate phosphatase (EC 3.1.3.-) ...    38   0.48    Rattus norvegicus [brown rat]
pir|AD1261|AD1261 hypothetical protein lmo1492 [imported] - List...    37   0.63    Listeria monocytogenes
gb:BC009756_1972233 Homo sapiens pyridoxal (pyridoxine, vitamin ...    37   0.82    
gb:AK126873_1916500 Homo sapiens cDNA FLJ44925 fis, clone BRAMY3...    37   0.82    
gb:CP000023_875473 Streptococcus thermophilus LMG 18311, complet...    37   0.82    
gb:AY596297_631977 Haloarcula marismortui ATCC 43049 chromosome ...    37   0.82    
sp|Q96GD0|PLPP_HUMAN|PLPP_HUMAN Pyridoxal phosphate phosphatase (EC 3.1.3.-...    37   0.82    Homo sapiens [man]
gb:BC069982_2106233 Mus musculus pyridoxal (pyridoxine, vitamin ...    37   1.1     
gb:BC058388_2103194 Mus musculus pyridoxal (pyridoxine, vitamin ...    37   1.1     
gb:BC037010_2097938 Mus musculus pyridoxal (pyridoxine, vitamin ...    37   1.1     
sp|P60487|PLPP_MOUSE|PLPP_MOUSE Pyridoxal phosphate phosphatase (EC 3.1.3.-...    37   1.1     Mus musculus [mouse]
gb:BT005294_1638234 Arabidopsis thaliana At5g47760 mRNA, complet...    36   1.4     
gb:AY087611_1572641 Arabidopsis thaliana clone 37055 mRNA, compl...    36   1.4     
gb:AB016886_1513134 Arabidopsis thaliana genomic DNA, chromosome...    36   1.4     
pir|AF1623|AF1623 hypothetical protein homolog lin1527 [imported...    36   1.4     Listeria innocua
pir|A72409|A72409 conserved hypothetical protein - Thermotoga ma...    36   1.4     Thermotoga maritima
gb:AP002029_1821452 Arabidopsis thaliana genomic DNA, chromosome...    35   2.4     
gb:AK117908_1815915 Arabidopsis thaliana At5g36790 mRNA for puta...    35   2.4     
gb:AC098833_1736916 Oryza sativa (japonica cultivar-group) chrom...    35   2.4     
gb:AY094446_1575745 Arabidopsis thaliana AT5g36790/f5h8_20 mRNA,...    35   2.4     
gb:AY596298_634945 Haloarcula marismortui ATCC 43049 chromosome ...    35   2.4     
pir|T52067|T52067 hypothetical protein [imported] - rice>gb:AF11...    35   2.4     Oryza sativa Indica Group [Indian rice]
pir|D84229|D84229 unknown L-arabinose operon protein [imported] ...    35   2.4     Halobacterium salinarum
gb:AB011819_2157050 Clover yellow vein virus genomic RNA for pol...    35   3.1     
gb:OSJN00051_1693924 Oryza sativa genomic DNA, chromosome 4, BAC...    35   3.1     
gb:AF322012S1_499979 Bradyrhizobium japonicum symbiotic gene reg...    35   3.1     
gb:AP005592_1854628 Oryza sativa (japonica cultivar-group) genom...    35   4.1     
gb:AP003243_1826113 Oryza sativa (japonica cultivar-group) genom...    35   4.1     
gb:AB025605_1516276 Arabidopsis thaliana genomic DNA, chromosome...    35   4.1     
gb:BC060400_2552868 Xenopus laevis hypothetical protein MGC68532...    34   5.3     
pir|AD2244|AD2244 hypothetical protein alr3507 [imported] - Nost...    34   5.3     Nostoc sp. PCC 7120
gb:AF539862_1280297 Hydra vulgaris nematocyst outer wall antigen...    34   7.0     
gb:BA000030_699999 Streptomyces avermitilis MA-4680 genomic DNA,...    34   7.0     
gb:BA000026_693995 Mycoplasma penetrans HF-2 DNA, complete genome.     34   7.0     
pir|A38660|B38346 ultra-high-sulfur keratin 2 - mouse>gb:MUSSER2...    20   7.7     
gb:AY391472_2531608 Danio rerio 1700012G19-like protein mRNA, co...    33   9.1     
gb:AP005260_1849770 Oryza sativa (japonica cultivar-group) genom...    33   9.1     
gb:AE016942_363166 Bacteroides thetaiotaomicron VPI-5482, sectio...    33   9.1     
pir|E72218|E72218 hypothetical protein TM1742 - Thermotoga marit...    33   9.1     Thermotoga maritima


>gb:BT004819_1637853 Arabidopsis thaliana At3g58830 gene, complete
            cds.
          Length = 343

 Score =  342 bits (877), Expect = 9e-93
 Identities = 184/331 (55%), Positives = 226/331 (68%), Gaps = 28/331 (8%)
 Frame = -3

Query: 1014 YCPVPSRFT-SPPHSLPFPIRLSRLTL---------SAAATTHSCSTEHEKQKHP-RNPE 868
            Y P+P  F  SPP     P  +S  T          S++++    +T H  QK   R P 
Sbjct: 8    YYPIPKSFLLSPPRHKRNPNLISCSTKPICSPPPPSSSSSSPLQTTTTHRSQKQNLRLPT 67

Query: 867  DPDR----------ENPVFPQDYYEDGDGEPER----RFENP---LVFLTNMWWADMKAA 739
              D           E+P F     E  DGEP      R E+    L   +NMWWAD+KAA
Sbjct: 68   FEDSFLLYQFSSPTEDPGFSNRIPEQFDGEPRELVLPRVEDNNKGLAISSNMWWADLKAA 127

Query: 738  LGQRINVEGLTSSLGIFAKNKHLVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVP 559
            LGQRIN+EG+ SS+ +  K++  V+PH++V D+RYIDW  LKR+GF+GVVFDKDNTLT P
Sbjct: 128  LGQRINIEGIVSSVSVVVKDRQFVLPHVSVKDLRYIDWEVLKRKGFKGVVFDKDNTLTAP 187

Query: 558  YSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVK 379
            YSL +WPPLR SIE+CKA+FG++IAVFSNSAGL EYD D   AK LE  IGI+V+RHRVK
Sbjct: 188  YSLAIWPPLRPSIERCKAVFGHDIAVFSNSAGLTEYDHDDSKAKALEAEIGIRVLRHRVK 247

Query: 378  KPAGTAEEIERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVR 199
            KPAGTAEE+E+ FGC SS+LIMVGDRPFTDIVYGNRNGFLT+LTEPLS AEEPFIV+QVR
Sbjct: 248  KPAGTAEEVEKHFGCTSSELIMVGDRPFTDIVYGNRNGFLTVLTEPLSRAEEPFIVRQVR 307

Query: 198  VIERALVYQWSVKGVEPISHELLPDCEQCVK 106
             +E AL+ +W  KG++P+ H L+ D  Q VK
Sbjct: 308  RLELALLKRWLRKGLKPVDHSLVSDITQFVK 338



>pir|T49166|T49166 hypothetical protein T20N10.180 - Arabidopsis
            thaliana>gb:ATT20N10_1555066 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T20N10.
          Length = 348

 Score =  342 bits (877), Expect = 9e-93
 Identities = 184/331 (55%), Positives = 226/331 (68%), Gaps = 28/331 (8%)
 Frame = -3

Query: 1014 YCPVPSRFT-SPPHSLPFPIRLSRLTL---------SAAATTHSCSTEHEKQKHP-RNPE 868
            Y P+P  F  SPP     P  +S  T          S++++    +T H  QK   R P 
Sbjct: 13   YYPIPKSFLLSPPRHKRNPNLISCSTKPICSPPPPSSSSSSPLQTTTTHRSQKQNLRLPT 72

Query: 867  DPDR----------ENPVFPQDYYEDGDGEPER----RFENP---LVFLTNMWWADMKAA 739
              D           E+P F     E  DGEP      R E+    L   +NMWWAD+KAA
Sbjct: 73   FEDSFLLYQFSSPTEDPGFSNRIPEQFDGEPRELVLPRVEDNNKGLAISSNMWWADLKAA 132

Query: 738  LGQRINVEGLTSSLGIFAKNKHLVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVP 559
            LGQRIN+EG+ SS+ +  K++  V+PH++V D+RYIDW  LKR+GF+GVVFDKDNTLT P
Sbjct: 133  LGQRINIEGIVSSVSVVVKDRQFVLPHVSVKDLRYIDWEVLKRKGFKGVVFDKDNTLTAP 192

Query: 558  YSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVK 379
            YSL +WPPLR SIE+CKA+FG++IAVFSNSAGL EYD D   AK LE  IGI+V+RHRVK
Sbjct: 193  YSLAIWPPLRPSIERCKAVFGHDIAVFSNSAGLTEYDHDDSKAKALEAEIGIRVLRHRVK 252

Query: 378  KPAGTAEEIERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVR 199
            KPAGTAEE+E+ FGC SS+LIMVGDRPFTDIVYGNRNGFLT+LTEPLS AEEPFIV+QVR
Sbjct: 253  KPAGTAEEVEKHFGCTSSELIMVGDRPFTDIVYGNRNGFLTVLTEPLSRAEEPFIVRQVR 312

Query: 198  VIERALVYQWSVKGVEPISHELLPDCEQCVK 106
             +E AL+ +W  KG++P+ H L+ D  Q VK
Sbjct: 313  RLELALLKRWLRKGLKPVDHSLVSDITQFVK 343



>gb:AP003299_1827630 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0699H05.
          Length = 422

 Score =  213 bits (543), Expect = 5e-54
 Identities = 108/223 (48%), Positives = 139/223 (62%), Gaps = 1/223 (0%)
 Frame = -3

Query: 762 WWADMKAALGQRINVEGLTSSLGIFAKNKHLVIPHIAVPDIRYIDWAELKRRGFEGVVFD 583
           WW   + +LGQR N  G+ +   + A    L +PH++V DIR++DW EL+R GF GVVFD
Sbjct: 220 WW---RRSLGQRFNPAGVAAVAAVAASEPRLALPHVSVQDIRWLDWGELRRAGFRGVVFD 276

Query: 582 KDNTLTVPYSLRLWPPLRSSIEQCKALFG-NNIAVFSNSAGLFEYDPDGRNAKILERAIG 406
           KDNTLT PY+  LWPPL ++ +QC+A F   ++AV+SNSA                    
Sbjct: 277 KDNTLTAPYAPGLWPPLAAAFDQCRAAFPPGSLAVYSNSAD------------------- 317

Query: 405 IKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAE 226
                  +KKP G A+EIE  FGC +S L++VGDR FTD+VYGNRNGFLT+LTEPL+ A 
Sbjct: 318 -------IKKPGGEAKEIESYFGCSASNLVLVGDRYFTDVVYGNRNGFLTVLTEPLNFAN 370

Query: 225 EPFIVQQVRVIERALVYQWSVKGVEPISHELLPDCEQCVKDKP 97
           E +IV+QVR  E  L+  W  KG  PI H LLPD  + VK  P
Sbjct: 371 ESYIVRQVRKFEAYLISYWYRKGHRPIKHPLLPDARRIVKFDP 413



>gb:CR382125_1657962 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 189

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 56/175 (32%), Positives = 92/175 (52%), Gaps = 10/175 (5%)
 Frame = -3

Query: 663 PHIAVPDIRYIDWAELKR---RGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF-G 496
           P + +P I+Y ++ E++       + +V DKDN    P+  ++WP  +   ++ K L+ G
Sbjct: 20  PKLCIPSIKYANFNEIQLPLPSHIKAIVLDKDNCFAKPHDDKVWPEYQEQWDKLKQLYPG 79

Query: 495 NNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFG----CES 328
             + + SNSAG  + D     AK LE++ G+ V+ H +KKP G   EI   F     CE 
Sbjct: 80  KKLLIVSNSAGTND-DIGHIQAKTLEKSTGVPVLLHSIKKP-GCHVEIMAYFKKSKVCED 137

Query: 327 -SKLIMVGDRPFTDIVYGNRNGFLTI-LTEPLSLAEEPFIVQQVRVIERALVYQW 169
            S++ +VGDR FTD+V  N  G  ++ L E +  +  PF++ + +      VY W
Sbjct: 138 PSEVAVVGDRLFTDVVMANTMGAYSVWLHEGVIKSSNPFVLLEQQ------VYNW 186



>gb:AE016818_1748535 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 191

 Score = 76.6 bits (187), Expect = 9e-13
 Identities = 53/173 (30%), Positives = 89/173 (51%), Gaps = 10/173 (5%)
 Frame = -3

Query: 678 KHLVIPHIAVPDIRYIDWAELK---RRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCK 508
           K LV P + +PDI    +A+L        + VV DKDN    P+  R+WP  + + ++ +
Sbjct: 15  KLLVNPRLCLPDIVVPTFADLPIPLGPNIKAVVLDKDNCFAYPHEDRVWPAYQDAWQRLR 74

Query: 507 ALF-GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEI-----ER 346
           A + G  + + SN+AG  + D D   A+ LER  G+ V+RH  KKP G   E+     E+
Sbjct: 75  AAYPGARLVIVSNTAGTAD-DKDELQARALERNTGVAVLRHATKKP-GCKNEVLRYLYEK 132

Query: 345 QFGCESSKLIMVGDRPFTDIVYGNRNGFLTI-LTEPLSLAEEPFIVQQVRVIE 190
           +      ++ +VGDR  TD+V   + G   + + + + L+  P +  + R+ E
Sbjct: 133 RLVDRPEEVAVVGDRLLTDMVMARQMGACGVWVRDGVRLSSSPIVAFEKRLYE 185



>gb:AE017333_448594 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858396 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 172

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 52/175 (29%), Positives = 85/175 (48%), Gaps = 1/175 (0%)
 Frame = -3

Query: 678 KHLVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF 499
           K   +P   V +I +I   +LK R  +G++ D DNTL         P L    E+ K   
Sbjct: 3   KKFFLPDEFVKNIFHITPEKLKERNVKGIITDLDNTLVEWDRPSATPRLIEWFEEMKE-H 61

Query: 498 GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCESSK 322
           G  + + SN+        + +  KI    + I  I ++ KKP G A  +  +  G +   
Sbjct: 62  GIKVTIVSNN--------NEKRVKIFSEPLNIPFI-YKAKKPMGRAFRKAVKNMGLKKED 112

Query: 321 LIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKG 157
           ++++GD+  TD++ GNRNGF TIL  P++ A + F  +  R +ER ++     KG
Sbjct: 113 VVVIGDQLMTDVLGGNRNGFHTILVVPVA-ASDGFFTRFNRQVERRILSALKRKG 166



>gb:CR382138_1671407 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 205

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 51/170 (30%), Positives = 85/170 (50%), Gaps = 15/170 (8%)
 Frame = -3

Query: 681 NKHLVIPHIAVPDIRYI---------DWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLR 529
           N  L +PH+ V     +         D  ++K     GVV DKDN     +  ++WP   
Sbjct: 16  NPRLCLPHLTVKSFDNLPIPFEIPGHDGVQIK-----GVVIDKDNCFAKDHDDKVWPAYS 70

Query: 528 SSIEQCKALF-GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEI 352
            + ++    +   ++ + SNSAG  + D +   A  LE+  G+ V+RH  KKP G  EEI
Sbjct: 71  ETWKRLTQAYPAEHLLIVSNSAGTND-DTNYNQASKLEKDTGVTVLRHPTKKP-GCHEEI 128

Query: 351 ERQFG----CESSKLIMVGDRPFTDIVYGNRNGFLTI-LTEPLSLAEEPF 217
              F      E+++++++GDR FTD++  N  G   I L+E + L+++ F
Sbjct: 129 RDYFKKQGITEANEIVVIGDRLFTDMLMANMMGSWGIWLSEGVELSQKVF 178



>gb:AE017343_1755732 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 419

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 37/105 (35%), Positives = 59/105 (56%), Gaps = 1/105 (0%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF-G 496
           L+ PH+ VP I  +D+  LK+ G+  VV DKDN LT+P+   ++PP + +     + F  
Sbjct: 21  LLRPHLRVPSIANVDFKALKKEGYNAVVIDKDNCLTLPHKDDIYPPYQKAWTDLLSTFRP 80

Query: 495 NNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA 361
             + V SNSAG  + DP G  A+ +  ++   V+ H + KP  +A
Sbjct: 81  GRVLVVSNSAGTTK-DPGGIAAEAVSLSLRAPVLLHHIPKPGCSA 124



>gb:NC15E6_1688347 Neurospora crassa DNA linkage group V Cosmid
           contig 15E6.
          Length = 218

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 18/167 (10%)
 Frame = -3

Query: 711 LTSSLGIFA--KNKHLVIPHIAVPDI--------RYIDWAELKRRGFEGVVFDKDNTLTV 562
           L++SL IF       L +PH  VP          +       K+   + VV DKD+    
Sbjct: 8   LSASLNIFKLIAKPSLCLPHATVPTFNDLPIPLNKAFSGNGEKKVDIKAVVLDKDDCFAY 67

Query: 561 PYSLRLWPPLRSSIEQCKALF-GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHR 385
           P    ++   +  +E  +A + G  + + SN+AG   +D DG+ A  +E+A GI V+ H 
Sbjct: 68  PDHNEVYEAYKERMEALRAAYPGRRLLIVSNTAGALSWDKDGQMASAVEKATGITVLPHG 127

Query: 384 VKKPAGTAEEIERQFGCESS-------KLIMVGDRPFTDIVYGNRNG 265
           VKKP G  +EI   F            ++ +VGDR  TD++  N  G
Sbjct: 128 VKKP-GCGDEIMSYFRAHPETGVTSPHQIAVVGDRLATDMMLANMMG 173



>pir|T48794|T48794 hypothetical protein 15E6.20 [imported] -
           Neurospora crassa
          Length = 211

 Score = 67.4 bits (163), Expect = 6e-10
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 18/167 (10%)
 Frame = -3

Query: 711 LTSSLGIFA--KNKHLVIPHIAVPDI--------RYIDWAELKRRGFEGVVFDKDNTLTV 562
           L++SL IF       L +PH  VP          +       K+   + VV DKD+    
Sbjct: 8   LSASLNIFKLIAKPSLCLPHATVPTFNDLPIPLNKAFSGNGEKKVDIKAVVLDKDDCFAY 67

Query: 561 PYSLRLWPPLRSSIEQCKALF-GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHR 385
           P    ++   +  +E  +A + G  + + SN+AG   +D DG+ A  +E+A GI V+ H 
Sbjct: 68  PDHNEVYEAYKERMEALRAAYPGRRLLIVSNTAGALSWDKDGQMASAVEKATGITVLPHG 127

Query: 384 VKKPAGTAEEIERQFGCESS-------KLIMVGDRPFTDIVYGNRNG 265
           VKKP G  +EI   F            ++ +VGDR  TD++  N  G
Sbjct: 128 VKKP-GCGDEIMSYFRAHPETGVTSPHQIAVVGDRLATDMMLANMMG 173



>sp|P54452|YQEG_BACSU Hypothetical protein yqeG.>pir|C69951|C69951
           conserved hypothetical protein yqeG - Bacillus
           subtilis>gb:BACJH642_745628 Bacillus subtilis DNA, 283
           Kb region containing skin element.>gb:BSUB0014_754533
           Bacillus subtilis complete genome (section 14 of 21):
           from 2613658 to 2812830.
          Length = 172

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 51/175 (29%), Positives = 84/175 (48%), Gaps = 1/175 (0%)
 Frame = -3

Query: 678 KHLVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF 499
           K   +P   V +I +I   +LK R  +G++ D DNTL         P L    E+ K   
Sbjct: 3   KKFFLPDEFVKNIFHITPEKLKERNVKGIITDLDNTLVEWDRPNATPRLIEWFEEMKE-H 61

Query: 498 GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCESSK 322
           G  + + SN+        + R  K+    +GI  I ++ +KP G A     R    +   
Sbjct: 62  GIKVTIVSNN--------NERRVKLFSEPLGIPFI-YKARKPMGKAFNRAVRNMELKKED 112

Query: 321 LIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKG 157
            +++GD+  TD++ GNRNG+ TIL  P++ + + FI +  R +ER ++     KG
Sbjct: 113 CVVIGDQLLTDVLGGNRNGYHTILVVPVA-SSDGFITRFNRQVERRILSALKRKG 166



>sp|P38812|YHQ0_YEAST Hypothetical 20.9 kDa protein in HXT5-NRK1
           intergenic region.>pir|S48943|S48943 hypothetical
           protein YHR100c - yeast (Saccharomyces
           cerevisiae)>gb:AY692650_1622697 Saccharomyces cerevisiae
           clone FLH158475.01X YHR100C gene, complete
           cds.>gb:YSCH8263_1729082 Saccharomyces cerevisiae
           chromosome VIII cosmid 8263.
          Length = 185

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 52/160 (32%), Positives = 75/160 (46%), Gaps = 6/160 (3%)
 Frame = -3

Query: 726 INVEGLTSSLGIFAKNKHLVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLR 547
           +N+ G  ++L +   N  L  P + VP     D         + VV DKDN +  P+  +
Sbjct: 1   MNISGTLNTLRLLY-NPSLCKPSLVVPTFN--DLPIPIHDSIKAVVLDKDNCIAFPHDDK 57

Query: 546 LWPPLRSSIEQCKALFGNN-IAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPA 370
           +WP      E  ++ + N  + + SN+AG    D D   AK+LE   GI V+RH  KKP 
Sbjct: 58  IWPDYLQHWETLRSKYSNKALLIVSNTAGS-NSDKDYSQAKLLEDKTGIPVLRHSTKKP- 115

Query: 369 GTAEEIERQFG-----CESSKLIMVGDRPFTDIVYGNRNG 265
           G   EI   F          ++ +VGDR FTDI+  N  G
Sbjct: 116 GCHNEILDYFYRNKTITNPKEVAVVGDRLFTDILMANLMG 155



>gb:CR380954_1651245 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 185

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 40/115 (34%), Positives = 64/115 (55%), Gaps = 5/115 (4%)
 Frame = -3

Query: 594 VVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPDGRNAKILER 415
           VV DKDN + +    ++W    +  E+ K ++ + + + SNSAG  + D     AK LE+
Sbjct: 42  VVVDKDNCMALQDDDKVWHEYTAKWEELKRVYQDRVLIVSNSAGSSD-DKGYLQAKTLEK 100

Query: 414 AIGIKVIRHRVKKPAGTAEEI-----ERQFGCESSKLIMVGDRPFTDIVYGNRNG 265
             G+ V+RH++KKP G  +EI     ER    +  ++ ++GDR FTDI+  N  G
Sbjct: 101 NTGVPVLRHKLKKP-GCRDEIIEYFKERGLIEKPDEIAVIGDRLFTDILMANMMG 154



>pir|T41519|T41519 hypothetical protein SPCC645.02 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC645_1721522 S.pombe
           chromosome III cosmid c645.
          Length = 188

 Score = 60.1 bits (144), Expect = 9e-08
 Identities = 47/167 (28%), Positives = 73/167 (43%), Gaps = 13/167 (7%)
 Frame = -3

Query: 726 INVEGLTSSLGIFAKNKHLVIPHIAVPDIRYID-----WAELKRR---GFEGVVFDKDNT 571
           IN+EG+ +      +N   +IPH   P    I      + E K +       +V DKDN 
Sbjct: 3   INIEGIQAFCQTI-RNPRRIIPHATFPTFSQIPCNINYFLEQKFQVPVDIRALVLDKDNC 61

Query: 570 LTVPYSLRLWPPLRSSIEQCKALFGN-NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVI 394
           +T+P    +       I + + ++G  N+ + SNS G  + DP G  A   ++   I V+
Sbjct: 62  ITLPNETTIAEAELKKIREFQNIYGEKNVILLSNSIGTRKLDPTGELAAHFQQKWNIPVV 121

Query: 393 RHRVKKPAGTAEEI----ERQFGCESSKLIMVGDRPFTDIVYGNRNG 265
           RH   KP  T E             +S+++ +GDR  TDI   N  G
Sbjct: 122 RHSKLKPLCTEELYTYLSNNSHVSSASQILFIGDRLLTDITLANIMG 168



>gb:CR382127_1660052 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 193

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 47/165 (28%), Positives = 84/165 (50%), Gaps = 11/165 (6%)
 Frame = -3

Query: 726 INVEGLTSSLGIFAK--NKHLVIPHIAVPDIRYIDWAELKRRG--FEGVVFDKDNTLTVP 559
           +N   L+++L  F    N  L+ PH+ V +   +      + G   + V+ DKDN   V 
Sbjct: 2   VNGLNLSATLNTFKLLFNPSLIKPHVTVSNFSQLPVPIPGKNGAQIKAVILDKDNCFAVD 61

Query: 558 YSLRLWPPLRSSIEQCKALFGNNIA--VFSNSAGLFEYDPDGRNAKILERAIGIKVIRHR 385
            +  ++      +++ K  +   +   V SNSAG  + D D ++A+ +E+  G++V RH 
Sbjct: 62  GADHVFEQYHDKMDELKKQYPGKLQLLVVSNSAGTND-DTDFKDAQRVEQNTGLEVYRHA 120

Query: 384 VKKPAGTAEEI-----ERQFGCESSKLIMVGDRPFTDIVYGNRNG 265
           VKKP G  E++     + +   + S++ +VGDR  TD+V  N+ G
Sbjct: 121 VKKP-GCHEDLVAYLKKNKVIDQPSEVAVVGDRLLTDVVMANQIG 164



>gb:AE017038_384513 Bacillus anthracis str. Ames section 15 of 18 of
           the complete genome.>gb:AE017225_409609 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_454360 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_465366 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_854681 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1014218 Bacillus anthracis str. Ames
           complete genome.
          Length = 170

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 48/174 (27%), Positives = 84/174 (48%), Gaps = 1/174 (0%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGN 493
           L +P+  V ++ ++   +LK+RG +GV+ D DNTL         P L     + K   G 
Sbjct: 3   LFLPNEYVKNVYHVQPEDLKKRGIKGVITDLDNTLIEWDRPNATPQLEEWFLKMKEQ-GI 61

Query: 492 NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCESSKLI 316
            + V SN+        + +  K     +GI  I H  +KP   A +   R+   +  +++
Sbjct: 62  QVTVVSNN--------NEQRVKDFADPLGIPFI-HSARKPFVRAFKRAIREMQLQPDEVV 112

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKGV 154
           ++GD+  TD++ GNR G  TIL  P++   +  + +  R IER ++     KG+
Sbjct: 113 VIGDQLLTDVLGGNRVGLHTILVVPVA-QTDGLVTRFNRKIERRIMRNMKKKGL 165



>gb:AE017012_379202 Bacillus cereus ATCC 14579 section 15 of 18 of
           the complete genome.>gb:AE016877_1019452 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 170

 Score = 57.0 bits (136), Expect = 8e-07
 Identities = 47/174 (27%), Positives = 84/174 (48%), Gaps = 1/174 (0%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGN 493
           L +P+  V ++ ++   +LK+RG +GV+ D DNTL         P L     + K   G 
Sbjct: 3   LFLPNEYVKNVYHVQPEDLKKRGIKGVITDLDNTLIEWDRPNATPQLEKWFLEMKEQ-GI 61

Query: 492 NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCESSKLI 316
            + V SN+        + +  K     +GI  I H  +KP   A +   ++   +  +++
Sbjct: 62  QVTVVSNN--------NEQRVKDFADPLGIPFI-HSARKPFVRAFKRAIQEMRLQPDEVV 112

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKGV 154
           ++GD+  TD++ GNR G  TIL  P++   +  + +  R IER ++     KG+
Sbjct: 113 VIGDQLLTDVLGGNRVGLHTILVVPVA-QTDGLVTRFNRKIERRIMKNMKKKGL 165



>gb:AE017278_425617 Bacillus cereus ATCC 10987, section 15 of 18 of
           the complete genome.>gb:AE017194_1064036 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 170

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 47/174 (27%), Positives = 83/174 (47%), Gaps = 1/174 (0%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGN 493
           L +P+  V ++ ++   +LK+RG +GV+ D DNTL         P L     + K   G 
Sbjct: 3   LFLPNEYVKNVYHVQPEDLKKRGIKGVITDLDNTLIEWDRPNATPQLEEWFLKMKEQ-GI 61

Query: 492 NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCESSKLI 316
            + V SN+        + +  K     +GI  I H  +KP   A +   +    +  +++
Sbjct: 62  QVTVVSNN--------NEQRVKDFADPLGIPFI-HSARKPFVRAFKRAIQDMQLQPDEVV 112

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKGV 154
           ++GD+  TD++ GNR G  TIL  P++   +  + +  R IER ++     KG+
Sbjct: 113 VIGDQLLTDVLGGNRVGLHTILVVPVA-QTDGLVTRFNRKIERRIMRNMKKKGL 165



>gb:AE013088_288909 Thermoanaerobacter tengcongensis MB4, section
           115 of 244 of the complete genome.>gb:AE008691_1110974
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 166

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 43/145 (29%), Positives = 67/145 (46%)
 Frame = -3

Query: 669 VIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNN 490
           +IP + V  +  ID   LK++G   +V D DNTL    +  L       +E+ K   G  
Sbjct: 5   LIPDMIVESVHKIDLNLLKKKGITSLVLDIDNTLLPKKAKFLDEDTVEWLERAKNE-GFK 63

Query: 489 IAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMV 310
           I + SN+          +    L+   GI  I   +K   G  ++  +  G +  +  ++
Sbjct: 64  ICLVSNNTK--------KRVNELKEKTGIPGIAWAIKPRKGAFKKALKLLGAKPHETALI 115

Query: 309 GDRPFTDIVYGNRNGFLTILTEPLS 235
           GD+ FTDI+ G R G  TIL +PLS
Sbjct: 116 GDQIFTDILGGKRVGLYTILVKPLS 140



>pir|E89941|E89941 conserved hypothetical protein SA1426 [imported]
           - Staphylococcus aureus (strain N315)>gb:BA000017_677286
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_679872 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete genome.
          Length = 175

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 51/177 (28%), Positives = 84/177 (47%), Gaps = 7/177 (3%)
 Frame = -3

Query: 666 IPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF---- 499
           +P+  V  I  ID  +L  +G +G++ D DNTL        W  ++   E+ KA F    
Sbjct: 9   MPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVG------WD-VKEPTERVKAWFKEAN 61

Query: 498 --GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCES 328
             G  I + SN+        + R A   +  + I  I  + +KP G A ++   +     
Sbjct: 62  EKGITITIVSNNN-------ESRVASFSQH-LDIDFI-FKARKPMGKAFDKAITKMNIRP 112

Query: 327 SKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKG 157
            + +++GD+  TD+  GNR G  TI+  P+    + FI +  R+IER L+  +S KG
Sbjct: 113 DQTVVIGDQMLTDVFGGNRRGLYTIMVVPVK-RTDGFITKVNRLIERRLLRHFSKKG 168



>gb:AP006627_563955 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 173

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 46/170 (27%), Positives = 85/170 (50%), Gaps = 3/170 (1%)
 Frame = -3

Query: 669 VIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNN 490
           ++P+  V  I  ID   L+ RG + V+ D DNTL   +     P ++  +++ +   G +
Sbjct: 5   LLPNQYVKSIYDIDLNALRDRGIKAVITDLDNTLVEWHRPGATPEVKQWLKELEKT-GLH 63

Query: 489 IAVFSNSAGLFEYDPDGRNAKILERAIGIK--VIRHRVKKPAGTA-EEIERQFGCESSKL 319
           + + SN+           N K ++     +  V  H  KKP   A  +   Q G  + + 
Sbjct: 64  VTIVSNN-----------NEKRVKTFCDPEKVVFIHSAKKPMRRAFRQACSQMGVRTDEA 112

Query: 318 IMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQW 169
           +++GD+ FTD++ GNR G  TIL  P++ + + ++ +  R +ER +V +W
Sbjct: 113 VVIGDQIFTDVLGGNRAGLYTILVVPVA-STDGWMTKVNRRVER-IVLKW 160



>gb:CP000046_91773 Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000033_711841 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_781113 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_783756 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 175

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 51/177 (28%), Positives = 84/177 (47%), Gaps = 7/177 (3%)
 Frame = -3

Query: 666 IPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF---- 499
           +P+  V  I  ID  +L  +G +G++ D DNTL        W  ++   E+ KA F    
Sbjct: 9   MPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVG------WD-VKEPTERVKAWFKEAN 61

Query: 498 --GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCES 328
             G  I + SN+        + R A   +  + I  I  + +KP G A ++   +     
Sbjct: 62  EKGITITIVSNNN-------ESRVASFSQH-LDIDFI-FKARKPMGKAFDKAITKMNIRP 112

Query: 327 SKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKG 157
            + +++GD+  TD+  GNR G  TI+  P+    + FI +  R+IER L+  +S KG
Sbjct: 113 DQTVVIGDQMLTDVFGGNRRGLYTIMVVPVK-RTDGFITKFNRLIERRLLRHFSKKG 168



>pir|B83815|B83815 hypothetical protein BH1322 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_655268 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 171

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 41/146 (28%), Positives = 70/146 (47%), Gaps = 1/146 (0%)
 Frame = -3

Query: 669 VIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNN 490
           ++P+  V  +  I   ELK++G +G++ D DNTL         P ++   +Q K   G  
Sbjct: 5   LLPNDYVKTVHDIPLEELKQQGIKGIITDLDNTLVEWDRPEATPEVKEWFQQVKDA-GMK 63

Query: 489 IAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQFGCESSKLIM 313
           + + SN++         +  +     + +  I H  KKP   A  E  +Q     S+ ++
Sbjct: 64  LTIVSNNSE--------KRVRSFAAPVQVNFI-HSAKKPMTKAFVEACKQMNISVSEAVV 114

Query: 312 VGDRPFTDIVYGNRNGFLTILTEPLS 235
           VGD+ FTD++ GNR    TIL  P++
Sbjct: 115 VGDQIFTDVLGGNRANIHTILVVPVT 140



>gb:AP008231_581404 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 183

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 45/149 (30%), Positives = 70/149 (46%), Gaps = 1/149 (0%)
 Frame = -3

Query: 675 HLVIPHIAVP-DIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF 499
           HL+ P + VP  I  +    L   G +G++ D D TL    S  +   LR  I + K  F
Sbjct: 5   HLLQPDLVVPGSILQLQAEPLLAAGLQGLILDVDETLVPTMSREISEELRHWIAEMKQSF 64

Query: 498 GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKL 319
             ++ + SN+         G  A  L+    +   +   +K    AEE+    G +  ++
Sbjct: 65  --SLWLVSNNLSQSRI---GAIAAALDLPYFLAARKPSRRKIRQAAEEM----GLDLERV 115

Query: 318 IMVGDRPFTDIVYGNRNGFLTILTEPLSL 232
            +VGDR FTD++ GNR G  T+L EP+ L
Sbjct: 116 GVVGDRLFTDVLAGNRLGVFTVLVEPMVL 144



>gb:CP000029_81769 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016748_322934 Staphylococcus epidermidis
           ATCC 12228, section 5 of 9 of the complete
           genome.>gb:AE015929_1147603 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 175

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 47/175 (26%), Positives = 81/175 (46%), Gaps = 1/175 (0%)
 Frame = -3

Query: 678 KHLVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF 499
           K L +P+  V  I  ID  +L   G +G++ D DNTL           ++S   + K L 
Sbjct: 5   KKLFMPNAYVKSIFEIDIEKLADSGVKGIITDLDNTLVGWDVKEPTKGVKSWFAKAKDL- 63

Query: 498 GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIE-RQFGCESSK 322
           G  + + SN+        +          +G+  I  + +KP G A ++  ++   +  +
Sbjct: 64  GITVTIVSNN--------NKSRVSSFSSNLGVDYI-FKARKPMGKAFKMAIKKMKIQPRE 114

Query: 321 LIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKG 157
            ++VGD+  TD+  GN NG  TI+  P+    +  I +  R+IER L+  +  KG
Sbjct: 115 TVVVGDQMLTDVFGGNCNGLYTIMVVPVK-RTDGLITKFNRLIERRLLNHFRKKG 168



>gb:BX569691_775683 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 173

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 42/164 (25%), Positives = 67/164 (40%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGN 493
           L I H+++P         L  RG    V D D TL     + L  P+   +   K     
Sbjct: 18  LTIAHLSLP--------HLLSRGLSAAVLDVDRTLLPGRDVTLPEPVLVWLTDAKRRL-- 67

Query: 492 NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIM 313
            + +FSN+       P       +   +G+       K   G    +  +      ++ M
Sbjct: 68  KLHLFSNN-------PSHARIAAVADQLGVSFTCGARKPRRGALRRVIDELDLPPERIAM 120

Query: 312 VGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERAL 181
           +GDR FTD+  GNR G  T+L +P+S   +P    +V+ +ER L
Sbjct: 121 IGDRLFTDVWCGNRLGLYTVLVQPISQNGQPCRHDRVQRLERRL 164



>gb:AP006840_569142 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 169

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 47/153 (30%), Positives = 70/153 (45%), Gaps = 1/153 (0%)
 Frame = -3

Query: 633 IDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFE 454
           ID   L+R G   ++ D DNTL         P L   +   +A  G    + SN++G   
Sbjct: 16  IDLDRLRRMGKRAIILDLDNTLVRWNDPTPTPKLLEWLAAVRA-HGLMPCIVSNNSG--- 71

Query: 453 YDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDRPFTDIVYGN 274
                R  +   RA G+  +    K       +  RQ G    + ++VGD+ FTD++ GN
Sbjct: 72  ----PRVGEFAARA-GVPFVPSAAKPRVKGFRQAMRQLGVAPHETVVVGDQLFTDVLGGN 126

Query: 273 RNGFLTILTEPLSLAEEPFI-VQQVRVIERALV 178
           R G  TIL  P+   E  FI  + VR+IER ++
Sbjct: 127 RAGAYTILVVPIDRRE--FIGTRLVRLIERRVL 157



>pir|S76105|S76105 hypothetical protein - Synechocystis sp. (strain
           PCC 6803)>gb:BA000022_689472 Synechocystis sp. PCC 6803
           DNA, complete genome.
          Length = 184

 Score = 50.8 bits (120), Expect = 6e-05
 Identities = 51/170 (30%), Positives = 73/170 (42%), Gaps = 12/170 (7%)
 Frame = -3

Query: 624 AELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKA-----LFGNNIAVFSNSAGL 460
           A L R G +G+V D D TL      ++   L++ I+  KA     L  NN++  S   G+
Sbjct: 33  AILDRHGVKGLVLDVDETLVPFRGDQVSEELQAWIDPIKAKLPIWLVSNNMSE-SRIGGV 91

Query: 459 -------FEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDR 301
                  F Y     + + L +AI                   E Q   ES  + MVGDR
Sbjct: 92  AQTLDLPFLYGAAKPSRRKLRQAIA------------------EMQLPVES--VAMVGDR 131

Query: 300 PFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKGVE 151
            FTD++ GNR G  TIL EP+ L  +P             +Y WS++ +E
Sbjct: 132 LFTDVLAGNRLGMFTILVEPMELPGKP-------------LYPWSIRNIE 168



>gb:BX572092_796415 Prochlorococcus marinus MED4 complete genome;
           segment 3/5.
          Length = 164

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 37/157 (23%), Positives = 70/157 (44%), Gaps = 6/157 (3%)
 Frame = -3

Query: 633 IDWAELKRRGFEGVVFDKDNTLT------VPYSLRLWPPLRSSIEQCKALFGNNIAVFSN 472
           I   +L++ G + ++ D D TL       VP +++ W      I++ K LF         
Sbjct: 18  ISHLKLQKEGIKSLLIDVDGTLLSRQSNIVPINVKNW------IKESKKLF--------- 62

Query: 471 SAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDRPFT 292
           S  L   +P     + + + + I+   + +K       ++  +   +S  + ++GDR FT
Sbjct: 63  SMYLISNNPSNERIRKIAKELDIRYKSNALKPRKKITLDVISEMNEDSKNIAIIGDRIFT 122

Query: 291 DIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERAL 181
           DI+ GNR    TIL + LS    P  +    ++E+ +
Sbjct: 123 DIIVGNRCNIQTILVKRLSKNGLPININLTLILEKMI 159



>gb:AP006628_566736 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 189

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 39/151 (25%), Positives = 75/151 (49%), Gaps = 1/151 (0%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGN 493
           L IP    P +  I +   +++G + ++FD DNTL       L   +++ + +   +F  
Sbjct: 11  LFIPQHYFPCVLQIPFELFQKQGIKALIFDLDNTLIECNKDILDEQIKNLLTKLSLIF-- 68

Query: 492 NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQF-GCESSKLI 316
            + + SN++         R  K+L+       +    KKP+ TA +   Q    E+++++
Sbjct: 69  KVVILSNAS-------KKRLHKVLKNDFTFIYLNLLNKKPSPTAFQKACQLLKLETTQML 121

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPLSLAEE 223
           M+GD+  TDI   N+ GF ++L +PL+  +E
Sbjct: 122 MIGDQLQTDIKGANQAGFCSLLVKPLNRFQE 152



>gb:AE017204_404799 Lactobacillus johnsonii NCC 533, section 5 of 7
           of the complete genome.>gb:AE017198_1123286
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 167

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 41/147 (27%), Positives = 65/147 (44%), Gaps = 5/147 (3%)
 Frame = -3

Query: 663 PHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIE-----QCKALF 499
           P   +  I ++D  +LK+ G + V  D DNTL        W    +++E     Q  A  
Sbjct: 5   PRYTIDTIYHLDPKQLKKMGIKAVFSDLDNTLLA------WNKAETAVEMDELNQRLAKD 58

Query: 498 GNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKL 319
           G  + V SN+          R  K+L       + + R   P G  +E+ +    +  ++
Sbjct: 59  GIRLVVISNNNA-------ERIGKVLNPYHISFIAKARKPLPIGINKEL-KALNLKKDQV 110

Query: 318 IMVGDRPFTDIVYGNRNGFLTILTEPL 238
           +MVGD+  TDI  GN  G  T+L +PL
Sbjct: 111 LMVGDQLITDIQAGNLAGVTTVLVKPL 137



>gb:AE017306_437257 Thermus thermophilus HB27 section 6 of 7 of the
           complete genome.>gb:AP008226_577820 Thermus thermophilus
           HB8 genomic DNA, complete genome.>gb:AE017221_1079235
           Thermus thermophilus HB27 complete genome.
          Length = 161

 Score = 48.1 bits (113), Expect = 4e-04
 Identities = 46/162 (28%), Positives = 80/162 (49%), Gaps = 1/162 (0%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPL-RSSIEQCKALFG 496
           ++ P   +P + ++  A LK RG +GV+ D DNTL +PY     P   R+ +   K    
Sbjct: 1   MLFPREVLPSLLHLTPAWLKARGLKGVILDLDNTL-LPYGEGDLPEAYRAWLSDLKGA-- 57

Query: 495 NNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLI 316
             + V+  S  L E     R A++ +R + +      +K   G  + + +  G  + ++ 
Sbjct: 58  --VPVYLLSNALPE-----RFARV-QRLLDLPGHAPALKPWFGFRKAL-KALGLPAREVA 108

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIE 190
            VGD+ FTD++ GN  G  T+L  PL   +E F  + +R++E
Sbjct: 109 AVGDQVFTDVLGGNLVGAYTVLVPPLR-EQEFFYTRFIRMLE 149



>gb:BA000028_696376 Oceanobacillus iheyensis HTE831 DNA, complete
           genome.
          Length = 171

 Score = 47.0 bits (110), Expect = 8e-04
 Identities = 45/182 (24%), Positives = 79/182 (43%), Gaps = 12/182 (6%)
 Frame = -3

Query: 666 IPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTV-------PYSLRLWPPLRSSIEQCK 508
           +P+  V  I  +  + LK+RG +G++ D DNTL         P  +R +  +R +  +  
Sbjct: 6   LPNEHVKSIFDLQPSTLKKRGIKGIITDLDNTLVAWDVKDATPEVVRWFQEMRENDIKVT 65

Query: 507 ALFGNN---IAVFSNSAGL-FEYDPDGRNAKILERAIGIKVIRHRVKKPAGTA-EEIERQ 343
            +  NN   + VFS      F Y                       +KP   A + + ++
Sbjct: 66  IISNNNQERVQVFSEPLETPFVYS---------------------ARKPLSKAFKTVAKE 104

Query: 342 FGCESSKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSV 163
                 ++++VGD+  TD++ GN  GF T+L  P+ +  +  I +  R IER ++     
Sbjct: 105 MELSKEEIVVVGDQLLTDVLGGNFAGFYTVLVVPI-VETDGKITRINRTIERRILNYMRR 163

Query: 162 KG 157
           KG
Sbjct: 164 KG 165



>gb:AE016956_366825 Enterococcus faecalis V583, section 10 of 11 of
           the complete genome.>gb:AE016830_993313 Enterococcus
           faecalis V583, complete genome.
          Length = 175

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 41/152 (26%), Positives = 73/152 (48%)
 Frame = -3

Query: 693 IFAKNKHLVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQ 514
           +F+K K    P   +  I  I  A+LK+ G + V+ D DNTL    +      L++ + +
Sbjct: 1   MFSKYK----PTWMIDAIYKITPAQLKKLGIKAVLTDLDNTLIAWNNPDGTEELKTWLLE 56

Query: 513 CKALFGNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGC 334
            K   G  + V SN+        D R  +++E+   +  +   +K  A   +  E++ G 
Sbjct: 57  MKNA-GITVLVVSNNK-------DSRIKRVVEK-FDLDYVARALKPTARGFKLAEKKLGL 107

Query: 333 ESSKLIMVGDRPFTDIVYGNRNGFLTILTEPL 238
           + S+++MVGD+  TDI   N  G   +L +P+
Sbjct: 108 KPSEMLMVGDQIMTDIRGANAAGIRNVLVQPI 139



>gb:CP000003_860213 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 194

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 40/142 (28%), Positives = 73/142 (51%), Gaps = 3/142 (2%)
 Frame = -3

Query: 654 AVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFS 475
           A+ D+R  D   L R G   V+ D DNTL    +    P +R+ +++   +   ++ V S
Sbjct: 33  AIYDLRAND---LLRHGITAVLVDLDNTLIAWNNPDGTPEVRAWLDEM-TIADISVVVVS 88

Query: 474 NSAGLFEYDPDGRNAKILERAI---GIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGD 304
           N+          +++++ ERA+   G+  I   +K  A   E+   ++G + +++IMVGD
Sbjct: 89  NN----------KHSRV-ERAVSRFGVDFISRALKPFAYGIEKAIARYGFDRNEVIMVGD 137

Query: 303 RPFTDIVYGNRNGFLTILTEPL 238
           +  TDI   +R G  ++L +PL
Sbjct: 138 QLMTDIRASHRAGIKSVLVKPL 159



>gb:AE006496_219492 Streptococcus pyogenes M1 GAS, section 25 of 167
           of the complete genome.>gb:AE009976_257948 Streptococcus
           pyogenes strain MGAS8232, section 24 of 173 of the
           complete genome.>gb:AE014141_303700 Streptococcus
           pyogenes MGAS315, section 6 of 37 of the complete
           genome.>gb:BA000034_714561 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:AE009949_904330 Streptococcus
           pyogenes strain MGAS8232, complete
           genome.>gb:AE014074_926879 Streptococcus pyogenes
           MGAS315, complete genome.>gb:AE004092_1105338
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 194

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 40/142 (28%), Positives = 73/142 (51%), Gaps = 3/142 (2%)
 Frame = -3

Query: 654 AVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFS 475
           A+ D+R  D   L R G   V+ D DNTL    +    P +R+ +++   +   ++ V S
Sbjct: 33  AIYDLRAND---LLRHGITAVLVDLDNTLIAWNNPDGTPEVRAWLDEM-TIADISVVVVS 88

Query: 474 NSAGLFEYDPDGRNAKILERAI---GIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGD 304
           N+          +++++ ERA+   G+  I   +K  A   E+   ++G + +++IMVGD
Sbjct: 89  NN----------KHSRV-ERAVSRFGVDFISRALKPFAYGIEKAIARYGFDRNEVIMVGD 137

Query: 303 RPFTDIVYGNRNGFLTILTEPL 238
           +  TDI   +R G  ++L +PL
Sbjct: 138 QLMTDIRASHRAGIKSVLVKPL 159



>gb:BX572096_797870 Prochlorococcus marinus MIT9313 complete genome;
           segment 2/7.
          Length = 169

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 35/164 (21%), Positives = 67/164 (40%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGN 493
           L +PH+ +          L  +G + ++ D D TL     + L   + S +++ +     
Sbjct: 14  LTLPHLPIQ--------HLLDQGLQALILDVDRTLLPGREIELPLSVTSWVKEAQRHL-- 63

Query: 492 NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIM 313
                     LF  +P  +    +   + +       K       ++  Q  C+ +++ +
Sbjct: 64  -------LLHLFSNNPSRKRIGSVAEQLDLTFTCSAAKPRRARLRKVLNQIQCKPTEIAI 116

Query: 312 VGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERAL 181
           VGDR FTD++ GNR    T+L  PL     P    +V+ +E+ L
Sbjct: 117 VGDRIFTDVLAGNRLDLYTVLVRPLRADGYPCKNNRVQRLEQKL 160



>gb:BA000043_739103 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 171

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 32/129 (24%), Positives = 59/129 (45%)
 Frame = -3

Query: 621 ELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPD 442
           ELK++G +G++ D DNTL         P L +  +  K   G  + + SN+        +
Sbjct: 21  ELKQKGVKGIITDLDNTLVEWDRPSATPELAAWFDAMKQA-GIKVVIVSNN--------N 71

Query: 441 GRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDRPFTDIVYGNRNGF 262
            +  +     +GI  I    K       +  +    +  +++++GD+  TD++ GNR G 
Sbjct: 72  KQRVQSFAEPLGIPFIFEARKPLTRAFLQALKMMELKKEEVVVIGDQLLTDVLGGNRLGL 131

Query: 261 LTILTEPLS 235
            TIL  P++
Sbjct: 132 NTILVVPVA 140



>pir|A95204|A95204 conserved hypothetical protein SP1750 [imported]
           - Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007467_226887 Streptococcus pneumoniae TIGR4
           section 150 of 194 of the complete
           genome.>gb:AE005672_1104655 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 175

 Score = 43.1 bits (100), Expect = 0.011
 Identities = 38/146 (26%), Positives = 66/146 (45%), Gaps = 3/146 (2%)
 Frame = -3

Query: 666 IPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNI 487
           IP  AV  +  +    L+ +G + V+ D DNTL    +    P ++  +   +   G  I
Sbjct: 7   IPDFAVEAVYDLTVPSLQAQGIKAVLVDLDNTLIAWNNPDGTPEMKQWLHDLRDA-GIGI 65

Query: 486 AVFSNSAGLFEYDPDGRNAKILERAI---GIKVIRHRVKKPAGTAEEIERQFGCESSKLI 316
            V SN+             K ++RA+   GI  +   +K      +   ++F  +  +++
Sbjct: 66  IVVSNNT-----------KKRVQRAVEKFGIDYVYWALKPFTFGIDRAMKEFHYDKKEVV 114

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPL 238
           MVGD+  TDI   +R G  +IL +PL
Sbjct: 115 MVGDQLMTDIRAAHRAGIRSILVKPL 140



>pir|AG2193|AG2193 hypothetical protein alr3102 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684091 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 179

 Score = 42.7 bits (99), Expect = 0.015
 Identities = 36/128 (28%), Positives = 60/128 (46%), Gaps = 1/128 (0%)
 Frame = -3

Query: 618 LKRRGFEGVVFDKDNTLTVPYSL-RLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPD 442
           ++    +G+V D D TL VP ++    P LR  +EQ +++     A++  S  + E    
Sbjct: 25  IEHHQLKGLVLDVDETL-VPITVGSASPELRDWVEQIRSV----TALWLVSNNMSEARIG 79

Query: 441 GRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDRPFTDIVYGNRNGF 262
           G     + R++ +       K          ++      ++ MVGDR FTD++ GNR G 
Sbjct: 80  G-----IARSLNLPYYLGAAKPSRRKIRAALQEMNLPVEQVGMVGDRLFTDVLAGNRLGM 134

Query: 261 LTILTEPL 238
            TIL EP+
Sbjct: 135 FTILVEPI 142



>gb:BA000045_741204 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 179

 Score = 42.4 bits (98), Expect = 0.020
 Identities = 33/147 (22%), Positives = 66/147 (44%), Gaps = 1/147 (0%)
 Frame = -3

Query: 678 KHLVIPHIAVPD-IRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKAL 502
           K+L  P + V   +  + +A LK+R   G++ D D+TL       +   +   + + +  
Sbjct: 4   KNLFKPDLIVAGPVSDLSFAWLKQRDIAGLILDLDDTLLALGEQMVNTRVVEWVARARLE 63

Query: 501 FGNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSK 322
           F   + + SN+       P+    + +  ++ +  I    K        + ++      +
Sbjct: 64  F--RLYIVSNN-------PNRSFIESIALSLSLPFINRAAKPSRRALRRVLQELQLPPER 114

Query: 321 LIMVGDRPFTDIVYGNRNGFLTILTEP 241
           + +VGDR  TD++ GNR G +T+L EP
Sbjct: 115 VAIVGDRLLTDVLAGNRLGLVTVLVEP 141



>pir|F75330|F75330 conserved hypothetical protein - Deinococcus
           radiodurans  (strain R1)>gb:AE002035_42215 Deinococcus
           radiodurans R1 section 172 of 229 of the complete
           chromosome 1.>gb:AE000513_883110 Deinococcus radiodurans
           R1 complete chromosome 1.
          Length = 174

 Score = 42.0 bits (97), Expect = 0.026
 Identities = 39/145 (26%), Positives = 59/145 (40%)
 Frame = -3

Query: 672 LVIPHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGN 493
           L+ P   +  +  I    L  RG  G+V D DNTL +PY  + +      I     L G 
Sbjct: 3   LLRPDDLIAHVSQITPEFLAARGLRGLVLDLDNTL-IPY--KSYEDAAEIIAWAADLRGA 59

Query: 492 NIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIM 313
            I ++  S      +   + A      +G   +    K             G  + ++ M
Sbjct: 60  GIRLYLLS------NATAKRAAFWLPKLGFDGVGMAGKPNPRAFRRALEVLGLPAPQVAM 113

Query: 312 VGDRPFTDIVYGNRNGFLTILTEPL 238
           VGD+ FTD++ GN  G  T+L EPL
Sbjct: 114 VGDQLFTDVLGGNLAGMHTVLVEPL 138



>pir|A98071|A98071 conserved hypothetical protein spr1595 [imported]
           - Streptococcus pneumoniae (strain
           R6)>gb:AE008526_237914 Streptococcus pneumoniae R6
           section 142 of 184 of the complete
           genome.>gb:AE007317_944072 Streptococcus pneumoniae R6,
           complete genome.
          Length = 196

 Score = 41.6 bits (96), Expect = 0.033
 Identities = 37/145 (25%), Positives = 65/145 (44%), Gaps = 3/145 (2%)
 Frame = -3

Query: 663 PHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIA 484
           P  AV  +  +    L+ +G + V+ D DNTL    +    P ++  +   +   G  I 
Sbjct: 29  PDFAVEAVYDLTVPSLQAQGIKAVLVDLDNTLIAWNNPDGTPEMKQWLHDLRDA-GIGII 87

Query: 483 VFSNSAGLFEYDPDGRNAKILERAI---GIKVIRHRVKKPAGTAEEIERQFGCESSKLIM 313
           V SN+             K ++RA+   GI  +   +K      +   ++F  +  +++M
Sbjct: 88  VVSNNT-----------KKRVQRAVEKFGIDYVYWALKPFTFGIDRAMKEFHYDKKEVVM 136

Query: 312 VGDRPFTDIVYGNRNGFLTILTEPL 238
           VGD+  TDI   +R G  +IL +PL
Sbjct: 137 VGDQLMTDIRAAHRAGIRSILVKPL 161



>pir|T52063|T52063 ran GTPase-activating protein [imported] -
           alfalfa>gb:AF215731_1777948 Medicago sativa subsp. x
           varia Ran GTPase activating protein mRNA, complete cds.
          Length = 533

 Score = 41.2 bits (95), Expect = 0.044
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 3/84 (3%)
 Frame = -3

Query: 555 SLRLWPPLRSSIEQCKALFGNNI---AVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHR 385
           S++LWPP +S+          N+   ++FS   GL   D   ++AK +E A  +   +H 
Sbjct: 14  SIKLWPPSQSTRLMLVERMVRNLTTPSIFSRKYGLLNKDEAEKDAKEIEDAAFVTASQHF 73

Query: 384 VKKPAGTAEEIERQFGCESSKLIM 313
            K+P G      + +  ESSKL++
Sbjct: 74  EKEPDGDGSSAVQIYAKESSKLML 97



>gb:AE017163_395321 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 3 of 6 of the complete
           genome.>gb:AE017126_1030990 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 170

 Score = 40.4 bits (93), Expect = 0.074
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = -3

Query: 333 ESSKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERAL 181
           E+S++ ++GDR FTDI+ GNR G  TIL + +    +   +  V+ IE++L
Sbjct: 110 ENSQIAIIGDRIFTDILGGNRVGIYTILVKAIGSNGKSKNINYVQFIEKSL 160



>gb:SSP440366_190887 Synechococcus sp. PCC 7942 ORF1, gltX gene, nha
           gene and ORF2, strain PCC 7942.
          Length = 139

 Score = 39.7 bits (91), Expect = 0.13
 Identities = 17/38 (44%), Positives = 26/38 (68%)
 Frame = -3

Query: 345 QFGCESSKLIMVGDRPFTDIVYGNRNGFLTILTEPLSL 232
           + G +  ++ +VGDR FTD++ GNR G  T+L EP+ L
Sbjct: 63  EMGLDLERVGVVGDRLFTDVLAGNRLGVFTVLVEPMVL 100



>gb:AE014267_306962 Streptococcus agalactiae 2603V/R section 77 of
           100 of the complete genome.>gb:AE009948_937075
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 177

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 39/146 (26%), Positives = 59/146 (40%), Gaps = 7/146 (4%)
 Frame = -3

Query: 654 AVPDIRYIDWAELKRRGFEGVVFDKDNTLTV------PYSLRLWPPLRSSIE-QCKALFG 496
           AV D+R  D   L R G   V+ D DNTL           +R W    ++ +     +  
Sbjct: 16  AVYDLRAED---LLRHGIRAVLVDLDNTLIAWNNPDGTAEVRAWLDEMTTADISVVVVSN 72

Query: 495 NNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLI 316
           NN A    +   F  D   R  K   R I + + R                +G +  ++I
Sbjct: 73  NNHARVERAVSRFGVDFVSRAMKPFTRGINMAIER----------------YGFDRDEVI 116

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPL 238
           MVGD+  TDI   +R G  ++L +P+
Sbjct: 117 MVGDQLMTDIRASHRAGIKSVLVKPI 142



>gb:SAG766852_171237 Streptococcus agalactiae NEM316 complete
           genome, segment 10.
          Length = 186

 Score = 39.3 bits (90), Expect = 0.17
 Identities = 39/146 (26%), Positives = 59/146 (40%), Gaps = 7/146 (4%)
 Frame = -3

Query: 654 AVPDIRYIDWAELKRRGFEGVVFDKDNTLTV------PYSLRLWPPLRSSIE-QCKALFG 496
           AV D+R  D   L R G   V+ D DNTL           +R W    ++ +     +  
Sbjct: 25  AVYDLRAED---LLRHGIRAVLVDLDNTLIAWNNPDGTAEVRAWLDEMTTADISVVVVSN 81

Query: 495 NNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLI 316
           NN A    +   F  D   R  K   R I + + R                +G +  ++I
Sbjct: 82  NNHARVERAVSRFGVDFVSRAMKPFTRGINMAIER----------------YGFDRDEVI 125

Query: 315 MVGDRPFTDIVYGNRNGFLTILTEPL 238
           MVGD+  TDI   +R G  ++L +P+
Sbjct: 126 MVGDQLMTDIRASHRAGIKSVLVKPI 151



>gb:BA000031_706722 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 557

 Score = 38.9 bits (89), Expect = 0.22
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 8/72 (11%)
 Frame = -3

Query: 768 NMWWADMKAALGQRINVEGLTSSLGIFAKNKHLVIPHIAVPDIRY--------IDWAELK 613
           N W +++K      I VE  TSS+      ++L +  +A+  + Y        + WA++K
Sbjct: 451 NAWASELKDVSNNPIGVEFATSSVSSPGLEEYLALDPVAIAQMEYTLPHLVSELKWADIK 510

Query: 612 RRGFEGVVFDKD 577
           +RGF  V F  D
Sbjct: 511 QRGFMRVTFTAD 522



>gb:BA000039_726279 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 179

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 17/29 (58%), Positives = 22/29 (75%)
 Frame = -3

Query: 324 KLIMVGDRPFTDIVYGNRNGFLTILTEPL 238
           ++ MVGDR FTDI+ GNR G  TIL +P+
Sbjct: 117 QVAMVGDRLFTDILAGNRLGMFTILVQPV 145



>gb:AL935256_551325 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 5/11.
          Length = 176

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 37/142 (26%), Positives = 64/142 (45%)
 Frame = -3

Query: 663 PHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIA 484
           P   +P I  +  A+L+ +G + V  D DNTL    +    P L+  +   +   G  + 
Sbjct: 7   PTWMIPAIYNVTPAQLRAQGIKAVFTDLDNTLIAWDNPDGTPELKKWLHALQDA-GIPLV 65

Query: 483 VFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGD 304
           V SN++       + R AK L+      V R     P G ++      G   ++++MVGD
Sbjct: 66  VVSNNS-------EARIAKALQSLELPFVSRSLKPLPLGISKA-RHDLGLHKNEVVMVGD 117

Query: 303 RPFTDIVYGNRNGFLTILTEPL 238
           +  TD+   +  G  +IL +P+
Sbjct: 118 QYITDMWAAHLAGVPSILVQPI 139



>pir|E86902|E86902 hypothetical protein yxaC [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006450_219123 Lactococcus lactis subsp.
           lactis IL1403 section 212 of 218 of the complete
           genome.>gb:AE005176_1096196 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 175

 Score = 38.1 bits (87), Expect = 0.37
 Identities = 45/173 (26%), Positives = 75/173 (43%)
 Frame = -3

Query: 663 PHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIA 484
           P   V  +  +D   L+      V+ D DNTL    +    P L + +   +   G  + 
Sbjct: 8   PDYLVEAVYQLDPKRLQALNVRAVMVDLDNTLIAWDNPDGTPELLAWLLDMREN-GLKVV 66

Query: 483 VFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGD 304
           V SN+          R A+ +E+  G++ I   +K  A   ++  R        +IMVGD
Sbjct: 67  VVSNNK-------QARVARAVEK-FGVQYIWRAMKPFAWGIKKALRLLDERPENVIMVGD 118

Query: 303 RPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKGVEPI 145
           +  TDI   +R G  +IL +PL +A + +  Q  R  ER +  +   +  EP+
Sbjct: 119 QLMTDIRAAHRAGVRSILVKPL-VASDSWSTQVNRWRERRVWKKLIARDGEPV 170



>gb:AE015007_314100 Streptococcus mutans UA159 section 155 of 185 of
           the complete genome.>gb:AE014133_941101 Streptococcus
           mutans UA159 complete genome.
          Length = 175

 Score = 37.7 bits (86), Expect = 0.48
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 1/128 (0%)
 Frame = -3

Query: 618 LKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPDG 439
           L++ G + V+ D DNTL         P LR  ++         + V +NS    +    G
Sbjct: 23  LRKHGIKAVLVDLDNTLIAWDHPDGTPQLRDWLDSMTEADMPVVVVSNNSYTRVKRAVKG 82

Query: 438 RNAKILERAIGIKVIRHRVKKPAGTAEEIE-RQFGCESSKLIMVGDRPFTDIVYGNRNGF 262
            +   + RA+          KP      +   ++G    +++MVGD+  TDI   +R G 
Sbjct: 83  FHVDFVSRAL----------KPFSRGINMAVNRYGFSKDEVVMVGDQLMTDIRAAHRAGV 132

Query: 261 LTILTEPL 238
            +IL +PL
Sbjct: 133 KSILVKPL 140



>gb:CP000033_89766 Lactobacillus acidophilus NCFM, complete genome.
          Length = 174

 Score = 37.7 bits (86), Expect = 0.48
 Identities = 36/142 (25%), Positives = 58/142 (40%)
 Frame = -3

Query: 663 PHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIA 484
           P   +  I  +D  +L   G + V  D DNTL        W    ++ E  K      +A
Sbjct: 5   PKYTIDTIYNLDPRKLNEMGIKAVFSDLDNTLLA------WNKFETAKEMDK--LNKKLA 56

Query: 483 VFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGD 304
             +    +   +   R  K+L       V + R   P     + E + G   ++++MVGD
Sbjct: 57  KANIKLVVISNNNAERVGKVLNPYHIDFVAKARKPLPFAITRKRE-EMGLNKNQVMMVGD 115

Query: 303 RPFTDIVYGNRNGFLTILTEPL 238
           +  TD+  GN  G  T+L +PL
Sbjct: 116 QLITDMQAGNLAGVETVLVKPL 137



>sp|Q8VD52|PLPP_RAT Pyridoxal phosphate phosphatase (EC 3.1.3.-)
           (Reg I binding protein 1)
           (Fragment).>gb:AF318578_2062770 Rattus norvegicus reg I
           binding protein I (Rbp1) mRNA, partial cds.
          Length = 204

 Score = 37.7 bits (86), Expect = 0.48
 Identities = 16/36 (44%), Positives = 25/36 (69%)
 Frame = -3

Query: 354 IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           I   F  + ++++MVGDR  TDI++G+R G  T+LT
Sbjct: 113 ITEDFSVDPARMLMVGDRLETDILFGHRCGMTTVLT 148



>pir|AD1261|AD1261 hypothetical protein lmo1492 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AE017327_443937
           Listeria monocytogenes str. 4b F2365, section 6 of 10 of
           the complete genome.>gb:AL591979_535983 Listeria
           monocytogenes strain EGD, complete genome, segment
           7/12.>gb:AE017262_1076293 Listeria monocytogenes str. 4b
           F2365, complete genome.
          Length = 173

 Score = 37.4 bits (85), Expect = 0.63
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 6/135 (4%)
 Frame = -3

Query: 624 AELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF-----GNNIAVFSNSAGL 460
           A+L++ G   ++ D DNTL        W  L ++ E           G  + +FSN+   
Sbjct: 20  AQLRKMGKTTILTDLDNTLLA------WDQLDATDEVINWFTILKEEGIKVMIFSNNN-- 71

Query: 459 FEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIE-RQFGCESSKLIMVGDRPFTDIV 283
                + R A++  +AI +  +  R KKP G       ++      + +M+GD+  TDI 
Sbjct: 72  -----EERVARVA-KAIDVPYLA-RAKKPLGANFRWALKEMDATPEETVMIGDQIMTDIF 124

Query: 282 YGNRNGFLTILTEPL 238
            GNR    TI   P+
Sbjct: 125 GGNRQKLTTIFVRPV 139



>gb:BC009756_1972233 Homo sapiens pyridoxal (pyridoxine, vitamin B6)
           phosphatase, mRNA (cDNA clone IMAGE:3840432), partial
           cds.
          Length = 176

 Score = 37.0 bits (84), Expect = 0.82
 Identities = 17/38 (44%), Positives = 25/38 (65%)
 Frame = -3

Query: 360 EEIERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           E I   F  + ++ +MVGDR  TDI++G+R G  T+LT
Sbjct: 100 ECITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLT 137



>gb:AK126873_1916500 Homo sapiens cDNA FLJ44925 fis, clone
           BRAMY3014613, highly similar to Homo sapiens SH3-domain
           binding protein 1 (SH3BP1).
          Length = 605

 Score = 37.0 bits (84), Expect = 0.82
 Identities = 17/38 (44%), Positives = 25/38 (65%)
 Frame = -3

Query: 360 EEIERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           E I   F  + ++ +MVGDR  TDI++G+R G  T+LT
Sbjct: 529 ECITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLT 566



>gb:CP000023_875473 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_877400 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 175

 Score = 37.0 bits (84), Expect = 0.82
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 2/130 (1%)
 Frame = -3

Query: 621 ELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPD 442
           +L+  G   V+ D DNTL    +    P LR+ +++        + V +N     E    
Sbjct: 22  QLREHGIRTVLVDLDNTLIAWNNPDGTPELRAWLDEMTEADIPVVVVSNNKHKRVERAVA 81

Query: 441 GRNAKILERAIGIKVIRHRVKKP--AGTAEEIERQFGCESSKLIMVGDRPFTDIVYGNRN 268
             +   + RA+          KP   G  E IER +     +++MVGD+  TDI   +R 
Sbjct: 82  NFHVDFVSRAM----------KPFTKGINEAIER-YHFNREEVVMVGDQLMTDIRASHRA 130

Query: 267 GFLTILTEPL 238
           G  +IL +PL
Sbjct: 131 GIRSILVKPL 140



>gb:AY596297_631977 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 264

 Score = 37.0 bits (84), Expect = 0.82
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = -3

Query: 486 AVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIE-RQFGCESSKLIMV 310
           A+ +  AG+ E DPD        R +G         KP+  A +    +  C  ++ +++
Sbjct: 165 AIINAVAGVIERDPD--------RILG---------KPSEIAVQAALERLDCAPTECVII 207

Query: 309 GDRPFTDIVYGNRNGFLTIL 250
           GDR  TDI  G RNG  T+L
Sbjct: 208 GDRLETDIAMGERNGMTTVL 227



>sp|Q96GD0|PLPP_HUMAN Pyridoxal phosphate phosphatase (EC
           3.1.3.-).>gb:AY125047_1936721 Homo sapiens pyridoxal
           phosphate phosphatase mRNA, complete
           cds.>gb:BC000320_1966611 Homo sapiens pyridoxal
           (pyridoxine, vitamin B6) phosphatase, mRNA (cDNA clone
           MGC:8472 IMAGE:2821743), complete
           cds.>gb:BC064922_1986659 Homo sapiens pyridoxal
           (pyridoxine, vitamin B6) phosphatase, mRNA (cDNA clone
           MGC:74719 IMAGE:6141538), complete
           cds.>gb:HS37E16_1998361 Human DNA sequence from clone
           RP1-37E16 on chromosome 22 Contains the 3' part of the
           gene for a novel VHS domain containing protein similar
           to predicted worm and human proteins, the SH3BP1 gene
           for SH3-domain binding protein 1, the gene for a novel
           protein similar to nitrophenylphosphatases from various
           organisms, the LGALS1 gene for soluble
           galactoside-binding lectin 1, a novel gene and the gene
           for a novel protein similar to mouse RIP3 (P116
           Rho-interacting protein) and rat RB109, complete
           sequence.
          Length = 296

 Score = 37.0 bits (84), Expect = 0.82
 Identities = 17/38 (44%), Positives = 25/38 (65%)
 Frame = -3

Query: 360 EEIERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           E I   F  + ++ +MVGDR  TDI++G+R G  T+LT
Sbjct: 220 ECITENFSIDPARTLMVGDRLETDILFGHRCGMTTVLT 257



>gb:BC069982_2106233 Mus musculus pyridoxal (pyridoxine, vitamin B6)
           phosphatase, mRNA (cDNA clone IMAGE:6334928), partial
           cds.
          Length = 233

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -3

Query: 354 IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           I   F  + ++ +MVGDR  TDI++G+R G  T+LT
Sbjct: 159 ITEDFSVDPARTLMVGDRLETDILFGHRCGMTTVLT 194



>gb:BC058388_2103194 Mus musculus pyridoxal (pyridoxine, vitamin B6)
           phosphatase, mRNA (cDNA clone IMAGE:5717111), partial
           cds.
          Length = 157

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -3

Query: 354 IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           I   F  + ++ +MVGDR  TDI++G+R G  T+LT
Sbjct: 83  ITEDFSVDPARTLMVGDRLETDILFGHRCGMTTVLT 118



>gb:BC037010_2097938 Mus musculus pyridoxal (pyridoxine, vitamin B6)
           phosphatase, mRNA (cDNA clone IMAGE:5322747), partial
           cds.
          Length = 117

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -3

Query: 354 IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           I   F  + ++ +MVGDR  TDI++G+R G  T+LT
Sbjct: 43  ITEDFSVDPARTLMVGDRLETDILFGHRCGMTTVLT 78



>sp|P60487|PLPP_MOUSE Pyridoxal phosphate phosphatase (EC
           3.1.3.-).>gb:AY366300_2084119 Mus musculus pyridoxal
           phosphate phosphatase mRNA, complete cds.
          Length = 292

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -3

Query: 354 IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           I   F  + ++ +MVGDR  TDI++G+R G  T+LT
Sbjct: 218 ITEDFSVDPARTLMVGDRLETDILFGHRCGMTTVLT 253



>gb:BT005294_1638234 Arabidopsis thaliana At5g47760 mRNA, complete
           cds.>gb:AK118640_1816606 Arabidopsis thaliana At5g47760
           mRNA for putative 4-nitrophenylphosphatase, complete
           cds, clone: RAFL19-90-G08.
          Length = 301

 Score = 36.2 bits (82), Expect = 1.4
 Identities = 16/33 (48%), Positives = 24/33 (72%)
 Frame = -3

Query: 348 RQFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL 250
           ++FG E+S++ MVGDR  TDI++G   G  T+L
Sbjct: 232 QKFGTETSRMCMVGDRLDTDILFGQNAGCKTLL 264



>gb:AY087611_1572641 Arabidopsis thaliana clone 37055 mRNA, complete
           sequence.
          Length = 301

 Score = 36.2 bits (82), Expect = 1.4
 Identities = 16/33 (48%), Positives = 24/33 (72%)
 Frame = -3

Query: 348 RQFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL 250
           ++FG E+S++ MVGDR  TDI++G   G  T+L
Sbjct: 232 QKFGTETSRMCMVGDRLDTDILFGQNAGCKTLL 264



>gb:AB016886_1513134 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCA23.
          Length = 311

 Score = 36.2 bits (82), Expect = 1.4
 Identities = 16/33 (48%), Positives = 24/33 (72%)
 Frame = -3

Query: 348 RQFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL 250
           ++FG E+S++ MVGDR  TDI++G   G  T+L
Sbjct: 232 QKFGTETSRMCMVGDRLDTDILFGQNAGCKTLL 264



>pir|AF1623|AF1623 hypothetical protein homolog lin1527 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596168_538872
           Listeria innocua Clip11262 complete genome, segment
           6/12.
          Length = 173

 Score = 36.2 bits (82), Expect = 1.4
 Identities = 35/134 (26%), Positives = 58/134 (43%), Gaps = 6/134 (4%)
 Frame = -3

Query: 621 ELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALF-----GNNIAVFSNSAGLF 457
           +L++ G   ++ D DNTL        W  L ++ E           G  + +FSN+    
Sbjct: 21  QLRKMGKTTILTDLDNTLLA------WDQLDATDEVINWFTILKEEGIKVMIFSNNN--- 71

Query: 456 EYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIE-RQFGCESSKLIMVGDRPFTDIVY 280
               + R A++  +AI +  +  R KKP G       ++      + +M+GD+  TDI  
Sbjct: 72  ----EERVARVA-KAIDVPYLA-RAKKPLGANFRWALKEMNATPEETVMIGDQIMTDIFG 125

Query: 279 GNRNGFLTILTEPL 238
           GNR    TI   P+
Sbjct: 126 GNRQKLTTIFVRPV 139



>pir|A72409|A72409 conserved hypothetical protein - Thermotoga
           maritima (strain MSB8)>gb:AE001702_38092 Thermotoga
           maritima MSB8 section 14 of 136 of the complete
           genome.>gb:AE000512_1112565 Thermotoga maritima MSB8,
           complete genome.
          Length = 151

 Score = 36.2 bits (82), Expect = 1.4
 Identities = 40/162 (24%), Positives = 69/162 (42%), Gaps = 5/162 (3%)
 Frame = -3

Query: 651 VPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSN 472
           V  +  ID+  L + G+    FD DNTL VP+         S +E+ K      +A  + 
Sbjct: 6   VERVEDIDFEGLLKEGYTCFFFDFDNTL-VPWK-------ESKLEESKRRLLIELAKKAR 57

Query: 471 SAGLFEYDPDGRNAKIL-----ERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVG 307
              +    P   +  ++      +   +K+ R   K+              +  + +M+G
Sbjct: 58  VVVVSNGKPRKVDLPVMFIWRAGKPFSLKLWRFLKKEKI------------DPKRCVMIG 105

Query: 306 DRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERAL 181
           D+ FTD++ G   GF  I  EP+S A+E F  + +R  E+ L
Sbjct: 106 DQIFTDVLTGKIFGFRVIKVEPIS-AKEFFGTKILRFFEKIL 146



>gb:AP002029_1821452 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F24C7.
          Length = 289

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
 Frame = -3

Query: 345 QFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL----TEPLSLAEEP 220
           +FG + S++ MVGDR  TDI++G   G  T+L       +S+ E P
Sbjct: 220 KFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSISMLESP 265



>gb:AK117908_1815915 Arabidopsis thaliana At5g36790 mRNA for
           putative p-nitrophenylphosphatase, complete cds, clone:
           RAFL19-09-D04.
          Length = 309

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
 Frame = -3

Query: 345 QFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL----TEPLSLAEEP 220
           +FG + S++ MVGDR  TDI++G   G  T+L       +S+ E P
Sbjct: 240 KFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSISMLESP 285



>gb:AC098833_1736916 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1288_A07, complete sequence.
          Length = 544

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
 Frame = -3

Query: 558 YSLRLWPPLRSSIEQCKALFGNNIA---VFSNSAGLFEYDPDGRNAKILERAIGIKVIRH 388
           +S++LWPP  S+          N++   +FS   GL   +    NAK +E         H
Sbjct: 13  FSIKLWPPSESTRLMLVERMTKNLSTESIFSRKYGLLGKEEAHDNAKRIEEVCFASADEH 72

Query: 387 RVKKPAGTAEEIERQFGCESSKLIM 313
             ++P G      + +  E+SKL++
Sbjct: 73  FKEEPDGDGSSAVQLYAKETSKLML 97



>gb:AY094446_1575745 Arabidopsis thaliana AT5g36790/f5h8_20 mRNA,
           complete cds.>gb:AY122899_1579777 Arabidopsis thaliana
           AT5g36790/f5h8_20 mRNA, complete cds.
          Length = 362

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
 Frame = -3

Query: 345 QFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL----TEPLSLAEEP 220
           +FG + S++ MVGDR  TDI++G   G  T+L       +S+ E P
Sbjct: 293 KFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSISMLESP 338



>gb:AY596298_634945 Haloarcula marismortui ATCC 43049 chromosome II,
           complete sequence.
          Length = 262

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 21/51 (41%), Positives = 26/51 (50%), Gaps = 5/51 (9%)
 Frame = -3

Query: 339 GCESSKLIMVGDRPFTDIVYGNRNGFLTIL-----TEPLSLAEEPFIVQQV 202
           G E  + +M+GDR  TDI  GN+ G  T+L     T P  LAE   I   V
Sbjct: 198 GGEPDRCLMIGDRLGTDIRMGNQAGMETVLPLTGVTSPADLAESDVIADHV 248



>pir|T52067|T52067 hypothetical protein [imported] -
           rice>gb:AF111710_1768981 Oryza sativa subsp. indica
           putative dnaJ-like protein, putative myb-related
           protein, putative farnesyl pyrophosphate synthase, and
           hypothetical protein genes, complete cds.
          Length = 789

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
 Frame = -3

Query: 558 YSLRLWPPLRSSIEQCKALFGNNIA---VFSNSAGLFEYDPDGRNAKILERAIGIKVIRH 388
           +S++LWPP  S+          N++   +FS   GL   +    NAK +E         H
Sbjct: 13  FSIKLWPPSESTRLMLVERMTKNLSTESIFSRKYGLLGKEEAHDNAKRIEEVCFASADEH 72

Query: 387 RVKKPAGTAEEIERQFGCESSKLIM 313
             ++P G      + +  E+SKL++
Sbjct: 73  FKEEPDGDGSSAVQLYAKETSKLML 97



>pir|D84229|D84229 unknown L-arabinose operon protein [imported] -
           Halobacterium sp. NRC-1>gb:AE005016_62360 Halobacterium
           sp. NRC-1 section 47 of 170 of the complete
           genome.>gb:AE004437_887279 Halobacterium sp. NRC-1
           complete genome.
          Length = 288

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
 Frame = -3

Query: 444 DGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQF-GCESSKLIMVGDRPFTDIVYGNRN 268
           +G   + L+R +G         KP+  A E      G   ++ +MVGDR  TDI  GNR 
Sbjct: 196 EGATGRSLDRVLG---------KPSPVAVEAATDLLGVPLARCVMVGDRIETDIEMGNRA 246

Query: 267 GFLTIL 250
           G  T+L
Sbjct: 247 GMTTVL 252



>gb:AB011819_2157050 Clover yellow vein virus genomic RNA for
           polyprotein, complete cds.
          Length = 3072

 Score = 35.0 bits (79), Expect = 3.1
 Identities = 16/61 (26%), Positives = 33/61 (54%)
 Frame = -3

Query: 297 FTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQWSVKGVEPISHELLPDCE 118
           F D+V+  R G  T++ +P  L EE    +    ++R +  +W+++ ++P +   +PD  
Sbjct: 71  FGDMVFKTRRGITTMVPKPARLVEEE--KRAAEALKRFMEVEWTLEEIDPDAEYQVPDLR 128

Query: 117 Q 115
           Q
Sbjct: 129 Q 129



>gb:OSJN00051_1693924 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K20, complete
           sequence.>gb:OSJN00261_1697572 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0076N16, complete
           sequence.
          Length = 365

 Score = 35.0 bits (79), Expect = 3.1
 Identities = 15/35 (42%), Positives = 24/35 (68%)
 Frame = -3

Query: 354 IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL 250
           + ++FG  +S++ MVGDR  TDI++G   G  T+L
Sbjct: 293 LAKKFGITTSQICMVGDRLDTDILFGQNGGCKTLL 327



>gb:AF322012S1_499979 Bradyrhizobium japonicum symbiotic gene
           region, part 1 of 2.>gb:BA000040_730154 Bradyrhizobium
           japonicum USDA 110 DNA, complete genome.
          Length = 275

 Score = 35.0 bits (79), Expect = 3.1
 Identities = 46/152 (30%), Positives = 59/152 (38%), Gaps = 8/152 (5%)
 Frame = -3

Query: 621 ELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFEYDPD 442
           E+  R  E VV   D  +T    LR+      SI       G N  +   +A  FE    
Sbjct: 117 EVTDRAPEAVVMGLDRDITHE-KLRI---AVESILNGAVFIGTNPDLLLPTASGFE---P 169

Query: 441 GRNAKILERAIGIKVIRHRVKKP-AGTAEEIERQFGCESSKLIMVGDRPFTDIVYGNRNG 265
           G  A I   A   +V    V KP     E    + G +    IM+GD+  TDI  G R G
Sbjct: 170 GAGATIAAVAAATQVRPSIVGKPQVPMIETALSRLGTKRGSTIMIGDQVPTDIQAGKRAG 229

Query: 264 FLTILT-------EPLSLAEEPFIVQQVRVIE 190
             T+L        +  SL    FIV  +R IE
Sbjct: 230 LATVLVTTGVPTRQDPSLMAPDFIVSSLREIE 261



>gb:AP005592_1854628 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0638A12.>gb:AP006157_1861026 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:B1077E10.
          Length = 303

 Score = 34.7 bits (78), Expect = 4.1
 Identities = 15/33 (45%), Positives = 22/33 (66%)
 Frame = -3

Query: 348 RQFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL 250
           + F  E+S++ MVGDR  TDI++G   G  T+L
Sbjct: 235 KSFNLETSRMCMVGDRLDTDILFGQNTGCKTLL 267



>gb:AP003243_1826113 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0415C01.
          Length = 160

 Score = 34.7 bits (78), Expect = 4.1
 Identities = 22/70 (31%), Positives = 35/70 (50%)
 Frame = -3

Query: 1008 PVPSRFTSPPHSLPFPIRLSRLTLSAAATTHSCSTEHEKQKHPRNPEDPDRENPVFPQDY 829
            P P R  +PPH+LP P+R++   L   ++ H+ +T    ++   +P      NP   Q  
Sbjct: 46   PSPRRCFAPPHALPPPLRITPPLLD-YSSHHTDATSQHGRRFSFSPSGV--RNPAGVQYP 102

Query: 828  YEDGDGEPER 799
            + DGDG   R
Sbjct: 103  HGDGDGRKPR 112



>gb:AB025605_1516276 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F5H8.
          Length = 389

 Score = 34.7 bits (78), Expect = 4.1
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = -3

Query: 345 QFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL 250
           +FG + S++ MVGDR  TDI++G   G  T+L
Sbjct: 293 KFGIQKSQICMVGDRLDTDILFGQNGGCKTLL 324



>gb:BC060400_2552868 Xenopus laevis hypothetical protein MGC68532,
           mRNA (cDNA clone MGC:68532 IMAGE:4031000), complete cds.
          Length = 546

 Score = 34.3 bits (77), Expect = 5.3
 Identities = 32/109 (29%), Positives = 48/109 (44%)
 Frame = -3

Query: 525 SIEQCKALFGNNIAVFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIER 346
           SIEQ K L G  +    N  G F  D DG ++ + E  I    +   + K   T ++++ 
Sbjct: 134 SIEQAKRLLGQIVDRCRNGPG-FHNDMDG-SSTVQEILIPASKVGLVIGKGGETIKQLQE 191

Query: 345 QFGCESSKLIMVGDRPFTDIVYGNRNGFLTILTEPLSLAEEPFIVQQVR 199
           + G    K+IM+ D P             T   +PL +  +PF VQQ R
Sbjct: 192 RTGV---KMIMIQDGPLP-----------TGADKPLRITGDPFKVQQAR 226



>pir|AD2244|AD2244 hypothetical protein alr3507 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684496 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 194

 Score = 34.3 bits (77), Expect = 5.3
 Identities = 31/123 (25%), Positives = 46/123 (37%)
 Frame = -3

Query: 633 IDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIAVFSNSAGLFE 454
           IDW  LK  G  GV+ D DNT+       L P     I + K L G  + + SN    + 
Sbjct: 35  IDW--LKNAGIRGVILDLDNTIISEDDRYLAPWAEDWIAEAK-LAGLKLFILSNGKRRY- 90

Query: 453 YDPDGRNAKILERAIGIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDRPFTDIVYGN 274
                   K     + I  I    K       +   Q    S  ++++GD   TD++   
Sbjct: 91  ------RVKYWSHRLDINAISPAKKPFPSAFRKAMTQMRLSSKNVLVIGDSLHTDVMGAK 144

Query: 273 RNG 265
            +G
Sbjct: 145 FSG 147



>gb:AF539862_1280297 Hydra vulgaris nematocyst outer wall antigen
           precursor (NOWA) mRNA, complete cds.
          Length = 774

 Score = 33.9 bits (76), Expect = 7.0
 Identities = 33/114 (28%), Positives = 46/114 (40%), Gaps = 20/114 (17%)
 Frame = +3

Query: 480 KPQCCCQTEL-----------CTALWTISEAATSAKSKEQLKYCPYRRPHLQSPFSSAQP 626
           KP CC Q  L           C+       +  S+ S+   +  PY+ P + S     QP
Sbjct: 482 KPGCCGQVNLNAPVQPSGYTACSQYPNCGLSCQSSCSQSCCQQNPYQ-PSVMSGTIVIQP 540

Query: 627 NQ---------CTLYPAQRYVGSPNACF*QKSPEKK*DPPR*SSAPMQPSCLPT 761
           N+         C+ + A R   SP  C  Q+S      PP+ S+ P  PSC PT
Sbjct: 541 NEQSVCPQHPGCSQHCAPRC--SPQCC--QQSMNSLYQPPQMSACPQFPSCSPT 590



>gb:BA000030_699999 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 416

 Score = 33.9 bits (76), Expect = 7.0
 Identities = 23/74 (31%), Positives = 32/74 (43%), Gaps = 5/74 (6%)
 Frame = -3

Query: 963 PIRLSRLTLSAAATTHSCSTEHE----KQKHPRNPEDPDRENPVFP-QDYYEDGDGEPER 799
           P R+S +     A      T+ +    +   P  P DPD   P+ P +D +ED DGE + 
Sbjct: 334 PNRISLVDAQVNARDIGACTQRDLSFVRPPQPDEPVDPDWR-PIDPLRDRFEDPDGETDA 392

Query: 798 RFENPLVFLTNMWW 757
           R   P    T  WW
Sbjct: 393 RLPWPTDHTTLYWW 406



>gb:BA000026_693995 Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 199

 Score = 33.9 bits (76), Expect = 7.0
 Identities = 39/144 (27%), Positives = 60/144 (41%), Gaps = 1/144 (0%)
 Frame = -3

Query: 663 PHIAVPDIRYIDWAELKRRGFEGVVFDKDNTLTVPYSLRLWPPLRSSIEQCKALFGNNIA 484
           P++ V DI  I+   L+    + +V D DNTL VPY  R                G +I 
Sbjct: 14  PNLFVRDISEINLESLRISDIKLIVCDLDNTL-VPYFTRYPNKFAFDFINKAKQMGFSIL 72

Query: 483 VFSNSAGLFEYDPDGRNAKILERAIGIKVIRHRVKKP-AGTAEEIERQFGCESSKLIMVG 307
           + SN+             K LE    I+      KKP A    +  ++ G    + + +G
Sbjct: 73  IASNNTK----KRVSTFVKKLEETSSIEGHLWSCKKPVAFKIIKWIKENGFSFDQTVFIG 128

Query: 306 DRPFTDIVYGNRNGFLTILTEPLS 235
           D+  TD++  NR    +IL  PL+
Sbjct: 129 DQFLTDVLLANRVKSKSILVFPLT 152



>pir|A38660|B38346 ultra-high-sulfur keratin 2 -
           mouse>gb:MUSSER2_2129995 Mouse serine 2 ultra high
           sulfur protein gene, complete cds.
          Length = 223

 Score = 20.4 bits (41), Expect(7) = 7.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 489 CCCQTELC 512
           CCCQ+  C
Sbjct: 207 CCCQSSCC 214



 Score = 20.4 bits (41), Expect(7) = 7.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 489 CCCQTELC 512
           CCCQ+  C
Sbjct: 197 CCCQSSCC 204



 Score = 20.4 bits (41), Expect(7) = 7.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 489 CCCQTELC 512
           CCCQ+  C
Sbjct: 187 CCCQSSCC 194



 Score = 20.4 bits (41), Expect(7) = 7.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 489 CCCQTELC 512
           CCCQ+  C
Sbjct: 177 CCCQSSCC 184



 Score = 20.4 bits (41), Expect(7) = 7.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 489 CCCQTELC 512
           CCCQ+  C
Sbjct: 139 CCCQSSCC 146



 Score = 20.4 bits (41), Expect(7) = 7.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 489 CCCQTELC 512
           CCCQ+  C
Sbjct: 111 CCCQSSCC 118



 Score = 20.4 bits (41), Expect(7) = 7.7
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = +3

Query: 489 CCCQTELC 512
           CCCQ+  C
Sbjct: 83  CCCQSSCC 90



>gb:AY391472_2531608 Danio rerio 1700012G19-like protein mRNA,
           complete cds.>gb:BC045860_2549379 Danio rerio zgc:56011,
           mRNA (cDNA clone MGC:56011 IMAGE:3819817), complete cds.
          Length = 306

 Score = 33.5 bits (75), Expect = 9.1
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 1/47 (2%)
 Frame = -3

Query: 384 VKKPAGTAEE-IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTILT 247
           V KP+    E +  QF  +  + +MVGDR  TDI+ G+  G  T+LT
Sbjct: 218 VGKPSNFMFECVASQFNLKPQRCLMVGDRLDTDIMLGSNCGLKTLLT 264



>gb:AP005260_1849770 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0557D09.
          Length = 1342

 Score = 33.5 bits (75), Expect = 9.1
 Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 1/96 (1%)
 Frame = -3

Query: 585  DKDNTLTVPYSLRLWPPL-RSSIEQCKALFGNNIAVFSNSAGLFEYDPDGRNAKILERAI 409
            D+DNT+TV YS   +P L ++ I +C  +  NN+ V +  AG       G+  + L  A 
Sbjct: 763  DEDNTMTV-YSSSQFPELAQNVISKCLGIPFNNVRVITRRAG---GGFGGKAVRSLHIAT 818

Query: 408  GIKVIRHRVKKPAGTAEEIERQFGCESSKLIMVGDR 301
               +  H +++P        R +   ++ +IMVG R
Sbjct: 819  AAALCAHTLRRPV-------RMYLNRNTDMIMVGGR 847



>gb:AE016942_363166 Bacteroides thetaiotaomicron VPI-5482, section
           17 of 21 of the complete genome.>gb:AE015928_989654
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 1333

 Score = 33.5 bits (75), Expect = 9.1
 Identities = 35/116 (30%), Positives = 51/116 (43%), Gaps = 4/116 (3%)
 Frame = -3

Query: 507 ALFGNNIAVFSNSAGLFEYDPDGRNAKILERAI---GIKVIRHRVKKPAGTAEEIERQFG 337
           ALF +    F N+  L  ++P+  NA      +   G++V  H    P GT E+I  Q  
Sbjct: 607 ALFSDKTLFFGNNQSLTYFNPEDINAYPTNGRVLITGLEVDNH----PVGTGEKINNQ-- 660

Query: 336 CESSKLIMVGDRPFTD-IVYGNRNGFLTILTEPLSLAEEPFIVQQVRVIERALVYQ 172
                +I+    PFTD IV  N N   ++    LS ++E     Q +   R L YQ
Sbjct: 661 -----IILNQFIPFTDRIVLDNDNKDFSLTFNNLSYSDE-----QQKYNYRLLPYQ 706



>pir|E72218|E72218 hypothetical protein TM1742 - Thermotoga maritima
           (strain MSB8)>gb:AE001812_39635 Thermotoga maritima MSB8
           section 124 of 136 of the complete
           genome.>gb:AE000512_1114108 Thermotoga maritima MSB8,
           complete genome.
          Length = 259

 Score = 33.5 bits (75), Expect = 9.1
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = -3

Query: 354 IERQFGCESSKLIMVGDRPFTDIVYGNRNGFLTIL 250
           I  +FG    ++ MVGDR +TD+  G   G ++IL
Sbjct: 192 ISEKFGVPKERMAMVGDRLYTDVKLGKNAGIVSIL 226


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,259,972,144
Number of Sequences: 1806583
Number of extensions: 26680909
Number of successful extensions: 78565
Number of sequences better than 10.0: 93
Number of HSP's better than 10.0 without gapping: 75059
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 78497
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 99399905388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)