BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12299
         (785 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T06628|T06628 hypothetical protein T20K18.50 - Arabidopsis t...   338   5e-92   Arabidopsis thaliana [mouse-ear cress]
pir|G84455|G84455 hypothetical protein At2g04280 [imported] - Ar...   338   7e-92   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1022901 Oryza sativa (japonica cultivar-group) chrom...   308   1e-82   
pir|F85088|F85088 hypothetical protein AT4g08810 [imported] - Ar...   256   3e-67   Arabidopsis thaliana [mouse-ear cress]
gb:AP004334_1840383 Oryza sativa (japonica cultivar-group) genom...   241   9e-63   
gb:AP003232_1825828 Oryza sativa (japonica cultivar-group) genom...   145   8e-34   
gb:AY102558_1577787 Arabidopsis thaliana hypothetical protein (A...    65   1e-09   
pir|T02104|T02104 hypothetical protein At2g41150 [imported] - Ar...    65   1e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AP004671_1843080 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
pir|T51263|T51263 hypothetical protein T8M16_80 - Arabidopsis th...    63   7e-09   Arabidopsis thaliana [mouse-ear cress]
gb:BT002919_1636509 Arabidopsis thaliana clone RAFL15-04-D21 (R2...    37   0.42    
gb:AB017064_1513362 Arabidopsis thaliana genomic DNA, chromosome...    37   0.42    
gb:SCHAP4_1708431 Yeast HAP4 gene for HAP4 transcriptional activ...    35   1.6     
sp|P14064|HAP4_YEAST|HAP4_YEAST Transcriptional activator HAP4.>pir|S37936|...    35   1.6     Saccharomyces cerevisiae [brewer's yeast]
gb:AY446894_2345460 Human herpesvirus 5 strain Merlin, complete ...    34   2.7     
gb:AF378666_1266769 Heliothis virescens 110 kDa aminopeptidase m...    34   3.5     
sp|Q973C8|SYT_SULTO|SYT_SULTO Threonyl-tRNA synthetase (EC 6.1.1.3) (Threo...    34   3.5     Sulfurisphaera tokodaii
sp|Q8MI28|LBN_BOVIN|LBN_BOVIN Limbin.>gb:AB083065_1409265 Bos taurus LBN m...    33   4.6     Bos taurus [bovine]
gb:CR380948_1649308 Candida glabrata strain CBS138 chromosome B ...    33   6.0     
gb:AE014188_968072 Plasmodium falciparum 3D7 chromosome 12, comp...    33   6.0     
gb:AE017199_403040 Nanoarchaeum equitans Kin4-M, complete genome.      33   6.0     
gb:AE017176_397379 Porphyromonas gingivalis W83 section 5 of 8 o...    33   6.0     
pir|A86878|A86878 non-heme iron-binding ferritin [imported] - La...    33   6.0     Lactococcus lactis subsp. lactis
gb:CR380955_1651733 Candida glabrata strain CBS138 chromosome I ...    33   7.8     
gb:BX842648_823978 Bdellovibrio bacteriovorus complete genome, s...    33   7.8     
gb:AF319533_499489 Neisseria meningitidis strain 6083 PqiA (pqiA...    33   7.8     
gb:CR522870_99812 Desulfotalea psychrophila LSv54 chromosome.          33   7.8     


>pir|T06628|T06628 hypothetical protein T20K18.50 - Arabidopsis
           thaliana>gb:ATCHRIV34_1545034 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           34.>gb:ATT20K18_1555007 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T20K18 (ESSA
           project).>gb:BT010366_1640312 Arabidopsis thaliana
           At4g12700 mRNA, complete cds.
          Length = 561

 Score =  338 bits (868), Expect = 5e-92
 Identities = 151/192 (78%), Positives = 178/192 (92%)
 Frame = -3

Query: 783 KLAELKDTLIMRKFGSVEPDNYWYRVCEGETESVVQRPWHLIWKSRRLMDIVSAIASRLN 604
           KL ++KDTLIMRKFG+VEPDNYWYRVCEGETESVVQRPW+L+WKS+RLM+IVSAIASRLN
Sbjct: 362 KLVDVKDTLIMRKFGTVEPDNYWYRVCEGETESVVQRPWNLLWKSKRLMEIVSAIASRLN 421

Query: 603 WDYDSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDP 424
           WDYD++HI RG+KA NKE WP+L +DTSP +++S+L+DKIE GRNLY+AT+EP++SFF+P
Sbjct: 422 WDYDAIHIERGDKARNKEVWPNLEKDTSPSSILSTLQDKIEQGRNLYIATNEPELSFFNP 481

Query: 423 LKDKYSTHFLNEYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVET 244
           LKDKY  HFL+E+KD WDE+SEWYSET KLNGGNPVEFD YMR SVDTEVFLRGKKQ+ET
Sbjct: 482 LKDKYKPHFLDEFKDLWDESSEWYSETTKLNGGNPVEFDGYMRASVDTEVFLRGKKQIET 541

Query: 243 FNDLTKDCKDGI 208
           FNDLT DC+DGI
Sbjct: 542 FNDLTNDCRDGI 553



>pir|G84455|G84455 hypothetical protein At2g04280 [imported] -
           Arabidopsis thaliana>gb:AC007213_1535608 Arabidopsis
           thaliana chromosome 2 clone T23O15 map RNS1, complete
           sequence.>gb:AY056207_1563530 Arabidopsis thaliana
           unknown protein (At2g04280) mRNA, complete
           cds.>gb:BT015416_1642244 Arabidopsis thaliana At2g04280
           gene, complete cds.
          Length = 568

 Score =  338 bits (867), Expect = 7e-92
 Identities = 153/192 (79%), Positives = 177/192 (92%)
 Frame = -3

Query: 783 KLAELKDTLIMRKFGSVEPDNYWYRVCEGETESVVQRPWHLIWKSRRLMDIVSAIASRLN 604
           KLA +KDTLIMRKFGSVEPDNYWYRVCEG+ ESVV+RPWHL+WKSRRLM+IVSAIASRLN
Sbjct: 369 KLAAVKDTLIMRKFGSVEPDNYWYRVCEGDAESVVKRPWHLLWKSRRLMEIVSAIASRLN 428

Query: 603 WDYDSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDP 424
           WDYD+VHI RGEKA NKE WP+L  DTSP A++S+L+DK+E+GR+LY+AT+E ++SFF+P
Sbjct: 429 WDYDAVHIERGEKARNKEVWPNLEADTSPSALLSTLQDKVEEGRHLYIATNEGELSFFNP 488

Query: 423 LKDKYSTHFLNEYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVET 244
           LKDKY+THFL +YKD WDE+SEWYSET KLNGGNPVEFD YMR SVDTEVFLRGKKQ+ET
Sbjct: 489 LKDKYATHFLYDYKDLWDESSEWYSETTKLNGGNPVEFDGYMRASVDTEVFLRGKKQIET 548

Query: 243 FNDLTKDCKDGI 208
           FNDLT DCKDG+
Sbjct: 549 FNDLTNDCKDGV 560



>gb:AE016959_1022901 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AE017101_1752720 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 55 of 77
            of the complete sequence.
          Length = 639

 Score =  308 bits (788), Expect = 1e-82
 Identities = 132/193 (68%), Positives = 176/193 (91%)
 Frame = -3

Query: 783  KLAELKDTLIMRKFGSVEPDNYWYRVCEGETESVVQRPWHLIWKSRRLMDIVSAIASRLN 604
            +L ++KDTLIMRKFG+VEPDN+W RVCEGETE+V++RPW+L+WKSRRLM+IVSAI+SR++
Sbjct: 441  QLRDVKDTLIMRKFGNVEPDNFWSRVCEGETEAVIKRPWYLLWKSRRLMEIVSAISSRMD 500

Query: 603  WDYDSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDP 424
            WD+DSVH+VRGEKA NK+ WP+L  DTSP++++++L DK+  GR+LY+AT+EPD SFFDP
Sbjct: 501  WDFDSVHVVRGEKAQNKQLWPNLDRDTSPDSLLTTLNDKVGAGRHLYIATNEPDKSFFDP 560

Query: 423  LKDKYSTHFLNEYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVET 244
            +K KY THFL+++KD WDENSEWY+ET +L+ GN VEFD YMR++VDTEVFLRGK+++ET
Sbjct: 561  MKGKYRTHFLDDFKDLWDENSEWYTETKELSNGNAVEFDGYMRVAVDTEVFLRGKRKLET 620

Query: 243  FNDLTKDCKDGIN 205
            F+DLT+DCK+G+N
Sbjct: 621  FSDLTRDCKNGVN 633



>pir|F85088|F85088 hypothetical protein AT4g08810 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV24_1544597 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           24.>gb:ATT32A17_1555902 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T32A17 (ESSA
           project).>gb:AY056392_1563700 Arabidopsis thaliana
           AT4g08810/T32A17_120 mRNA, complete
           cds.>gb:BT002655_1636258 Arabidopsis thaliana
           At4g08810/T32A17_120 gene, complete cds.
          Length = 552

 Score =  256 bits (654), Expect = 3e-67
 Identities = 111/193 (57%), Positives = 150/193 (77%)
 Frame = -3

Query: 783 KLAELKDTLIMRKFGSVEPDNYWYRVCEGETESVVQRPWHLIWKSRRLMDIVSAIASRLN 604
           +L++ K T+I R+F + EP+NYWYRVCEG+    V+RPWH +WKS+RLM+IVS I+ +++
Sbjct: 358 QLSKDKSTIIWRQFDTPEPENYWYRVCEGQASKYVERPWHALWKSKRLMNIVSEISGKMD 417

Query: 603 WDYDSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDP 424
           WD+D+VH+VRGEKA NK+ WPHL  DT P+A+++ LK  ++  RNLYVAT+EP  ++FD 
Sbjct: 418 WDFDAVHVVRGEKAKNKKLWPHLDADTWPDAILTKLKGLVQVWRNLYVATNEPFYNYFDK 477

Query: 423 LKDKYSTHFLNEYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVET 244
           L+ +Y  H L++Y   W   SEWY+ET+ LN G PVEFD YMR++VDTEVF RGK +VET
Sbjct: 478 LRSQYKVHLLDDYSYLWGNKSEWYNETSLLNNGKPVEFDGYMRVAVDTEVFYRGKTRVET 537

Query: 243 FNDLTKDCKDGIN 205
           F +LT DCKDGIN
Sbjct: 538 FYNLTTDCKDGIN 550



>gb:AP004334_1840383 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0455H11.>gb:AP004339_1840455 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0519E12.
          Length = 585

 Score =  241 bits (616), Expect = 9e-63
 Identities = 107/189 (56%), Positives = 140/189 (74%), Gaps = 1/189 (0%)
 Frame = -3

Query: 768 KDTLIMRKFGSVEPDNYWYRVCEGETESVVQRPWHLIWKSRRLMDIVSAIASRLNWDYDS 589
           K  +I R F   EP+NYWYRVCEG    V+QRPW+ IWKS+RLM+IV+ IA R++WDYD 
Sbjct: 393 KSNIIWRLFDGQEPENYWYRVCEGRAAKVIQRPWYAIWKSKRLMNIVTEIAGRMDWDYDG 452

Query: 588 VHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDKIEDG-RNLYVATDEPDISFFDPLKDK 412
           +H++RG KA NK+ +P+L  DTSPEA++  +   I+   RNLY+AT+EP  ++FD L+  
Sbjct: 453 LHVIRGWKAQNKQMYPNLDADTSPEALVDKVPKLIKQPMRNLYIATNEPFYNYFDKLRSY 512

Query: 411 YSTHFLNEYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVETFNDL 232
           +  H L++YK+ W   SEWY+ET  L+GG PV FD YMR+ VDTEVF R K QVETFN+L
Sbjct: 513 FHVHLLDDYKELWSNTSEWYNETTTLSGGRPVPFDAYMRVIVDTEVFYRAKTQVETFNNL 572

Query: 231 TKDCKDGIN 205
           T+DCKDGIN
Sbjct: 573 TRDCKDGIN 581



>gb:AP003232_1825828 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0034E02.
          Length = 259

 Score =  145 bits (366), Expect = 8e-34
 Identities = 80/185 (43%), Positives = 111/185 (60%), Gaps = 6/185 (3%)
 Frame = -3

Query: 783 KLAELKDTLIMRKFGSVEPDNYWYRVCEGETESVVQRPWHLIWKSRRLMDIVSAIASRLN 604
           K ++ +D LI+RKFG VEP NYWY VCEGE E V++ P   I  +  LMDIV  I SR+ 
Sbjct: 93  KFSKSRDPLIVRKFGDVEPGNYWYNVCEGEAEHVLRPPQGAIRTAPSLMDIVDGIISRMQ 152

Query: 603 WDYDSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDKIED-----GRNLYVATDEPDI 439
            D+DSVH+   +                      +L+ +IE+     GR +YVA +  ++
Sbjct: 153 VDFDSVHVGGND---------------------GNLRRRIEERLNGGGRQVYVAGEGINV 191

Query: 438 SFFDPLKDKYST-HFLNEYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRG 262
              D LK KYS+ H+L+ +++ W  +S+W+ E  +LNGG PVEFD YMR  VD EVFL+G
Sbjct: 192 VLLDALKAKYSSVHYLDAFEELWARDSKWFLEMKRLNGGVPVEFDGYMRELVDREVFLKG 251

Query: 261 KKQVE 247
           KK+VE
Sbjct: 252 KKKVE 256



>gb:AY102558_1577787 Arabidopsis thaliana hypothetical protein
           (At2g41150/T3K9.8) mRNA, complete cds.
          Length = 401

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 11/182 (6%)
 Frame = -3

Query: 717 WYRVCEGE-TESVVQRPWHLI--WKSRRLMDIVSAIASRLNWDYDSVHIVRGEKASNKE- 550
           W+  C+     S V  P+  +    + RL D    I ++L  DYD++H+ RG+K   ++ 
Sbjct: 215 WFVECKDRGNRSDVMLPYSFLXTMAASRLRDAAEKIKAKLG-DYDAIHVRRGDKLKTRKD 273

Query: 549 -------QWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDPLKDKYSTHFLN 391
                  Q+PHL  DT PE ++  ++ +I  GR L++ ++E    FF PL  +Y   + +
Sbjct: 274 RFRVERSQFPHLDRDTRPEFIIGRIQKQIPPGRTLFIGSNERTPDFFSPLAIRYKVAYSS 333

Query: 390 EYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVETFNDLTKDCKDG 211
            + +  D   E           N   F     I +  + F +  ++ ET   LT D K  
Sbjct: 334 NFSEILDPIIE----------NNYQLFMVERLIMMGAKTFFKTFREYETDLTLTDDPKKN 383

Query: 210 IN 205
            N
Sbjct: 384 KN 385



>pir|T02104|T02104 hypothetical protein At2g41150 [imported] -
           Arabidopsis thaliana>gb:AC004261_1531623 Arabidopsis
           thaliana chromosome 2 clone T3K9 map CIC11C08, complete
           sequence.>gb:AY649306_1620106 Arabidopsis thaliana
           hypothetical protein (At2g41150) mRNA, complete cds.
          Length = 401

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 11/182 (6%)
 Frame = -3

Query: 717 WYRVCEGE-TESVVQRPWHLI--WKSRRLMDIVSAIASRLNWDYDSVHIVRGEKASNKE- 550
           W+  C+     S V  P+  +    + RL D    I ++L  DYD++H+ RG+K   ++ 
Sbjct: 215 WFVECKDRGNRSDVMLPYSFLQTMAASRLRDAAEKIKAKLG-DYDAIHVRRGDKLKTRKD 273

Query: 549 -------QWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDPLKDKYSTHFLN 391
                  Q+PHL  DT PE ++  ++ +I  GR L++ ++E    FF PL  +Y   + +
Sbjct: 274 RFRVERSQFPHLDRDTRPEFIIGRIQKQIPPGRTLFIGSNERTPDFFSPLAIRYKVAYSS 333

Query: 390 EYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVETFNDLTKDCKDG 211
            + +  D   E           N   F     I +  + F +  ++ ET   LT D K  
Sbjct: 334 NFSEILDPIIE----------NNYQLFMVERLIMMGAKTFFKTFREYETDLTLTDDPKKN 383

Query: 210 IN 205
            N
Sbjct: 384 KN 385



>gb:AP004671_1843080 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0524G08.>gb:AP005292_1850018 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1340_C08.
          Length = 288

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 45/176 (25%), Positives = 77/176 (43%), Gaps = 11/176 (6%)
 Frame = -3

Query: 717 WYRVCEGETE-SVVQRPWHLI--WKSRRLMDIVSAIASRLNWDYDSVHIVRGEKASNKEQ 547
           W+  C+  T+ S V  P++ +    +R+L D  + I   L  DYD++H+ RG+   N++ 
Sbjct: 108 WFMECKDRTKRSSVMLPYNFLPSMPARKLRDAANKIKVILG-DYDAIHVRRGDLLKNRKD 166

Query: 546 --------WPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDPLKDKYSTHFLN 391
                    PHL  DT PE +   +   I  GR L++A++E    FF PL D+Y   + +
Sbjct: 167 RFGVERSLHPHLDRDTHPENIKRRIAKWIPRGRTLFIASNERTPGFFSPLSDRYKLAYSS 226

Query: 390 EYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVETFNDLTKD 223
            +    +                PV  + Y    V+  +    +K V+T  +   D
Sbjct: 227 NFSSILE----------------PVIDNNYQLFMVERLIMQGARKFVKTMKEFDND 266



>pir|T51263|T51263 hypothetical protein T8M16_80 - Arabidopsis
           thaliana>gb:ATT8M16_1556489 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8M16.>gb:AY059818_1564662
           Arabidopsis thaliana putative protein (At3g56750;
           T8M16_80) mRNA, complete cds.>gb:AY094482_1575775
           Arabidopsis thaliana AT3g56750/T8M16_80 mRNA, complete
           cds.>gb:BT000051_1634329 Arabidopsis thaliana putative
           protein (At3g56750) mRNA, complete cds.
          Length = 403

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 41/176 (23%), Positives = 79/176 (44%), Gaps = 11/176 (6%)
 Frame = -3

Query: 717 WYRVCEGETE-SVVQRPWHLI--WKSRRLMDIVSAIASRLNWDYDSVHIVRGEKASNKE- 550
           W+  C+  +  S V  P+  +    + +L +    I ++L  DYD++H+ RG+K   ++ 
Sbjct: 217 WFVECKDRSNRSAVMLPYSFLPNMAAAKLRNAAEKIKAQLG-DYDAIHVRRGDKLKTRKD 275

Query: 549 -------QWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDPLKDKYSTHFLN 391
                  Q+PHL  DT PE ++  ++ +I  GR L++ ++E    FF PL  +Y   + +
Sbjct: 276 RFGVERIQFPHLDRDTRPEFILRRIEKRIPRGRTLFIGSNERKPGFFSPLAVRYKLAYSS 335

Query: 390 EYKDQWDENSEWYSETAKLNGGNPVEFDTYMRISVDTEVFLRGKKQVETFNDLTKD 223
            + +  D                P+  + Y    ++  V +  K   +TF +   D
Sbjct: 336 NFSEILD----------------PIIENNYQLFMMERLVMMGAKTYFKTFKEYETD 375



>gb:BT002919_1636509 Arabidopsis thaliana clone RAFL15-04-D21
           (R20177) putative laccase (diphenol oxidase) family
           protein (At5g48100) mRNA, complete
           cds.>gb:BT005152_1638098 Arabidopsis thaliana clone
           U20177 putative laccase (diphenol oxidase) family
           protein (At5g48100) mRNA, complete cds.
          Length = 565

 Score = 37.0 bits (84), Expect = 0.42
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = +3

Query: 414 CLSEGQKMICLVRRLQHTSSCHLRFCPSRRT*QPRGKYLQPDVATVPYCLPSHL 575
           CL  GQ  + + RR+  T S +LR CP      P G  L   +  + +  PSH+
Sbjct: 338 CLFSGQVPVQISRRIITTVSINLRMCPQNSCEGPNGSRLAASMNNISFVTPSHV 391



>gb:AB017064_1513362 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDN11.
          Length = 490

 Score = 37.0 bits (84), Expect = 0.42
 Identities = 18/54 (33%), Positives = 26/54 (48%)
 Frame = +3

Query: 414 CLSEGQKMICLVRRLQHTSSCHLRFCPSRRT*QPRGKYLQPDVATVPYCLPSHL 575
           CL  GQ  + + RR+  T S +LR CP      P G  L   +  + +  PSH+
Sbjct: 263 CLFSGQVPVQISRRIITTVSINLRMCPQNSCEGPNGSRLAASMNNISFVTPSHV 316



>gb:SCHAP4_1708431 Yeast HAP4 gene for HAP4 transcriptional
           activator.
          Length = 554

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 11/98 (11%)
 Frame = -3

Query: 567 KASNKEQWPHLAEDTSPEAVMS-----------SLKDKIEDGRNLYVATDEPDISFFDPL 421
           K  +K  +P    D SP   +S            +KDKIED   +    D   + FF+  
Sbjct: 261 KIPHKASFPDSPADFSPADSVSLIRNHSLPTNLQVKDKIEDLNEIKFFNDFEKLEFFNKY 320

Query: 420 KDKYSTHFLNEYKDQWDENSEWYSETAKLNGGNPVEFD 307
               + + +NE  D W+   +   +T   N GN  + D
Sbjct: 321 AKVNTNNDVNENNDLWNSYLQSMDDTTGKNSGNYQQVD 358



>sp|P14064|HAP4_YEAST Transcriptional activator
           HAP4.>pir|S37936|S37936 regulatory protein HAP4 - yeast
           (Saccharomyces cerevisiae)>gb:SCHAPLAP_1708433
           S.cerevisiae HAP4, AAT1, GFA1, LAP4 and MBR1
           genes.>gb:SCYKL109W_1713085 S.cerevisiae chromosome XI
           reading frame ORF YKL109w.
          Length = 554

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 11/98 (11%)
 Frame = -3

Query: 567 KASNKEQWPHLAEDTSPEAVMS-----------SLKDKIEDGRNLYVATDEPDISFFDPL 421
           K  +K  +P    D SP   +S            +KDKIED   +    D   + FF+  
Sbjct: 261 KIPHKASFPDSPADFSPADSVSLIRNHSLPTNLQVKDKIEDLNEIKFFNDFEKLEFFNKY 320

Query: 420 KDKYSTHFLNEYKDQWDENSEWYSETAKLNGGNPVEFD 307
               + + +NE  D W+   +   +T   N GN  + D
Sbjct: 321 AKVNTNNDVNENNDLWNSYLQSMDDTTGKNSGNYQQVD 358



>gb:AY446894_2345460 Human herpesvirus 5 strain Merlin, complete
           genome.
          Length = 636

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 22/82 (26%), Positives = 36/82 (43%)
 Frame = -3

Query: 666 HLIWKSRRLMDIVSAIASRLNWDYDSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDK 487
           H +W+ R   D V+A+ S L                  +  P LA+D S E  +++ +  
Sbjct: 283 HALWEGRDPPDSVTAVLSEL-----------------PQLLPRLADDVSRE--IAAWEGP 323

Query: 486 IEDGRNLYVATDEPDISFFDPL 421
           +  G N Y   D PD+ ++ PL
Sbjct: 324 VAAGNNYYAYRDSPDLRYYMPL 345



>gb:AF378666_1266769 Heliothis virescens 110 kDa aminopeptidase
           mRNA, complete cds.
          Length = 950

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 30/113 (26%), Positives = 53/113 (46%), Gaps = 3/113 (2%)
 Frame = +3

Query: 345 SLNTTRCFHPIDLYIRSEN---AWNTCLSEGQKMICLVRRLQHTSSCHLRFCPSRRT*QP 515
           S+N T  F  +D ++R E     WN  L++   +  ++RRL+H  + H  F         
Sbjct: 640 SINRTLAFEVLD-FLRDETDYYVWNGALTQ---IDWILRRLEHLPAAHAAF--------- 686

Query: 516 RGKYLQPDVATVPYCLPSHLSRCEQSHNPNSTLMQLQKLCPSASSTSISGAMA 674
             +Y+   ++TV     +HL   EQS +  ST++   ++   A +   SG +A
Sbjct: 687 -SEYILDLMSTVI----NHLGYNEQSTDSTSTILNRMQIMNYACNLGHSGCIA 734



>sp|Q973C8|SYT_SULTO Threonyl-tRNA synthetase (EC 6.1.1.3)
           (Threonine--tRNA ligase) (ThrRS).>gb:BA000023_691568
           Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 540

 Score = 33.9 bits (76), Expect = 3.5
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 5/67 (7%)
 Frame = -3

Query: 396 LNEYKDQWDENSEWYSETAKLNGGNPVEF-----DTYMRISVDTEVFLRGKKQVETFNDL 232
           + EYK  W +    Y+     NG  PVE      D Y+ +  DT + L   K+  T+N  
Sbjct: 1   MEEYKGVWLKAGIIYALNLASNGFKPVEVGLGERDFYVDVESDTTLTLDEAKKFATYNQY 60

Query: 231 TKDCKDG 211
           +   KDG
Sbjct: 61  SYQLKDG 67



>sp|Q8MI28|LBN_BOVIN Limbin.>gb:AB083065_1409265 Bos taurus LBN mRNA
            for limbin, complete cds.
          Length = 1209

 Score = 33.5 bits (75), Expect = 4.6
 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 7/70 (10%)
 Frame = -3

Query: 561  SNKEQWPHLAEDTSPE-----AVMSSLKDKIEDGRNLYVATD--EPDISFFDPLKDKYST 403
            S K  WPHL+ +++ E      V +   D +  G  L++  +  EP+IS   P + K   
Sbjct: 1136 SGKRSWPHLSLESTDELTPVPIVGAEAVDLLNTGEKLFIFRNPKEPEISLHVPPRKK-KK 1194

Query: 402  HFLNEYKDQW 373
            +FLN  K  W
Sbjct: 1195 NFLNAKKAAW 1204



>gb:CR380948_1649308 Candida glabrata strain CBS138 chromosome B
           complete sequence.
          Length = 515

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 23/84 (27%), Positives = 41/84 (48%), Gaps = 1/84 (1%)
 Frame = -3

Query: 606 NWDYDSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKDKIED-GRNLYVATDEPDISFF 430
           NW +DS       K   K   PH A   S + ++ ++KD  +   + L V+   P  S+F
Sbjct: 116 NWFFDSWSQDSLMKFLAKYDLPHEANQ-SKDQLIKTIKDNFDTISKKLEVSGYYPSSSYF 174

Query: 429 DPLKDKYSTHFLNEYKDQWDENSE 358
           D   +K    +L+ YK ++D+ ++
Sbjct: 175 DDWSNKDLQDWLDHYKIKYDQTTD 198



>gb:AE014188_968072 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014848_1229464 Plasmodium
           falciparum 3D7 chromosome 12, section 5 of 9 of the
           complete sequence.
          Length = 1172

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = -3

Query: 726 DNYWYRVCEGETESVVQRPWHL-IWKSRRLMDIVSAIASRLNWDYDSVHIVRGEKASNKE 550
           +NY+   C+      V+R W+  I+K+ +  +I    AS  N +Y + +I+  EK+SNK 
Sbjct: 241 NNYYNNSCKK-----VKRLWNTDIFKTNKKRNI--KYASLFNNNYHTTNIIY-EKSSNK- 291

Query: 549 QWPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDPLKDKYSTHFLNEYKDQ-W 373
                       +    +   IE+ +N+Y+ T+   +   D +K+KY       YKD  +
Sbjct: 292 ------------SFKKDMMSYIEEMKNIYIPTNAEFVKVADDIKNKY-------YKDNIY 332

Query: 372 DENS 361
           D N+
Sbjct: 333 DGNN 336



>gb:AE017199_403040 Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 711

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 25/107 (23%), Positives = 47/107 (43%), Gaps = 11/107 (10%)
 Frame = -3

Query: 510 VMSSLKDKIEDGRNLYVA-----TDEPDISFFDPLKDKYSTHFLNEYKDQWDENSEWYSE 346
           ++   ++K++D  +  V      +D+PD+  F    D+   +  +EY ++ DE  +   E
Sbjct: 444 IIKESREKVKDALDKLVKAYEGNSDDPDVKEFKLALDRIKLYLKSEYGEKADEILKTMIE 503

Query: 345 TAKLNGGNPVEFDTYMRISVDTEV------FLRGKKQVETFNDLTKD 223
            AK    N  +   Y    + T +       L GK +  T +DL K+
Sbjct: 504 KAKELRNNEAKLKEYSEKYIGTTLDNLHTTMLLGKHEGYTVDDLLKE 550



>gb:AE017176_397379 Porphyromonas gingivalis W83 section 5 of 8 of
           the complete genome.>gb:AE015924_1032990 Porphyromonas
           gingivalis W83 complete genome.
          Length = 876

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 29/87 (33%), Positives = 37/87 (42%), Gaps = 5/87 (5%)
 Frame = -3

Query: 546 WPHLAEDTSPEAVMSSLKDKIEDGRNLYVATDEPDISFFDPLKDKYSTHFLNE-----YK 382
           W      T PEA  S+L  K    R   V T+         L D +S + L+E     YK
Sbjct: 597 WQQAETSTQPEA--SALAVKWFGYRLDEVKTE---------LDDLFSKYRLSEALTLVYK 645

Query: 381 DQWDENSEWYSETAKLNGGNPVEFDTY 301
             WD+ S WY E  K   G P++  TY
Sbjct: 646 LFWDDFSSWYLEMVKPAYGQPMDAKTY 672



>pir|A86878|A86878 non-heme iron-binding ferritin [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006432_218927 Lactococcus lactis subsp.
           lactis IL1403 section 194 of 218 of the complete
           genome.>gb:AE005176_1096000 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 148

 Score = 33.1 bits (74), Expect = 6.0
 Identities = 24/72 (33%), Positives = 38/72 (52%), Gaps = 9/72 (12%)
 Frame = -3

Query: 396 LNEYKDQWDENSEWYSETAKLNGGNPV----EFDTYMRISVDTEVF-----LRGKKQVET 244
           ++E KDQ DE+ + ++E     GG+PV    EFD   +I +   V+      R K+ +  
Sbjct: 43  MDELKDQLDEHLDEFAERLITIGGSPVSTLAEFDKNSKIEMTPAVWGKSNSERVKELIVA 102

Query: 243 FNDLTKDCKDGI 208
           +  LT+  KDGI
Sbjct: 103 YKYLTQLFKDGI 114



>gb:CR380955_1651733 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 612

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 26/68 (38%), Positives = 33/68 (48%), Gaps = 5/68 (7%)
 Frame = +3

Query: 561 LPSHLSRCE-QSHNPNSTLMQLQKLCPSASSTSI----SGAMAVEQQIQSLPHTPCTSNY 725
           LPS LS  E  S NPNS    +QK+  S  STS     S A AV     +   TP T+  
Sbjct: 320 LPSSLSHTEVYSSNPNSRRHSVQKITDSRGSTSSITSPSAASAVYSASNNYMDTPVTNAN 379

Query: 726 LVPQSQTS 749
           +   ++TS
Sbjct: 380 MTTFNKTS 387



>gb:BX842648_823978 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 3/11.
          Length = 354

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 2/80 (2%)
 Frame = -3

Query: 771 LKDTLIMRKFGSVEPDNYWYRVCEGETESVVQRPWHLIWKSRRLMDIVSAIASRLNWDYD 592
           L+  LI + +   + +NY YR       S+ ++     WK     D+  +  S+L  DY 
Sbjct: 109 LRAGLIPQTWQEAQYENYQYRFLGQTAWSMTEK-----WKYLSYSDLGVSFMSQLPHDYG 163

Query: 591 --SVHIVRGEKASNKEQWPH 538
             ++++  GE A  KE+ PH
Sbjct: 164 EWALNLTNGEGAEEKEEGPH 183



>gb:AF319533_499489 Neisseria meningitidis strain 6083 PqiA (pqiA)
           gene, partial cds; HemO (hemO) and Exl3 (exl3) genes,
           complete cds; and Col (col) gene, partial cds.
          Length = 455

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 21/92 (22%), Positives = 40/92 (43%), Gaps = 12/92 (13%)
 Frame = -3

Query: 594 DSVHIVRGEKASNKEQWPHLAEDTSPEAVMSSLKD---------KIEDGRNLYVATDEPD 442
           +++ + + ++  +++  P L  D+  E VM S            K++DG        +P 
Sbjct: 268 ETIDLTKADEPVSRKNHPGLMSDSDFEKVMVSQGQYQHLIYGAAKLQDGTYTLFVQGKPT 327

Query: 441 ISFFDPLKDKYS---THFLNEYKDQWDENSEW 355
            +    +  KY     HF+ +YKD W  NS +
Sbjct: 328 ENLPTRMMAKYQGKVLHFVGKYKDNWFNNSAY 359



>gb:CR522870_99812 Desulfotalea psychrophila LSv54 chromosome.
          Length = 546

 Score = 32.7 bits (73), Expect = 7.8
 Identities = 36/130 (27%), Positives = 55/130 (42%), Gaps = 4/130 (3%)
 Frame = +1

Query: 181 KLGRGSASVNPILAVLGEIIKSLYLLFTPQENLCINRDSHVSVEFHGIPTVKLCCL*--- 351
           KLG+    V P   +LG +     ++F  Q N+    D  VSV  HG   + +  L    
Sbjct: 130 KLGKFIRLV-PHPVMLGFVNGLAIVIFLSQLNMFKTVDGGVSVWLHGPNMLTMLALVGTT 188

Query: 352 IPLAVFIP-LIFIFVQKMRGILVFQRVKK*YVWFVGCNIQVPAIFDFVLQGGHDSLGGSI 528
           + +  F+P L       +  ILV   +       + C + VP +  F+  GG + LGG +
Sbjct: 189 MAIMYFLPKLNRQLPAALTAILVISFIT------IVCKLDVPTVGSFIRDGGGEGLGGVL 242

Query: 529 FSQMWPLFLI 558
            S    LF I
Sbjct: 243 PSFQLELFSI 252


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 841,442,717
Number of Sequences: 1806583
Number of extensions: 17996705
Number of successful extensions: 56650
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 54413
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56594
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 50250564011
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)