BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12272
         (798 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AK176239_1818227 Arabidopsis thaliana mRNA, complete cds, clo...   294   1e-78   
gb:AB015473_1512537 Arabidopsis thaliana genomic DNA, chromosome...   294   1e-78   
gb:AC148814_1744833 Oryza sativa (japonica cultivar-group) chrom...   254   1e-66   
gb:BC007902_1971080 Homo sapiens chromosome 7 open reading frame...   117   3e-25   
gb:AE014296_1134357 Drosophila melanogaster chromosome 3L, compl...    87   3e-16   
gb:CEY52B11A_1370451 Caenorhabditis elegans YAC Y52B11A, complet...    83   7e-15   
gb:AE017353_1760160 Cryptococcus neoformans var. neoformans JEC2...    82   2e-14   
gb:CR382130_1662977 Yarrowia lipolytica chromosome D of strain C...    77   3e-13   
pir|T38352|T38352 hypothetical protein SPAC24C9.11 - fission yea...    74   3e-12   Schizosaccharomyces pombe
gb:CR382138_1671596 Debaryomyces hansenii chromosome F of strain...    72   2e-11   
pir|C96842|C96842 hypothetical protein F23A5.29 [imported] - Ara...    70   3e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AE014188_968178 Plasmodium falciparum 3D7 chromosome 12, comp...    69   8e-11   
gb:AJ720181_2502368 Gallus gallus mRNA for hypothetical protein,...    67   3e-10   
gb:BC057826_1985466 Homo sapiens KIAA1604 protein, mRNA (cDNA cl...    67   4e-10   
gb:BC053573_1984977 Homo sapiens KIAA1604 protein, mRNA (cDNA cl...    67   4e-10   
gb:AK026978_1910766 Homo sapiens cDNA: FLJ23325 fis, clone HEP12...    67   4e-10   
gb:AB046824_1867463 Homo sapiens mRNA for KIAA1604 protein, part...    67   4e-10   
gb:CR859125_1183262 Pongo pygmaeus mRNA; cDNA DKFZp459F1129 (fro...    67   4e-10   
pir|S51341|S51341 SGD1 protein - yeast (Saccharomyces cerevisiae...    67   4e-10   Saccharomyces cerevisiae [brewer's yeast]
gb:SPBC15D4_1719040 S.pombe chromosome II cosmid c15D4.                66   7e-10   
pir|T39492|T39492 conserved hypothetical protein SPBC15D4.16 - f...    66   7e-10   Schizosaccharomyces pombe
sp|Q9P6R9|CWFM_SCHPO|CWFM_SCHPO Cell cycle control protein cwf22.                 66   7e-10   Schizosaccharomyces pombe
gb:AK129404_2069635 Mus musculus mRNA for mKIAA1604 protein.           64   3e-09   
gb:AY089504_1297160 Drosophila melanogaster GH13383 full insert ...    64   3e-09   
gb:AY061596_1293399 Drosophila melanogaster SD04745 full length ...    64   3e-09   
gb:AK077961_1172136 Mus musculus 13 days embryo male testis cDNA...    64   3e-09   
gb:AK045589_1167473 Mus musculus adult male corpora quadrigemina...    64   3e-09   
gb:AE014134_1129597 Drosophila melanogaster chromosome 2L, compl...    64   3e-09   
gb:AY325221_1177890 Rattus norvegicus Ac2-155 mRNA, complete cds.      64   3e-09   
gb:BC003993_2089515 Mus musculus cDNA sequence BC003993, mRNA (c...    63   7e-09   
gb:CR380953_1650654 Candida glabrata strain CBS138 chromosome G ...    62   2e-08   
gb:CNS09S4S_1648241 DNA centromeric region sequence from BAC DP2...    62   2e-08   
gb:CR382122_1655071 Kluyveromyces lactis strain NRRL Y-1140 chro...    61   3e-08   
gb:LMFL5341_1388174 Leishmania major Friedlin chromosome 19 cosm...    59   1e-07   
gb:AE017346_1757170 Cryptococcus neoformans var. neoformans JEC2...    58   2e-07   
pir|T21688|T21688 hypothetical protein F33A8.1 - Caenorhabditis ...    57   5e-07   Caenorhabditis elegans [roundworm]
gb:AE016820_1749600 Ashbya gossypii (= Eremothecium gossypii) AT...    56   9e-07   
gb:AK025635_1910353 Homo sapiens cDNA: FLJ21982 fis, clone HEP06...    53   6e-06   
gb:CR382130_1663170 Yarrowia lipolytica chromosome D of strain C...    47   3e-04   
gb:CR382135_1668301 Debaryomyces hansenii chromosome C of strain...    43   0.006   
sp|P53333|YG5U_YEAST|YG5U_YEAST Hypothetical 67.3 kDa protein in TAF145-YOR...    42   0.013   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382123_1656090 Kluyveromyces lactis strain NRRL Y-1140 chro...    42   0.017   
gb:AE016815_1746269 Ashbya gossypii (= Eremothecium gossypii) AT...    40   0.039   
gb:CR382126_1659563 Kluyveromyces lactis strain NRRL Y-1140 chro...    34   2.8     
gb:DRAJ5029_2570994 Danio rerio mRNA for Eph-like receptor tyros...    33   6.2     
gb:BC027875_1978980 Homo sapiens myosin XVB, pseudogene, mRNA (c...    33   6.2     
gb:AK026339_1910609 Homo sapiens cDNA: FLJ22686 fis, clone HSI10...    33   6.2     
gb:HSM803107_1186908 Homo sapiens mRNA; cDNA DKFZp667C0210 (from...    33   6.2     
pir|T00568|T00568 hypothetical protein At2g39580 [imported] - Ar...    33   8.1     Arabidopsis thaliana [mouse-ear cress]


>gb:AK176239_1818227 Arabidopsis thaliana mRNA, complete cds, clone:
            RAFL23-12-N11.
          Length = 784

 Score =  294 bits (753), Expect = 1e-78
 Identities = 140/194 (72%), Positives = 166/194 (85%), Gaps = 1/194 (0%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            F   MS EDYIDAFEKLLRLDLPGKQDREIMRVL+ECCLQEK FNK+Y  LASKLC HDK
Sbjct: 591  FCVIMSSEDYIDAFEKLLRLDLPGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDK 650

Query: 200  NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            NHKFTLQYC+WDHFKE+ESM L RSMHL+KF+AE++ ++ LSL+VLK VDL +  +LTPK
Sbjct: 651  NHKFTLQYCIWDHFKELESMSLQRSMHLAKFVAEIIVTFNLSLAVLKSVDLANPVELTPK 710

Query: 380  RIMHFRMLFEAIFEFPDKLVWNIFTRIAL-PEHESLCNGIVIFIREYVANGNKSLAGKFK 556
            RIMHFRMLFEAIFE P+ LVWN+FTRIAL PE+E+L +GI  F++EYV   NK++ GKF+
Sbjct: 711  RIMHFRMLFEAIFEHPENLVWNLFTRIALNPEYEALRDGIKFFVKEYVVKNNKAIYGKFR 770

Query: 557  IAKKAINNVEGVLM 598
             AK+A+NN EG+LM
Sbjct: 771  KAKEALNNAEGLLM 784



>gb:AB015473_1512537 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MCM23.
          Length = 707

 Score =  294 bits (753), Expect = 1e-78
 Identities = 140/194 (72%), Positives = 166/194 (85%), Gaps = 1/194 (0%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            F   MS EDYIDAFEKLLRLDLPGKQDREIMRVL+ECCLQEK FNK+Y  LASKLC HDK
Sbjct: 514  FCVIMSSEDYIDAFEKLLRLDLPGKQDREIMRVLVECCLQEKAFNKFYTVLASKLCEHDK 573

Query: 200  NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            NHKFTLQYC+WDHFKE+ESM L RSMHL+KF+AE++ ++ LSL+VLK VDL +  +LTPK
Sbjct: 574  NHKFTLQYCIWDHFKELESMSLQRSMHLAKFVAEIIVTFNLSLAVLKSVDLANPVELTPK 633

Query: 380  RIMHFRMLFEAIFEFPDKLVWNIFTRIAL-PEHESLCNGIVIFIREYVANGNKSLAGKFK 556
            RIMHFRMLFEAIFE P+ LVWN+FTRIAL PE+E+L +GI  F++EYV   NK++ GKF+
Sbjct: 634  RIMHFRMLFEAIFEHPENLVWNLFTRIALNPEYEALRDGIKFFVKEYVVKNNKAIYGKFR 693

Query: 557  IAKKAINNVEGVLM 598
             AK+A+NN EG+LM
Sbjct: 694  KAKEALNNAEGLLM 707



>gb:AC148814_1744833 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0077J22, complete sequence.
          Length = 427

 Score =  254 bits (649), Expect = 1e-66
 Identities = 126/196 (64%), Positives = 159/196 (81%), Gaps = 3/196 (1%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           F   MS EDY+DAFEKLLRLDL GKQDREI+RV+++CCLQEK+FNKYY  LASKLC HDK
Sbjct: 233 FCIIMSAEDYVDAFEKLLRLDLSGKQDREIIRVIVDCCLQEKMFNKYYAVLASKLCSHDK 292

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
           NHKF+LQYC+WDHFKE+++MEL RSM+L+K +AEMLA++TLSL+ LKVV      ++ PK
Sbjct: 293 NHKFSLQYCIWDHFKELDNMELNRSMNLAKLVAEMLANFTLSLATLKVVK-NLAVEVIPK 351

Query: 380 RIMHFRMLFEAIFEFPDKLVWNIFTRIA-LPEHESLCNGIVIFIREYV--ANGNKSLAGK 550
           R +HFRMLFE + +  D +VWN+FTRIA LPE E L +G+V+FI+++V   +  K LA K
Sbjct: 352 RTIHFRMLFETLLQKDDAVVWNVFTRIAGLPELEILRDGLVLFIKQHVIAKDTGKDLASK 411

Query: 551 FKIAKKAINNVEGVLM 598
           FKIAKKA++N  GVLM
Sbjct: 412 FKIAKKALDNTAGVLM 427



>gb:BC007902_1971080 Homo sapiens chromosome 7 open reading frame 3,
           mRNA (cDNA clone IMAGE:4138787), partial cds.
          Length = 295

 Score =  117 bits (292), Expect = 3e-25
 Identities = 62/170 (36%), Positives = 107/170 (62%), Gaps = 2/170 (1%)
 Frame = +2

Query: 17  NFLCN-MSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGH 193
           N  C  M+ ED++DAFEKLL+L L  +Q+REI+ VL++CCLQEK +N +Y  LASK C +
Sbjct: 93  NIFCTIMTSEDFLDAFEKLLKLGLKDQQEREIIHVLMDCCLQEKTYNPFYAFLASKFCEY 152

Query: 194 DKNHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLT 373
           ++  + T Q+ +WD F+++E++      +L   +A +L + +LSLS+LKVV+  ++ +  
Sbjct: 153 ERRFQMTFQFSIWDKFRDLENLPATNFSNLVHLVAHLLKTKSLSLSILKVVEFSELDK-- 210

Query: 374 PKRIMHFRMLFEAIFEFPDKLVWNIFTRIA-LPEHESLCNGIVIFIREYV 520
           P+     ++L   + E   + +  IFTR++  P+   L  G+ +FI  ++
Sbjct: 211 PRVRFLRKVLSILLMETEVEDLSLIFTRVSDNPKLGVLREGLKLFISHFL 260



>gb:AE014296_1134357 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003474_1211656 Drosophila melanogaster
            chromosome 3L, section 8 of 83 of the complete
            sequence.>gb:BT010298_1357589 Drosophila melanogaster
            LD10043 full insert cDNA.
          Length = 854

 Score = 87.4 bits (215), Expect = 3e-16
 Identities = 45/123 (36%), Positives = 69/123 (56%), Gaps = 1/123 (0%)
 Frame = +2

Query: 8    EESNFLCN-MSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKL 184
            E  N  C  MS  DY+DAFEK+L L L  K  R +  V++ C L EK  N YY  LA K 
Sbjct: 651  ERRNIFCIIMSAADYVDAFEKILHLSL--KDQRAVAYVIIHCALNEKRANPYYAHLALKF 708

Query: 185  CGHDKNHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVT 364
            C  ++ ++   Q+  WD   ++E +   +  +L+ F+ +++ +  L LSVLKVVD   + 
Sbjct: 709  CQFNRKYQLAFQFASWDRINDIEKLSKPQIRNLASFLQQVILAAGLQLSVLKVVDFMQLD 768

Query: 365  QLT 373
            +L+
Sbjct: 769  KLS 771



>gb:CEY52B11A_1370451 Caenorhabditis elegans YAC Y52B11A, complete
           sequence.
          Length = 819

 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 35/105 (33%), Positives = 67/105 (63%)
 Frame = +2

Query: 35  SGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDKNHKFT 214
           S +D  DAFE+LL+L L G+++RE++ VL+   ++EK +N +Y  L  + C  +K    T
Sbjct: 638 SADDEDDAFERLLKLQLKGEKERELVHVLIAMMMKEKTYNAFYATLLQRFCEFNKRFVIT 697

Query: 215 LQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVD 349
           LQ+ LWD  +E + ++  +   L++ +  ++++  +S++VLK V+
Sbjct: 698 LQFALWDRLRECDQLKPFQRGSLAQLLQHLISNEVMSITVLKTVE 742



>gb:AE017353_1760160 Cryptococcus neoformans var. neoformans JEC21
            chromosome 13, complete sequence.
          Length = 867

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 41/119 (34%), Positives = 68/119 (57%), Gaps = 3/119 (2%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            F+  M+ EDY+ A ++L    L   Q RE +RV L CC  E  +N YY  + S LC +  
Sbjct: 648  FVVLMTSEDYVHACDRLSMFKLSDVQQREFVRVALHCCGLEATYNPYYTLILSHLCANSY 707

Query: 200  NHKFTLQYCLWDHFKEVES---MELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQ 367
            +H+FT QY LWD  +E+E+   +   +  ++++ +  ++A   LSL+V K VD   +++
Sbjct: 708  DHRFTFQYALWDFMRELENGSKVSKEKLGNVARAVGYVVARGGLSLTVFKAVDFTSLSK 766



>gb:CR382130_1662977 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1213

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 59/207 (28%), Positives = 95/207 (45%), Gaps = 36/207 (17%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            F+  M  EDY++A E++ +L L   Q+REI RVL+ CC  E V+N +Y  LA KL     
Sbjct: 982  FVAIMGAEDYLNALERVSKLRLKRVQEREIPRVLIHCCSNESVYNPFYALLAVKL-AERH 1040

Query: 200  NHKFTLQYCLWDHFKEV------------------------ESMELMR-SMHLSKFIAEM 304
            + K T Q+ LWD F+E+                        +S EL+R +M+L++  A+M
Sbjct: 1041 SLKMTFQFTLWDFFRELDGDDDDDSDDDSDREESVKVLEGSDSKELLRKTMNLARMFAQM 1100

Query: 305  LASYTLSLSVLKVVDLGDVTQLTPKRIMHFRMLFEAIFEFPDKLVWN-----------IF 451
             A  T+ L++ K V+    ++      +   M F A+F    K               + 
Sbjct: 1101 TAEGTVGLNIFKNVNFLTASE---NMKIFLEMYFVALFGMLGKRAEEGNGKSRDQKQLVK 1157

Query: 452  TRIALPEHESLCNGIVIFIREYVANGN 532
              + L ++  L  GI  F+ E V + +
Sbjct: 1158 LLLKLKDNALLLRGIQYFVSEIVVHSD 1184



>pir|T38352|T38352 hypothetical protein SPAC24C9.11 - fission yeast 
           (Schizosaccharomyces pombe)>gb:SPAC24C9_1717381 S.pombe
           chromosome I cosmid c24C9.
          Length = 775

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 8/120 (6%)
 Frame = +2

Query: 14  SNFLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGH 193
           S F+  +  EDYIDA+E++L+L L   Q  EI  V+L C   EK++N +Y  +A K C  
Sbjct: 569 SIFVALVGSEDYIDAWERVLKLHLKRNQLPEIAYVILHCVGNEKLYNPFYGLVALKCCTL 628

Query: 194 DKNHKFTLQYCLWDHFKEVE--------SMELMRSMHLSKFIAEMLASYTLSLSVLKVVD 349
             N K + Q+ LWD F E++         + + R ++L+K  A ++      L++LK VD
Sbjct: 629 QHNLKKSFQFSLWDFFNELQPDDDSEEREISMRRIVNLAKLYASLVIEAAQPLTILKHVD 688



>gb:CR382138_1671596 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 822

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 38/81 (46%), Positives = 48/81 (59%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           F+  MS  DY+DA  KL +L L   Q+REI RVL+ C   E  +N YY  LASKLC +  
Sbjct: 726 FISIMSANDYVDALTKLDKLALKRSQEREIPRVLIHCTGIEPAWNPYYGVLASKLCDNHS 785

Query: 200 NHKFTLQYCLWDHFKEVESME 262
           N K T Q+ LWD  K+ E  +
Sbjct: 786 NRK-TFQFMLWDLIKDFEGTD 805



>pir|C96842|C96842 hypothetical protein F23A5.29 [imported] -
            Arabidopsis thaliana>gb:AE005173_895606 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AY139757_1582377 Arabidopsis thaliana
            At1g80930/F23A5_23 mRNA, complete
            cds.>gb:BT004547_1637581 Arabidopsis thaliana
            At1g80930/F23A5_23 gene, complete cds.>gb:F23A5_1677934
            Arabidopsis thaliana chromosome 1 BAC F23A5 sequence,
            complete sequence.
          Length = 900

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 39/134 (29%), Positives = 70/134 (52%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            +L  MS  D+ +A  KLL++ L   Q+ E+  +LLECC QE+ + +YY  L  + C  +K
Sbjct: 655  YLTIMSSVDFEEAGHKLLKIKLEPGQEMELCIMLLECCSQERTYLRYYGLLGQRFCMINK 714

Query: 200  NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
             H+   + C    +  +  +E  +  +++KF A +L +  L   VL  + L +    +  
Sbjct: 715  IHQENFEKCFVQQYSMIHRLETNKLRNVAKFFAHLLGTDALPWHVLAYIRLTEEDTTSSS 774

Query: 380  RIMHFRMLFEAIFE 421
            RI   ++LF+ + E
Sbjct: 775  RIF-IKILFQELSE 787



>gb:AE014188_968178 Plasmodium falciparum 3D7 chromosome 12, complete
            sequence.>gb:AE014850_1229570 Plasmodium falciparum 3D7
            chromosome 12, section 7 of 9 of the complete sequence.
          Length = 967

 Score = 69.3 bits (168), Expect = 8e-11
 Identities = 36/122 (29%), Positives = 62/122 (50%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            +L  MS   Y +   KLL+L++    + EI  +L++CC  EK F K+Y   A +LC   K
Sbjct: 778  YLSIMSSLSYEECVHKLLKLNIKKGYEIEICNMLIDCCCMEKTFQKFYALQAERLCKLKK 837

Query: 200  NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
             ++   + C  + F     +E  +  + SKF A +L +  +S S+ K++ L +    +  
Sbjct: 838  IYQENFEKCFDNSFNTAHRLETAKLRNCSKFFAHLLYTDAISWSIFKIIKLTEEDTTSST 897

Query: 380  RI 385
            RI
Sbjct: 898  RI 899



>gb:AJ720181_2502368 Gallus gallus mRNA for hypothetical protein,
           clone 12b15.
          Length = 854

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 32/135 (23%), Positives = 72/135 (53%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL++D P  Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 391 YLAIQSSLDFEECAHKLLKMDFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 450

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + ++  SVL+ + L + T  +  
Sbjct: 451 EYMESFEAIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSIPWSVLECIILSEETTTSSS 510

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 511 RIF-VKIFFQELSEY 524



>gb:BC057826_1985466 Homo sapiens KIAA1604 protein, mRNA (cDNA clone
           IMAGE:30334112), partial cds.
          Length = 748

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 32/135 (23%), Positives = 72/135 (53%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++ P  Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 460 YLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 519

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 520 EYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 579

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 580 RIF-VKIFFQELCEY 593



>gb:BC053573_1984977 Homo sapiens KIAA1604 protein, mRNA (cDNA clone
           IMAGE:3873747), partial cds.
          Length = 848

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 32/135 (23%), Positives = 72/135 (53%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++ P  Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 400 YLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 459

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 460 EYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 519

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 520 RIF-VKIFFQELCEY 533



>gb:AK026978_1910766 Homo sapiens cDNA: FLJ23325 fis, clone
           HEP12505.
          Length = 632

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 32/135 (23%), Positives = 72/135 (53%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++ P  Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 184 YLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 243

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 244 EYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 303

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 304 RIF-VKIFFQELCEY 317



>gb:AB046824_1867463 Homo sapiens mRNA for KIAA1604 protein, partial
           cds.
          Length = 937

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 32/135 (23%), Positives = 72/135 (53%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++ P  Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 489 YLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 548

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 549 EYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 608

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 609 RIF-VKIFFQELCEY 622



>gb:CR859125_1183262 Pongo pygmaeus mRNA; cDNA DKFZp459F1129 (from
           clone DKFZp459F1129).
          Length = 908

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 32/135 (23%), Positives = 72/135 (53%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++ P  Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 460 YLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 519

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 520 EYMESFEGIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 579

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 580 RIF-VKIFFQELCEY 593



>pir|S51341|S51341 SGD1 protein - yeast (Saccharomyces
            cerevisiae)>gb:YSCL8300_1729546 Saccharomyces cerevisiae
            chromosome XII cosmid 8300.
          Length = 899

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 42/130 (32%), Positives = 62/130 (47%), Gaps = 21/130 (16%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQE---KVFNKYYCALASKLCG 190
            F+  MS +DY+DAF KL +L L  KQ  EI R++L C L +     +N YY  +A+K+C 
Sbjct: 650  FISIMSAQDYLDAFSKLEKLSLKNKQVLEIPRIVLHCLLADSGSNGYNHYYALVANKICE 709

Query: 191  HDKNHKFTLQYCLWDHFKEVESME------------------LMRSMHLSKFIAEMLASY 316
               +   + Q+  WD  K+ E  E                  L+R  +  +F   +LA+ 
Sbjct: 710  RYSHLSKSFQFLFWDVIKKFEDKEFDSESDTDEEDDLDDKEKLLRISNQGRFFGSLLAND 769

Query: 317  TLSLSVLKVV 346
             L L V K V
Sbjct: 770  ILKLDVFKHV 779



>gb:SPBC15D4_1719040 S.pombe chromosome II cosmid c15D4.
          Length = 628

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 35/137 (25%), Positives = 72/137 (52%)
 Frame = +2

Query: 11  ESNFLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCG 190
           +S +L  MS  D+ +   KLL++DLP  Q+ E+  +++EC  QE+ + K+Y  +  + C 
Sbjct: 414 KSIYLTIMSSVDFEECCHKLLKIDLPEGQEIELCNMVIECNSQERTYAKFYGLIGERFCK 473

Query: 191 HDKNHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQL 370
             +  + T + C  ++++ +   E  R  +++ F A +L++ ++   V   V L +    
Sbjct: 474 LSRTWRSTYEQCFKNYYETIHRYETNRLRNIALFFANLLSTDSIGWEVYDCVRLTEDDTT 533

Query: 371 TPKRIMHFRMLFEAIFE 421
              RI   +++F+ I E
Sbjct: 534 ASSRIF-LKIMFQEIVE 549



>pir|T39492|T39492 conserved hypothetical protein SPBC15D4.16 -
           fission yeast  (Schizosaccharomyces pombe)
          Length = 887

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 35/137 (25%), Positives = 72/137 (52%)
 Frame = +2

Query: 11  ESNFLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCG 190
           +S +L  MS  D+ +   KLL++DLP  Q+ E+  +++EC  QE+ + K+Y  +  + C 
Sbjct: 414 KSIYLTIMSSVDFEECCHKLLKIDLPEGQEIELCNMVIECNSQERTYAKFYGLIGERFCK 473

Query: 191 HDKNHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQL 370
             +  + T + C  ++++ +   E  R  +++ F A +L++ ++   V   V L +    
Sbjct: 474 LSRTWRSTYEQCFKNYYETIHRYETNRLRNIALFFANLLSTDSIGWEVYDCVRLTEDDTT 533

Query: 371 TPKRIMHFRMLFEAIFE 421
              RI   +++F+ I E
Sbjct: 534 ASSRIF-LKIMFQEIVE 549



>sp|Q9P6R9|CWFM_SCHPO Cell cycle control protein cwf22.
          Length = 834

 Score = 66.2 bits (160), Expect = 7e-10
 Identities = 35/137 (25%), Positives = 72/137 (52%)
 Frame = +2

Query: 11  ESNFLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCG 190
           +S +L  MS  D+ +   KLL++DLP  Q+ E+  +++EC  QE+ + K+Y  +  + C 
Sbjct: 414 KSIYLTIMSSVDFEECCHKLLKIDLPEGQEIELCNMVIECNSQERTYAKFYGLIGERFCK 473

Query: 191 HDKNHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQL 370
             +  + T + C  ++++ +   E  R  +++ F A +L++ ++   V   V L +    
Sbjct: 474 LSRTWRSTYEQCFKNYYETIHRYETNRLRNIALFFANLLSTDSIGWEVYDCVRLTEDDTT 533

Query: 371 TPKRIMHFRMLFEAIFE 421
              RI   +++F+ I E
Sbjct: 534 ASSRIF-LKIMFQEIVE 549



>gb:AK129404_2069635 Mus musculus mRNA for mKIAA1604 protein.
          Length = 907

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 31/135 (22%), Positives = 71/135 (52%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++    Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 463 YLAIQSSLDFEECAHKLLKMEFAESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 522

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 523 EYMESFESIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 582

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 583 RIF-VKIFFQELCEY 596



>gb:AY089504_1297160 Drosophila melanogaster GH13383 full insert cDNA.
          Length = 1012

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 34/135 (25%), Positives = 70/135 (51%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            +L   S  DY +   KL+++ L   Q+ E+  + L+CC +++ + K+Y  LA + C  +K
Sbjct: 716  YLTINSSLDYEECAHKLMKMQLKPGQEIELCHMFLDCCAEQRTYEKFYGLLAQRFCNINK 775

Query: 200  NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
             +    +    D ++    ++  R  ++SKF A +L +  +S  VL+ + L +    +  
Sbjct: 776  IYIPPFEEIFKDTYQTTHRLDTNRLRNVSKFFAHLLFTDAISWDVLECIQLNEDDTTSSS 835

Query: 380  RIMHFRMLFEAIFEF 424
            RI   ++LF+ + E+
Sbjct: 836  RIF-IKILFQELAEY 849



>gb:AY061596_1293399 Drosophila melanogaster SD04745 full length
           cDNA.
          Length = 751

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 34/135 (25%), Positives = 70/135 (51%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  DY +   KL+++ L   Q+ E+  + L+CC +++ + K+Y  LA + C  +K
Sbjct: 125 YLTINSSLDYEECAHKLMKMQLKPGQEIELCHMFLDCCAEQRTYEKFYGLLAQRFCNINK 184

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +    +    D ++    ++  R  ++SKF A +L +  +S  VL+ + L +    +  
Sbjct: 185 IYIPPFEEIFKDTYQTTHRLDTNRLRNVSKFFAHLLFTDAISWDVLECIQLNEDDTTSSS 244

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++LF+ + E+
Sbjct: 245 RIF-IKILFQELAEY 258



>gb:AK077961_1172136 Mus musculus 13 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:6030473K15
           product:hypothetical protein, MGC:7531, full insert
           sequence.
          Length = 908

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 31/135 (22%), Positives = 71/135 (52%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++    Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 459 YLAIQSSLDFEECAHKLLKMEFAESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 518

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 519 EYMESFESIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 578

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 579 RIF-VKIFFQELCEY 592



>gb:AK045589_1167473 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230213M24 product:hypothetical protein, MGC:7531,
           full insert sequence.
          Length = 902

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 31/135 (22%), Positives = 71/135 (52%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++    Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 459 YLAIQSSLDFEECAHKLLKMEFAESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 518

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 519 EYMESFESIFKEQYDTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 578

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 579 RIF-VKIFFQELCEY 592



>gb:AE014134_1129597 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003659_1219704 Drosophila melanogaster
            chromosome 2L, section 68 of 83 of the complete sequence.
          Length = 1330

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 34/135 (25%), Positives = 70/135 (51%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            +L   S  DY +   KL+++ L   Q+ E+  + L+CC +++ + K+Y  LA + C  +K
Sbjct: 716  YLTINSSLDYEECAHKLMKMQLKPGQEIELCHMFLDCCAEQRTYEKFYGLLAQRFCNINK 775

Query: 200  NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
             +    +    D ++    ++  R  ++SKF A +L +  +S  VL+ + L +    +  
Sbjct: 776  IYIPPFEEIFKDTYQTTHRLDTNRLRNVSKFFAHLLFTDAISWDVLECIQLNEDDTTSSS 835

Query: 380  RIMHFRMLFEAIFEF 424
            RI   ++LF+ + E+
Sbjct: 836  RIF-IKILFQELAEY 849



>gb:AY325221_1177890 Rattus norvegicus Ac2-155 mRNA, complete cds.
          Length = 879

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 30/130 (23%), Positives = 69/130 (53%)
 Frame = +2

Query: 35  SGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDKNHKFT 214
           S  D+ +   KLL+++    Q +E+  ++L+CC Q++ + K++  LA + C   K +  +
Sbjct: 440 SXXDFEECVHKLLKMEFAESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKKEYMES 499

Query: 215 LQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPKRIMHF 394
            +    + +  +  +E  +  +++K  A +L + +L  SVL+ + L + T  +  RI   
Sbjct: 500 FESIFKEQYNTIHRLETNKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSSRIF-V 558

Query: 395 RMLFEAIFEF 424
           ++ F+ + E+
Sbjct: 559 KIFFQELCEY 568



>gb:BC003993_2089515 Mus musculus cDNA sequence BC003993, mRNA (cDNA
           clone MGC:7531 IMAGE:3492146), complete cds.
          Length = 629

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 30/135 (22%), Positives = 71/135 (52%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++    Q +E+  ++ +CC Q++ + K++  LA + C   K
Sbjct: 185 YLAIQSSLDFEECAHKLLKMEFAESQTKELCNMIPDCCAQQRTYEKFFGLLAGRFCMLKK 244

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            +  + +    + +  +  +E+ +  +++K  A +L + +L  SVL+ + L + T  +  
Sbjct: 245 EYMESFESIFKEQYDTIHRLEINKLRNVAKMFAHLLYTDSLPWSVLECIKLSEETTTSSS 304

Query: 380 RIMHFRMLFEAIFEF 424
           RI   ++ F+ + E+
Sbjct: 305 RIF-VKIFFQELCEY 318



>gb:CR380953_1650654 Candida glabrata strain CBS138 chromosome G
            complete sequence.
          Length = 1196

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 40/131 (30%), Positives = 61/131 (46%), Gaps = 24/131 (18%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQE---KVFNKYYCALASKLCG 190
            F+  MS +DY+DA  K+ +L+L  KQ  E+ +V++ C L E     +N YY  +A+KLC 
Sbjct: 946  FVSIMSAQDYVDASSKIEKLNLKNKQLVEVPKVIMHCLLSESGKSGYNPYYYLVANKLCE 1005

Query: 191  HDKNHKFTLQYCLWDHFKEV---------------------ESMELMRSMHLSKFIAEML 307
             + + +   Q+  WD  K                       E+  L R++   KF   M+
Sbjct: 1006 LNGHLQKPFQFLFWDILKRFEDNSSYDSDEDDLIDDSEDVDENTALKRTISQGKFFGSMI 1065

Query: 308  ASYTLSLSVLK 340
            A   L L VLK
Sbjct: 1066 AEQILKLDVLK 1076



>gb:CNS09S4S_1648241 DNA centromeric region sequence from BAC DP26B06,
            DP34F04, DP16D11, DP09G08, DP35C12 of chromosome 5 of
            Podospora anserina.
          Length = 910

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 40/138 (28%), Positives = 72/138 (52%), Gaps = 18/138 (13%)
 Frame = +2

Query: 14   SNFLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGH 193
            S F+  +S  D  DA+ ++L+L L  ++ REI  V+ +C   EK +N YY  +A K+C +
Sbjct: 686  SIFVTILSALDVQDAYIRILKLRLNKERQREIATVITKCVGAEKHYNPYYTLIARKVCEN 745

Query: 194  DKNHKFTLQYCLWDHF------------KEVESMEL------MRSMHLSKFIAEMLASYT 319
             +  K++ Q CLW  F            +E+E  EL       R ++ +K +  ++AS  
Sbjct: 746  MREVKWSFQTCLWKMFGRMGETGFVEEDEELEEEELEEEFSTQRLINTAKMVGSLIASGH 805

Query: 320  LSLSVLKVVDLGDVTQLT 373
            +SL  ++ ++L  + + T
Sbjct: 806  MSLIAIRRLNLAYLQKRT 823



>gb:CR382122_1655071 Kluyveromyces lactis strain NRRL Y-1140
            chromosome B of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1051

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 49/159 (30%), Positives = 68/159 (42%), Gaps = 26/159 (16%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKV---FNKYYCALASKLCG 190
            F+  MS EDY+DAF K+ +L+L  KQ  +I RVLL C   +     +N YY  LA KL  
Sbjct: 801  FVSIMSAEDYLDAFAKIEKLNLKSKQSLDISRVLLHCLSNDGTSSGYNPYYSLLAGKLSE 860

Query: 191  HDKNHKF--TLQYCLWDHFKEV---------------------ESMELMRSMHLSKFIAE 301
            H  NHK   + Q+  W+  K+                      E   L R     +F   
Sbjct: 861  H--NHKLLKSFQFLFWEIVKKFELETHSDDEEDTLFSNEDTVDEDTRLQRLAKQGRFFGH 918

Query: 302  MLASYTLSLSVLKVVDLGDVTQLTPKRIMHFRMLFEAIF 418
            ++A   L L   K V L  +  L    I+ F +L   +F
Sbjct: 919  LIAEGHLKLDAFKHVPL--MAGLNSDGIIFFDILLFQLF 955



>gb:LMFL5341_1388174 Leishmania major Friedlin chromosome 19 cosmid
            L5341.
          Length = 895

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 39/148 (26%), Positives = 72/148 (48%), Gaps = 4/148 (2%)
 Frame = +2

Query: 20   FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
            F C  +  D ++ F  L+  D    +  ++  VLL+C  QE+ +N YY  +  + C    
Sbjct: 610  FRCIATAADGLECFTMLMYRDPGYTRFHDVCAVLLQCVYQERKYNPYYVQVLMRFCSAKP 669

Query: 200  NHKFTLQYCLWDHFK--EVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLT 373
                TLQ+ +WD FK   +E+ ++   ++ +  IA+++     +LS+L+ +DL    + T
Sbjct: 670  ACAKTLQFAIWDRFKSIRIENTDIAGYLNFACGIADLMQHGVYNLSLLRGLDL----ENT 725

Query: 374  PKRIMHF--RMLFEAIFEFPDKLVWNIF 451
             K I  F   +L   I + P   +  +F
Sbjct: 726  NKTIGLFTRMLLLRLILQLPASRLTQLF 753



>gb:AE017346_1757170 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 831

 Score = 58.2 bits (139), Expect = 2e-07
 Identities = 30/134 (22%), Positives = 68/134 (50%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L  M+  ++ +A  KL+++++P  ++ E+  +++ECC QE+ ++ +Y  +  + C   +
Sbjct: 466 YLTIMNSLNFEEAVHKLMKVNIPEGREIELCNMVIECCSQERTYSNFYGLIGERFCKLHR 525

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
                 Q     ++  +   E  +  ++ +F   +LAS  +S +VL VV + +    +  
Sbjct: 526 IWTDAFQEAFQKYYDTIHRYETNKLRNIGRFFGHLLASDGISWAVLHVVHMNEEETTSSS 585

Query: 380 RIMHFRMLFEAIFE 421
           RI    +L E + E
Sbjct: 586 RIFVKIVLQEMVEE 599



>pir|T21688|T21688 hypothetical protein F33A8.1 - Caenorhabditis
           elegans>gb:CEF33A8_1363322 Caenorhabditis elegans cosmid
           F33A8, complete sequence.>gb:CEU19615_1368430
           Caenorhabditis elegans Nucampholin (let-858) mRNA,
           complete cds.
          Length = 897

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 27/134 (20%), Positives = 67/134 (50%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  DY +A  KLL++ +P     E+  +L++CC Q++ + ++Y  L  + C    
Sbjct: 491 YLTMQSSLDYQEAAHKLLKMKIPDSMQNELCAMLVDCCAQQRTYERFYGMLIERFCRLRL 550

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPK 379
            ++   +    D +  +  +++ +  +L++ IA +L++  +   +L  + + +    +  
Sbjct: 551 EYQQYFEKLCQDTYSTIHRIDITKLRNLARLIAHLLSTDAIDWKILADMKMTEEDTTSSG 610

Query: 380 RIMHFRMLFEAIFE 421
           RI + + +F  + E
Sbjct: 611 RI-YIKYIFNELVE 623



>gb:AE016820_1749600 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 554

 Score = 55.8 bits (133), Expect = 9e-07
 Identities = 31/121 (25%), Positives = 61/121 (50%)
 Frame = +2

Query: 53  DAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDKNHKFTLQYCLW 232
           +A  KLL+L     Q   I+ ++++ C QE+ + K+Y  LA +LCG  +N   +      
Sbjct: 297 EAAHKLLKLRPDASQKATIVEIVVKACAQEQTYTKFYGILAERLCGSHRNWPTSFTNLFR 356

Query: 233 DHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPKRIMHFRMLFEA 412
           D +  +   E  +  ++ KF   MLA+  + L++ + V L +  + TP   +  + +F+ 
Sbjct: 357 DLYGTLHEFEPNQLRNMGKFWGHMLAADHIGLNLFECVHLSE-HRTTPSSRVFLKFIFQE 415

Query: 413 I 415
           +
Sbjct: 416 L 416



>gb:AK025635_1910353 Homo sapiens cDNA: FLJ21982 fis, clone
           HEP06188.
          Length = 567

 Score = 53.1 bits (126), Expect = 6e-06
 Identities = 24/101 (23%), Positives = 53/101 (52%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           +L   S  D+ +   KLL+++ P  Q +E+  ++L+CC Q++ + K++  LA + C   K
Sbjct: 460 YLAIQSSLDFEECAHKLLKMEFPESQTKELCNMILDCCAQQRTYEKFFGLLAGRFCMLKK 519

Query: 200 NHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTL 322
            +  + +    + +  +  +E  +  +++K  A +   YTL
Sbjct: 520 EYMESFEGIFKEQYDTIHRLETNKLRNVAKVFAHL---YTL 557



>gb:CR382130_1663170 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 954

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 26/98 (26%), Positives = 47/98 (47%)
 Frame = +2

Query: 92  KQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDKNHKFTLQYCLWDHFKEVESMELMR 271
           K+ +E+  +L+ECC QEK++NK Y     +L    +  +   +      +  +   E  +
Sbjct: 562 KRTQEVTNMLVECCAQEKIYNKIYGGTGERLLRLSREWRTNFENTFGFFYSVIHRYEPNQ 621

Query: 272 SMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPKRI 385
             +++ F   +LAS +LS  VL+ V L +       RI
Sbjct: 622 IRNIATFFGYLLASDSLSWKVLEAVSLTEEDSNPSNRI 659



>gb:CR382135_1668301 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 637

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 24/113 (21%), Positives = 52/113 (46%), Gaps = 6/113 (5%)
 Frame = +2

Query: 8   EESNFLCNMSGEDYIDAFEKLLRLDLPGKQDRE------IMRVLLECCLQEKVFNKYYCA 169
           +++ +L  MS     +A  KL++L+     + +      ++ ++++CC QEK ++KYY  
Sbjct: 333 QKTVYLTVMSSMSSDEAVHKLIKLNFKKSNEEKYKNNEILVDMIIKCCSQEKTYSKYYGV 392

Query: 170 LASKLCGHDKNHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSL 328
           +  KLC  +K            ++  +   E     ++ KF   + A   L++
Sbjct: 393 IGEKLCSMNKLWHTIFIDTFKKYYSTIHQFETNSLRNIGKFFGHLFALDKLAI 445



>sp|P53333|YG5U_YEAST Hypothetical 67.3 kDa protein in TAF145-YOR1
           intergenic region.>pir|S64613|S64613 probable membrane
           protein YGR278w - yeast (Saccharomyces
           cerevisiae)>gb:SCYGR278W_1712526 S.cerevisiae chromosome
           VII reading frame ORF YGR278w.
          Length = 577

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 26/130 (20%), Positives = 66/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 29  NMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDKNHK 208
           ++SG++   A  KLL+L +     + ++ ++++  LQE  F+K+Y  L+ ++    ++ +
Sbjct: 302 SLSGDE---AAHKLLKLKIANNLKKSVVDIIIKSSLQESTFSKFYSILSERMITFHRSWQ 358

Query: 209 FTLQYCLWDHF-KEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPKRI 385
                    ++ +++E  E  +   L KF   +++   L +  LK++ L +  +  P+  
Sbjct: 359 TAYNETFEQNYTQDIEDYETDQLRILGKFWGHLISYEFLPMDCLKIIKLTE-EESCPQGR 417

Query: 386 MHFRMLFEAI 415
           +  + LF+ +
Sbjct: 418 IFIKFLFQEL 427



>gb:CR382123_1656090 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 529

 Score = 41.6 bits (96), Expect = 0.017
 Identities = 26/127 (20%), Positives = 58/127 (45%)
 Frame = +2

Query: 29  NMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDKNHK 208
           ++SG++   A  KLL+L L   +  E+   + + C QE  ++K+Y  L  +L     + +
Sbjct: 289 SLSGDE---AAHKLLQLRLNDAKKNEVADTITKACAQEPTYSKFYGILTERLTSFHVSWQ 345

Query: 209 FTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYTLSLSVLKVVDLGDVTQLTPKRIM 388
            +      ++++ +   +     +L KF    LA+  +   V ++V + +       R+ 
Sbjct: 346 HSFSAVFKENYQTIADNDPSNIRNLGKFWGHALATECIPFEVFEIVHMNERDSNAANRVF 405

Query: 389 HFRMLFE 409
             + LF+
Sbjct: 406 -LKFLFQ 411



>gb:AE016815_1746269 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 981

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
 Frame = +2

Query: 20  FLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKV---FNKYYCALA-SKLC 187
           F+  MS  DY+DAF KL +L+L  KQ  E+ +VL+ C          N YY  L   +  
Sbjct: 734 FISIMSAHDYMDAFTKLEKLNLKNKQSLEVPKVLVHCLSVPSAPAGHNPYYSLLRWQESA 793

Query: 188 GHDKNHKFTLQYCLWDHFKEVES 256
            +      + Q+  W+  ++ E+
Sbjct: 794 NNTIPSAKSFQFLFWNIMRKFEN 816



>gb:CR382126_1659563 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 556

 Score = 34.3 bits (77), Expect = 2.8
 Identities = 44/203 (21%), Positives = 92/203 (45%), Gaps = 24/203 (11%)
 Frame = +2

Query: 2   RCEESNFLCNMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQ-EKVFNKY------ 160
           +  ++N   N S    ++  EK+L L++  + D  + + + EC ++ +++ N+       
Sbjct: 226 KLSQNNEDLNDSKLSLLEVAEKVLSLNVQNEPDVILQQSVQECQMEVQRLCNELSLTVPV 285

Query: 161 -------YCALASKLCGHDKNHKFTLQYCLWDHFKEVESMELMRSMHLSKFIAEMLASYT 319
                  +    SKL  +D  +KFT +Y  +  + + +S E++ ++  S+  A +  S  
Sbjct: 286 LHTTTRSHSLTLSKL--NDYYNKFTTEYYNYT-YHQAKSNEIIHTLVRSQRKA-LSVSIN 341

Query: 320 LSLSVLKVV-----DLGDVTQLTPKRIMHFRMLFEAIFEFPDKLVWNIFTRIALPEHESL 484
           +S+ ++  V      L  V ++TP +  H  +       F    +WN F  +A+  H ++
Sbjct: 342 ISVKIMGFVLVFMSVLVFVLEITPIKFGHASI-------FMGTSIWNFFLEMAILLHNTI 394

Query: 485 CN-----GIVIFIREYVANGNKS 538
           C+      + I     V+NGN S
Sbjct: 395 CSLYSLLHVKIHNFHLVSNGNSS 417



>gb:DRAJ5029_2570994 Danio rerio mRNA for Eph-like receptor tyrosine
           kinase rtk8.
          Length = 976

 Score = 33.1 bits (74), Expect = 6.2
 Identities = 16/52 (30%), Positives = 30/52 (57%)
 Frame = +2

Query: 29  NMSGEDYIDAFEKLLRLDLPGKQDREIMRVLLECCLQEKVFNKYYCALASKL 184
           +MS +D I+A E+  RL  P +    + +++L+C  +E+     +CA+ S L
Sbjct: 821 DMSNQDVINAIEQDYRLPPPPECPASLHQLMLDCWQKERSSRPRFCAIVSAL 872



>gb:BC027875_1978980 Homo sapiens myosin XVB, pseudogene, mRNA (cDNA
           clone MGC:34148 IMAGE:5205535), complete cds.
          Length = 487

 Score = 33.1 bits (74), Expect = 6.2
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = +2

Query: 89  GKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           GK + +++  LL+ C QEK+ ++ YC +  ++ GH +
Sbjct: 73  GKDEMDLLYELLKLCQQEKLRDEIYCQVIKQVTGHPR 109



>gb:AK026339_1910609 Homo sapiens cDNA: FLJ22686 fis, clone
           HSI10987.
          Length = 487

 Score = 33.1 bits (74), Expect = 6.2
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = +2

Query: 89  GKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           GK + +++  LL+ C QEK+ ++ YC +  ++ GH +
Sbjct: 73  GKDEMDLLYELLKLCQQEKLRDEIYCQVIKQVTGHPR 109



>gb:HSM803107_1186908 Homo sapiens mRNA; cDNA DKFZp667C0210 (from
           clone DKFZp667C0210).
          Length = 461

 Score = 33.1 bits (74), Expect = 6.2
 Identities = 12/37 (32%), Positives = 24/37 (64%)
 Frame = +2

Query: 89  GKQDREIMRVLLECCLQEKVFNKYYCALASKLCGHDK 199
           GK + +++  LL+ C QEK+ ++ YC +  ++ GH +
Sbjct: 47  GKDEMDLLYELLKLCQQEKLRDEIYCQVIKQVTGHPR 83



>pir|T00568|T00568 hypothetical protein At2g39580 [imported] -
           Arabidopsis thaliana>gb:AC004218_1531543 Arabidopsis
           thaliana chromosome 2 clone F12L6 map CIC10A06, complete
           sequence.
          Length = 1567

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 19/65 (29%), Positives = 28/65 (43%), Gaps = 4/65 (6%)
 Frame = +2

Query: 98  DREIMRVLLECCLQEKVFNKYYCAL----ASKLCGHDKNHKFTLQYCLWDHFKEVESMEL 265
           D+   R L E  + EK    Y C L    +  LC ++   +     C W HFK+     L
Sbjct: 776 DKRQCRSLTETIVYEKKIGFYTCNLKVDPSWPLCMYELRGRCNNDECSWQHFKDFSDDSL 835

Query: 266 MRSMH 280
            +S+H
Sbjct: 836 HQSLH 840


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 774,891,705
Number of Sequences: 1806583
Number of extensions: 15427936
Number of successful extensions: 31695
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 30832
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31679
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51696623407
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)