BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12258
         (1168 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:ATAC012328_1543409 Arabidopsis thaliana chromosome III BAC T1...   291   1e-77   
gb:AC133333_1741340 Oryza sativa chromosome 3 BAC OJ1785_A05 gen...   238   2e-61   
gb:AC133003_1741248 Oryza sativa chromosome 3 BAC OSJNBa0010D22 ...   238   2e-61   
gb:AP005782_1857755 Oryza sativa (japonica cultivar-group) genom...   227   3e-58   
gb:AF187317_1775183 Arabidopsis thaliana CAF protein (CAF) mRNA,...   196   6e-49   
sp|Q9SP32|DICE_ARATH|DICE_ARATH Endoribonuclease Dicer homolog (EC 3.1.26.-...   196   6e-49   Arabidopsis thaliana [mouse-ear cress]
gb:AC105363_1737955 Oryza sativa (japonica cultivar-group) chrom...   195   2e-48   
gb:OSJN00068_1694251 Oryza sativa genomic DNA, chromosome 4, BAC...   189   9e-47   
gb:AE005172_889156 Arabidopsis thaliana chromosome 1, top arm co...   182   1e-44   
gb:AE016959_1023161 Oryza sativa (japonica cultivar-group) chrom...   179   1e-43   
gb:AP003416_1829165 Oryza sativa (japonica cultivar-group) genom...   169   8e-41   
pir|T48946|T48946 hypothetical protein T15B3.60 - Arabidopsis th...   166   8e-40   Arabidopsis thaliana [mouse-ear cress]
gb:AY050230_1289943 Drosophila melanogaster SD01621 full length ...   150   6e-35   
gb:AE014297_1140875 Drosophila melanogaster chromosome 3R, compl...   150   6e-35   
gb:AY386319_2531051 Danio rerio Dicer1 (dicer1) mRNA, partial cds.    143   8e-33   
pir|S44849|S44849 K12H4.8 protein - Caenorhabditis elegans            139   1e-31   Caenorhabditis elegans [roundworm]
sp|P34529|DCR1_CAEEL|DCR1_CAEEL Endoribonuclease dcr-1 (EC 3.1.26.-).>gb:L1...   139   1e-31   Caenorhabditis elegans [roundworm]
gb:AP005914_1860046 Oryza sativa (japonica cultivar-group) genom...   135   2e-30   
gb:AY239359_1312355 Anopheles gambiae strain G3 dicer-1 mRNA, co...   131   3e-29   
gb:AK129241_2069472 Mus musculus mRNA for mKIAA0928 protein.          129   9e-29   
gb:AF484523_2066919 Mus musculus endoribonuclease Dicer (Dicer) ...   129   9e-29   
gb:AF430845_2065648 Mus musculus dicer-like protein (Dicer1) mRN...   129   9e-29   
sp|Q8R418|DICE_MOUSE|DICE_MOUSE Endoribonuclease Dicer (EC 3.1.26.-) (Doubl...   129   9e-29   Mus musculus [mouse]
gb:AB081470_2047705 Mus musculus mRNA for double-strand-specific...   129   1e-28   
gb:AY386968_1429974 Bos taurus dicer (dicer) mRNA, complete cds.      126   1e-27   
gb:AB023145_1865467 Homo sapiens mRNA for KIAA0928 protein, part...   125   1e-27   
gb:AX877989_1477248 Sequence 12894 from Patent EP1074617.             125   1e-27   
gb:AX287264_1465307 Sequence 1 from Patent WO0168836.>gb:AB02844...   125   1e-27   
gb:HSM801262_1186110 Homo sapiens mRNA; cDNA DKFZp434A0427 (from...   125   1e-27   
pir|T34544|T34544 hypothetical protein DKFZp434A0427.1 - human (...   125   1e-27   Homo sapiens [man]
sp|Q9UPY3|DICE_HUMAN|DICE_HUMAN Endoribonuclease Dicer (EC 3.1.26.-) (Helic...   125   1e-27   Homo sapiens [man]
gb:AB024036_1515857 Arabidopsis thaliana genomic DNA, chromosome...   112   1e-23   
gb:AY042815_1560880 Arabidopsis thaliana Unknown protein (MQC12....   112   2e-23   
gb:BT011073_1357680 Drosophila melanogaster SD11113 full insert ...    99   2e-19   
gb:AB073024_1197454 Drosophila melanogaster dcr-2 mRNA for doubl...    99   2e-19   
gb:AE013599_1132453 Drosophila melanogaster chromosome 2R, compl...    99   2e-19   
pir|G71418|G71418 hypothetical protein - Arabidopsis thaliana>gb...    99   2e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AB012240_1511680 Arabidopsis thaliana genomic DNA, chromosome...    97   5e-19   
gb:SPCC188_1721124 S.pombe chromosome III cosmid c188.                 96   1e-18   
sp|Q09884|YQ3D_SCHPO|YQ3D_SCHPO Putative helicase C188.13c (EC 3.6.1.-).>pi...    96   1e-18   Schizosaccharomyces pombe
gb:AC115634_1739216 Oryza sativa (japonica cultivar-group) chrom...    92   2e-17   
gb:AP003933_1835453 Oryza sativa (japonica cultivar-group) genom...    88   3e-16   
sp|P74368|RNC_SYNY3|RNC_SYNY3 Ribonuclease III (EC 3.1.26.3) (RNase III).>...    79   1e-13   Synechocystis sp.
gb:BX571662_779163 Wolinella succinogenes, complete genome; segm...    78   3e-13   
sp|O84299|RNC_CHLTR|RNC_CHLTR Ribonuclease III (EC 3.1.26.3) (RNase III).>...    78   4e-13   Chlamydia trachomatis
gb:BX640418_806831 Bordetella pertussis strain Tohama I, complet...    77   5e-13   
gb:AY658047_2147057 Synthetic construct Peudomonas aeruginosa cl...    76   1e-12   
gb:AB182481_1202518 Tetrahymena thermophila DCL1 mRNA for Dicer-...    76   1e-12   
sp|Q9XCX9|RNC_PSEAE|RNC_PSEAE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    76   1e-12   Pseudomonas aeruginosa
gb:BX321864_774653 Nitrosomonas europaea ATCC 19718, complete ge...    76   1e-12   
gb:AE017340_456572 Idiomarina loihiensis L2TR, complete genome.        76   1e-12   
gb:AE017157_393400 Chlamydophila pneumoniae TW-183, section 1 of...    75   2e-12   
sp|Q9Z9C7|RNC_CHLPN|RNC_CHLPN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    75   2e-12   Chlamydia pneumoniae
sp|Q98514|A464_CHVP1|A464_CHVP1 Putative protein A464R.>pir|T17966|T17966 r...    75   2e-12   Paramecium bursaria Chlorella virus 1
sp|Q9PK97|RNC_CHLMU|RNC_CHLMU Ribonuclease III (EC 3.1.26.3) (RNase III).>...    75   3e-12   Chlamydia muridarum [agent of mouse pneumonitis]
gb:AJ749949_532012 Francisella tularensis subsp. tularensis comp...    74   6e-12   
gb:CR628337_115034 Legionella pneumophila str. Lens complete gen...    74   6e-12   
sp|Q87XG1|RNC_PSESM|RNC_PSESM Ribonuclease III (EC 3.1.26.3) (RNase III).>...    74   7e-12   Pseudomonas syringae pv. tomato
sp|Q823R4|RNC_CHLCV|RNC_CHLCV Ribonuclease III (EC 3.1.26.3) (RNase III).>...    74   7e-12   Chlamydia caviae
gb:AE017282_428217 Methylococcus capsulatus str. Bath, complete ...    73   1e-11   
gb:CR628336_111950 Legionella pneumophila str. Paris complete ge...    73   1e-11   
sp|P57805|RNC_PASMU|RNC_PASMU Ribonuclease III (EC 3.1.26.3) (RNase III).>...    73   1e-11   Pasteurella multocida
sp|Q819V8|RNC_BACCR|RNC_BACCR Ribonuclease III (EC 3.1.26.3) (RNase III).>...    73   1e-11   Bacillus cereus
gb:AB182480_1202517 Tetrahymena thermophila DCR2 mRNA for Dicer-...    73   1e-11   
sp|Q8KAN7|RNC_CHLTE|RNC_CHLTE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    72   2e-11   Chlorobaculum tepidum
gb:AY458647_620010 Uncultured bacterium 580 clone EBAC000-36A07 ...    72   2e-11   
sp|Q9ZBQ7|RNC_STRCO|RNC_STRCO Ribonuclease III (EC 3.1.26.3) (RNase III).>...    72   2e-11   
gb:AE017328_444253 Listeria monocytogenes str. 4b F2365, section...    71   4e-11   
gb:CR555306_108559 Azoarcus sp. EbN1 complete genome.                  71   4e-11   
gb:AP006840_568642 Symbiobacterium thermophilum DNA, complete ge...    71   5e-11   
gb:AE017276_425095 Bacillus cereus ATCC 10987, section 13 of 18 ...    70   6e-11   
sp|Q81WI8|RNC_BACAN|RNC_BACAN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    70   6e-11   Bacillus anthracis [anthrax]
gb:BA000030_700551 Streptomyces avermitilis MA-4680 genomic DNA,...    70   8e-11   
gb:AE017354_460228 Legionella pneumophila subsp. pneumophila str...    70   8e-11   
gb:AE008692_241113 Zymomonas mobilis subsp. mobilis ZM4, complet...    70   8e-11   
gb:CP000001_854210 Bacillus cereus ZK, complete genome.                70   1e-10   
sp|Q9Z5U2|RNC_ZYMMO|RNC_ZYMMO Ribonuclease III (EC 3.1.26.3) (RNase III).>...    70   1e-10   Zymomonas mobilis subsp. mobilis
sp|Q9PM40|RNC_CAMJE|RNC_CAMJE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    70   1e-10   
sp|Q9KPB2|RNC_VIBCH|RNC_VIBCH Ribonuclease III (EC 3.1.26.3) (RNase III).>...    69   1e-10   
gb:AE017155_392988 Haemophilus ducreyi strain 35000HP section 5 ...    69   2e-10   
sp|Q99UN7|RNC_STAAN|RNC_STAAN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    69   2e-10   Staphylococcus aureus
sp|Q931T1|RNC_STAAM|RNC_STAAM Ribonuclease III (EC 3.1.26.3) (RNase III).>...    69   2e-10   Staphylococcus aureus
gb:BX908798_829830 Parachlamydia-related symbiont UWE25, complet...    69   2e-10   
gb:AE016827_341997 Mannheimia succiniciproducens MBEL55E, comple...    69   2e-10   
gb:CP000033_89542 Lactobacillus acidophilus NCFM, complete genome.     69   2e-10   
sp|Q87C06|RNC_XYLFT|RNC_XYLFT Ribonuclease III (EC 3.1.26.3) (RNase III).>...    69   2e-10   Xylella fastidiosa
sp|Q8Y691|RNC_LISMO|RNC_LISMO Ribonuclease III (EC 3.1.26.3) (RNase III).>...    69   2e-10   
sp|Q92AK3|RNC_LISIN|RNC_LISIN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    69   2e-10   
gb:CP000025_879530 Campylobacter jejuni RM1221, complete genome.       68   3e-10   
gb:CP000020_872263 Vibrio fischeri ES114 chromosome I, complete ...    68   3e-10   
sp|Q9PB98|RNC_XYLFA|RNC_XYLFA Ribonuclease III (EC 3.1.26.3) (RNase III).        68   3e-10   Xylella fastidiosa
sp|Q9KA05|RNC_BACHD|RNC_BACHD Ribonuclease III (EC 3.1.26.3) (RNase III).>...    68   3e-10   Bacillus halodurans
gb:BA000037_723657 Vibrio vulnificus YJ016 DNA, chromosome I, co...    68   4e-10   
gb:AE017321_441735 Wolbachia endosymbiont strain TRS of Brugia m...    68   4e-10   
sp|Q8DC76|RNC_VIBVU|RNC_VIBVU Ribonuclease III (EC 3.1.26.3) (RNase III).>...    68   4e-10   Vibrio vulnificus
sp|Q8K9R1|RNC_BUCAP|RNC_BUCAP Ribonuclease III (EC 3.1.26.3) (RNase III).>...    68   4e-10   
gb:BX842651_824822 Bdellovibrio bacteriovorus complete genome, s...    67   5e-10   
gb:BX572601_802310 Rhodopseudomonas palustris CGA009 complete ge...    67   5e-10   
gb:AE017260_418939 Wolbachia endosymbiont of Drosophila melanoga...    67   5e-10   
sp|Q8ZD72|RNC_YERPE|RNC_YERPE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    67   5e-10   Yersinia pestis
sp|Q8PB52|RNC_XANCP|RNC_XANCP Ribonuclease III (EC 3.1.26.3) (RNase III).>...    67   5e-10   Xanthomonas campestris pv. campestris
sp|Q92JB0|RNC_RICCN|RNC_RICCN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    67   5e-10   Rickettsia conorii
sp|Q8RGX3|RNC_FUSNN|RNC_FUSNN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    67   5e-10   Fusobacterium nucleatum subsp. nucleatum
sp|Q8XJN8|RNC_CLOPE|RNC_CLOPE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    67   5e-10   Clostridium perfringens
gb:AE016917_357027 Chromobacterium violaceum ATCC 12472 section ...    67   7e-10   
gb:BX294141_767744 Pirellula sp. strain 1 complete genome; segme...    67   9e-10   
gb:AE017204_404678 Lactobacillus johnsonii NCC 533, section 5 of...    67   9e-10   
gb:BA000043_737769 Geobacillus kaustophilus HTA426 DNA, complete...    66   1e-09   
gb:BX950851_842013 Erwinia carotovora subsp. atroseptica SCRI104...    66   2e-09   
gb:CP000030_83865 Anaplasma marginale str. St. Maries, complete ...    66   2e-09   
gb:AE004969_60039 Neisseria gonorrhoeae FA 1090, complete genome.      66   2e-09   
sp|Q9K0C8|RNC_NEIMB|RNC_NEIMB Ribonuclease III (EC 3.1.26.3) (RNase III).>...    66   2e-09   Neisseria meningitidis serogroup B
sp|P44441|RNC_HAEIN|RNC_HAEIN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    66   2e-09   Haemophilus influenzae
gb:AF542975_520677 Yersinia enterocolitica rnc operon, partial s...    65   2e-09   
gb:AE016822_340078 Leifsonia xyli subsp. xyli str. CTCB07, compl...    65   2e-09   
gb:CR543861_104439 Acinetobacter sp. ADP1 complete genome.             65   2e-09   
pir|B97486|B97486 ribonuclease III (RNAse III) [imported] - Agro...    65   2e-09   Agrobacterium fabrum str. C58
sp|Q87LN9|RNC_VIBPA|RNC_VIBPA Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   2e-09   
sp|P57346|RNC_BUCAI|RNC_BUCAI Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   2e-09   
sp|Q8UGK2|RNC_AGRT5|RNC_AGRT5 Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   2e-09   Agrobacterium tumefaciens
gb:AF065159_475239 Bradyrhizobium japonicum putative arylsulfata...    65   3e-09   
gb:AE017333_447671 Bacillus licheniformis DSM 13, complete genome.     65   3e-09   
sp|Q8R9W3|RNC_THETN|RNC_THETN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   3e-09   
sp|Q88MY5|RNC_PSEPK|RNC_PSEPK Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   3e-09   Pseudomonas putida
gb:AX300293_1465434 Sequence 119 from Patent WO0185772.                65   3e-09   
gb:BA000040_733321 Bradyrhizobium japonicum USDA 110 DNA, comple...    65   3e-09   
gb:AE015579_315752 Shewanella oneidensis MR-1 section 128 of 457...    65   3e-09   
gb:D64116_120256 Bacillus subtilis genes for ORF1, ORF2, ORF3, O...    65   3e-09   
pir|S60767|S60767 ribonuclease III - Coxiella burnetii>gb:COXRER...    65   3e-09   Coxiella burnetii
sp|Q9ZE31|RNC_RICPR|RNC_RICPR Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   3e-09   Rickettsia prowazekii
sp|Q9JVD3|RNC_NEIMA|RNC_NEIMA Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   3e-09   
sp|P51837|RNC_COXBU|RNC_COXBU Ribonuclease III (EC 3.1.26.3) (RNase III).>...    65   3e-09   Coxiella burnetii
sp|O69161|RNC_BRAJA|RNC_BRAJA Ribonuclease III (EC 3.1.26.3) (RNase III).        65   3e-09   Bradyrhizobium japonicum
gb:CP000010_864953 Burkholderia mallei ATCC 23344 chromosome 1, ...    64   4e-09   
gb:BX571965_792220 Burkholderia pseudomallei strain K96243, chro...    64   4e-09   
gb:AP006627_564618 Bacillus clausii KSM-K16 DNA, complete genome.      64   4e-09   
sp|Q56056|RNC_SALTY|RNC_SALTY Ribonuclease III (EC 3.1.26.3) (RNase III).>...    64   4e-09   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q8Y0I1|RNC_RALSO|RNC_RALSO Ribonuclease III (EC 3.1.26.3) (RNase III).>...    64   4e-09   Ralstonia solanacearum
sp|P51833|RNC_BACSU|RNC_BACSU Ribonuclease III (EC 3.1.26.3) (RNase III).>...    64   4e-09   Bacillus subtilis
gb:AE013598_295556 Xanthomonas oryzae pv. oryzae KACC10331, comp...    64   6e-09   
sp|Q88WK0|RNC_LACPL|RNC_LACPL Ribonuclease III (EC 3.1.26.3) (RNase III).>...    64   6e-09   Lactobacillus plantarum
sp|P05797|RNC_ECOLI|RNC_ECOLI Ribonuclease III (EC 3.1.26.3) (RNase III).>...    64   6e-09   Escherichia coli [E. coli]
sp|Q97IA4|RNC_CLOAB|RNC_CLOAB Ribonuclease III (EC 3.1.26.3) (RNase III).>...    64   6e-09   Clostridium acetobutylicum
gb:AE014295_311682 Bifidobacterium longum NCC2705, complete genome.    64   8e-09   
sp|P59476|RNC_BUCBP|RNC_BUCBP Ribonuclease III (EC 3.1.26.3) (RNase III).>...    64   8e-09   
gb:AE017197_402012 Rickettsia typhi str. Wilmington complete gen...    63   1e-08   
sp|Q8PMV0|RNC_XANAC|RNC_XANAC Ribonuclease III (EC 3.1.26.3) (RNase III).>...    63   1e-08   Xanthomonas citri
gb:AE016956_367039 Enterococcus faecalis V583, section 10 of 11 ...    63   1e-08   
gb:AY714854_1189855 Uncultured archaeon GZfos32E4 clone GZfos32E...    62   2e-08   
sp|Q8Z4K4|RNC_SALTI|RNC_SALTI Ribonuclease III (EC 3.1.26.3) (RNase III).>...    62   2e-08   Salmonella enterica subsp. enterica serovar Typhi
gb:AY714866_1190303 Uncultured archaeon GZfos36D8 clone GZfos36D...    62   2e-08   
gb:CP000013_869934 Borrelia garinii PBi, complete genome.              62   2e-08   
gb:CP000029_81410 Staphylococcus epidermidis RP62A, complete gen...    62   2e-08   
pir|F82581|F82581 ribonuclease III XF2246 [imported] - Xylella f...    62   2e-08   Xylella fastidiosa
sp|Q8CPI1|RNC_STAEP|RNC_STAEP Ribonuclease III (EC 3.1.26.3) (RNase III).>...    62   2e-08   Staphylococcus epidermidis
gb:NCB14D6_1689355 Neurospora crassa DNA linkage group II BAC co...    62   3e-08   
gb:BX571870_788197 Photorhabdus luminescens subsp. laumondii TTO...    62   3e-08   
gb:CR925677_118105 Ehrlichia ruminantium str. Gardel, complete g...    62   3e-08   
sp|Q9X0I6|RNC_THEMA|RNC_THEMA Ribonuclease III (EC 3.1.26.3) (RNase III).>...    62   3e-08   Thermotoga maritima
gb:CR767821_117173 Ehrlichia ruminantium strain Welgevonden, com...    61   4e-08   
gb:CR378673_96382 Photobacterium profundum SS9; segment 11/12.         61   4e-08   
sp|O51648|RNC_BORBU|RNC_BORBU Ribonuclease III (EC 3.1.26.3) (RNase III).>...    61   4e-08   Borreliella burgdorferi
sp|O67082|RNC_AQUAE|RNC_AQUAE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    61   5e-08   Aquifex aeolicus
gb:AJ720721_2502908 Gallus gallus mRNA for hypothetical protein,...    60   6e-08   
gb:BC088999_2110660 Mus musculus ethanol induced 2, mRNA (cDNA c...    60   6e-08   
gb:BC060265_2103961 Mus musculus ethanol induced 2, mRNA (cDNA c...    60   6e-08   
gb:BC057687_2102885 Mus musculus ethanol induced 2, mRNA (cDNA c...    60   6e-08   
gb:BC055696_2102097 Mus musculus ethanol induced 2, mRNA (cDNA c...    60   6e-08   
gb:BC041162_1983005 Homo sapiens nuclear RNase III Drosha, mRNA ...    60   6e-08   
gb:AF116910_1884601 Homo sapiens clone HAW100 putative ribonucle...    60   6e-08   
gb:AX876043_1476348 Sequence 10948 from Patent EP1074617.>gb:AK0...    60   6e-08   
gb:AY714822_1188647 Uncultured archaeon GZfos17C7 clone GZfos17C...    60   6e-08   
gb:CR522870_100090 Desulfotalea psychrophila LSv54 chromosome.         60   6e-08   
sp|Q9NRR4|RNC_HUMAN|RNC_HUMAN Ribonuclease III (EC 3.1.26.3) (RNase III) (...    60   6e-08   Homo sapiens [man]
gb:BX248586_764140 Blochmannia floridanus complete genome; segme...    60   8e-08   
sp|Q8ER05|RNC_OCEIH|RNC_OCEIH Ribonuclease III (EC 3.1.26.3) (RNase III).>...    60   1e-07   Oceanobacillus iheyensis
gb:AF189011_1888744 Homo sapiens ribonuclease III (RN3) mRNA, co...    59   1e-07   
gb:AF440766_2065825 Mus musculus ribonuclease III (Rn3) mRNA, co...    59   2e-07   
sp|Q8Z023|RNC_ANASP|RNC_ANASP Ribonuclease III (EC 3.1.26.3) (RNase III).>...    58   3e-07   Anabaena sp.
gb:AE014983_313838 Streptococcus mutans UA159 section 131 of 185...    58   4e-07   
sp|Q8D305|RNC_WIGBR|RNC_WIGBR Ribonuclease III (EC 3.1.26.3) (RNase III).>...    58   4e-07   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
gb:AF533013_2067662 Mus musculus ribonuclease III mRNA, complete...    57   5e-07   
gb:AP006618_560582 Nocardia farcinica IFM 10152 DNA, complete ge...    57   5e-07   
sp|O83787|RNC_TREPA|RNC_TREPA Ribonuclease III (EC 3.1.26.3) (RNase III).>...    57   5e-07   Treponema pallidum
gb:BC050057_2100335 Mus musculus ethanol induced 2, mRNA (cDNA c...    57   7e-07   
gb:BX957223_844779 Methanococcus maripaludis S2 complete genome;...    57   7e-07   
gb:AE017146_390452 Helicobacter hepaticus ATCC 51449 section 3 o...    57   7e-07   
sp|Q53844|RNC_SPICI|RNC_SPICI Ribonuclease III (EC 3.1.26.3) (RNase III).>...    57   7e-07   Spiroplasma citri
gb:AE017283_431232 Propionibacterium acnes KPA171202, complete g...    57   9e-07   
gb:BX842643_822491 Mycoplasma mycoides subsp. mycoides SC genomi...    55   2e-06   
gb:AE017263_420784 Mesoplasma florum L1 complete genome.               55   2e-06   
gb:ECRNC1_132516 E. coli K12 (strain SB221) gene rnc for ribonuc...    55   2e-06   
gb:AE017237_413700 Mycobacterium avium subsp. paratuberculosis s...    55   3e-06   
gb:AE017314_439691 Desulfovibrio vulgaris subsp. vulgaris str. H...    55   4e-06   
gb:STU48415_193814 Salmonella typhimurium RNase III (rnc), G-pro...    55   4e-06   
sp|O69469|RNC_MYCLE|RNC_MYCLE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    55   4e-06   Mycobacterium leprae
gb:AY373464_2084294 Rattus norvegicus ribonuclease III-like prot...    54   5e-06   
sp|Q92R47|RNC_RHIME|RNC_RHIME Ribonuclease III (EC 3.1.26.3) (RNase III).>...    54   5e-06   Sinorhizobium meliloti
sp|Q10962|RNC_MYCTU|RNC_MYCTU Ribonuclease III (EC 3.1.26.3) (RNase III).>...    54   5e-06   Mycobacterium tuberculosis
gb:CP000003_860397 Streptococcus pyogenes MGAS10394, complete ge...    54   8e-06   
gb:AE014224_306044 Streptococcus agalactiae 2603V/R section 34 o...    54   8e-06   
gb:SAG766846_170272 Streptococcus agalactiae NEM316 complete gen...    54   8e-06   
gb:CR382134_1667178 Debaryomyces hansenii chromosome B of strain...    53   1e-05   
gb:BX897699_827136 Bartonella henselae strain Houston-1, complet...    53   1e-05   
gb:CP000027_80002 Dehalococcoides ethenogenes 195, complete genome.    53   1e-05   
sp|P47607|RNC_MYCGE|RNC_MYCGE Ribonuclease III (EC 3.1.26.3) (RNase III).>...    53   1e-05   Mycoplasma genitalium
gb:BX897700_828667 Bartonella quintana str. Toulouse, complete g...    53   1e-05   
sp|Q9A105|RNC_STRPY|RNC_STRPY Ribonuclease III (EC 3.1.26.3) (RNase III).>...    53   1e-05   Streptococcus pyogenes
sp|Q8YG74|RNC_BRUME|RNC_BRUME Ribonuclease III (EC 3.1.26.3) (RNase III).>...    53   1e-05   
gb:CP000023_875175 Streptococcus thermophilus LMG 18311, complet...    52   2e-05   
gb:BA000026_693716 Mycoplasma penetrans HF-2 DNA, complete genome.     52   2e-05   
pir|S77771|S77771 probable ribonuclease III (EC 3.1.26.3) - Myco...    52   2e-05   Mycoplasma capricolum
gb:AY653733_2371193 Mimivirus, complete genome.                        52   2e-05   
gb:AY051775_1290369 Drosophila melanogaster LD29995 full length ...    52   2e-05   
gb:AE013599_1130539 Drosophila melanogaster chromosome 2R, compl...    52   2e-05   
gb:BX251410_764403 Tropheryma whipplei TW08/27, complete genome;...    52   2e-05   
gb:AP006841_570744 Bacteroides fragilis YCH46 DNA, complete genome.    52   2e-05   
gb:AE017308_438034 Mycoplasma mobile 163K complete genome.             52   2e-05   
gb:AE016852_349086 Tropheryma whipplei str. Twist, section 3 of ...    52   2e-05   
sp|Q9ZLH2|RNC_HELPJ|RNC_HELPJ Ribonuclease III (EC 3.1.26.3) (RNase III).>...    52   2e-05   Helicobacter pylori
pir|F64602|F64602 ribonuclease III - Helicobacter pylori (strain...    51   4e-05   Helicobacter pylori
sp|P56118|RNC_HELPY|RNC_HELPY Ribonuclease III (EC 3.1.26.3) (RNase III).        51   4e-05   Helicobacter pylori
gb:AP006628_567043 Onion yellows phytoplasma OY-M DNA, complete ...    50   9e-05   
gb:AF533231_519871 Western X phytoplasma tRNA-Ser gene, complete...    50   1e-04   
gb:AE016969_369762 Mycoplasma gallisepticum strain R section 3 o...    49   1e-04   
pir|C90532|C90532 ribonuclease III (rnase III) [imported] - Myco...    49   1e-04   Mycoplasma pulmonis
sp|Q8NNV6|RNC_CORGL|RNC_CORGL Ribonuclease III (EC 3.1.26.3) (RNase III).>...    49   1e-04   Corynebacterium glutamicum
sp|Q9PQT8|RNC_UREPA|RNC_UREPA Ribonuclease III (EC 3.1.26.3) (RNase III).>...    49   2e-04   Ureaplasma parvum serovar 3
gb:BC054003_1985132 Homo sapiens nuclear RNase III Drosha, mRNA ...    49   3e-04   
sp|Q9CHD0|RNC_LACLA|RNC_LACLA Ribonuclease III (EC 3.1.26.3) (RNase III).>...    49   3e-04   Lactococcus lactis subsp. lactis
gb:AE017249_416073 Treponema denticola ATCC 35405, section 4 of ...    48   3e-04   
gb:AE015940_320373 Clostridium tetani E88, section 5 of 10 of th...    48   4e-04   
sp|P75233|RNC_MYCPN|RNC_MYCPN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    48   4e-04   Mycoplasma pneumoniae
gb:AF160248_1246101 Caenorhabditis elegans ribonuclease mRNA, pa...    47   6e-04   
gb:PMJ001135_158866 Prochlorococcus marinus genomic region for R...    47   6e-04   
pir|T21419|T21419 hypothetical protein F26E4.13 - Caenorhabditis...    47   6e-04   Caenorhabditis elegans [roundworm]
sp|O01326|RNC_CAEEL|RNC_CAEEL Ribonuclease III (EC 3.1.26.3) (RNase III).>...    47   6e-04   Caenorhabditis elegans [roundworm]
gb:BX569689_775054 Synechococcus sp. WH8102 complete genome; seg...    47   7e-04   
gb:BA000035_716759 Corynebacterium efficiens YS-314 DNA, complet...    47   7e-04   
gb:AE016940_362724 Bacteroides thetaiotaomicron VPI-5482, sectio...    47   7e-04   
gb:CP000031_87199 Silicibacter pomeroyi DSS-3, complete genome.        47   7e-04   
gb:CR380959_1653872 Candida glabrata strain CBS138 chromosome M ...    47   0.001   
gb:BX572094_797229 Prochlorococcus marinus MED4 complete genome;...    47   0.001   
gb:AE017180_400523 Geobacter sulfurreducens PCA, complete genome.      46   0.001   
gb:AE016819_1749373 Ashbya gossypii (= Eremothecium gossypii) AT...    46   0.002   
gb:AC116984_1207230 Dictyostelium discoideum chromosome 2 map 25...    45   0.002   
gb:AE017332_445669 Mycoplasma hyopneumoniae 232, complete genome.      45   0.002   
gb:AE017343_1755609 Cryptococcus neoformans var. neoformans JEC2...    45   0.003   
pir|F98012|F98012 ribonuclease III (EC 3.1.26.3) [imported] - St...    45   0.004   Streptococcus pneumoniae R6
sp|Q97QG6|RNC_STRPN|RNC_STRPN Ribonuclease III (EC 3.1.26.3) (RNase III).>...    45   0.004   
gb:AE011597_274680 Leptospira interrogans serovar lai str. 56601...    44   0.005   
gb:CR382129_1661787 Yarrowia lipolytica chromosome C of strain C...    44   0.006   
gb:BA000045_742723 Gloeobacter violaceus PCC 7421 DNA, complete ...    44   0.008   
gb:BX248358_762815 Corynebacterium diphtheriae gravis NCTC13129,...    43   0.011   
sp|Q55637|Y346_SYNY3|Y346_SYNY3 Hypothetical protein slr0346.>pir|S76301|S7...    43   0.011   Synechocystis sp.
gb:CR380955_1651929 Candida glabrata strain CBS138 chromosome I ...    42   0.018   
gb:AY142144_1303372 Giardia intestinalis putative bidentate RNas...    42   0.018   
gb:AY695821_1623521 Schizosaccharomyces pombe strain 2.1459 pac1...    42   0.024   
gb:AE017178_397904 Porphyromonas gingivalis W83 section 7 of 8 o...    42   0.024   
sp|P22192|PAC1_SCHPO|PAC1_SCHPO Double-strand-specific pac1 ribonuclease (E...    42   0.024   Schizosaccharomyces pombe
pir|T49432|T49432 Ribonuclease III related protein [imported] - ...    42   0.031   Neurospora crassa
gb:AE017346_1757513 Cryptococcus neoformans var. neoformans JEC2...    41   0.041   
gb:AY394484_2531664 Danio rerio dicer mRNA, partial cds.               41   0.053   
gb:AP008231_582136 Synechococcus elongatus PCC 6301 DNA, complet...    41   0.053   
pir|AD2319|AD2319 ribonuclease III [imported] - Nostoc sp. (stra...    41   0.053   Nostoc sp. PCC 7120
gb:AY647925_1619950 Arabidopsis lyrata subsp. petraea AT1G01040 ...    40   0.070   
gb:AE017343_1755608 Cryptococcus neoformans var. neoformans JEC2...    40   0.12    
gb:CR382126_1659449 Kluyveromyces lactis strain NRRL Y-1140 chro...    40   0.12    
gb:AF484524_2066920 Mus musculus x Mus spretus endoribonuclease ...    39   0.15    
gb:BX572100_799290 Prochlorococcus marinus MIT9313 complete geno...    38   0.35    
gb:SC9959_1706382 S.cerevisiae chromosome XIII cosmid 9959.            38   0.45    
gb:BA000012_672085 Mesorhizobium loti MAFF303099 DNA, complete g...    38   0.45    
sp|Q02555|RNT1_YEAST|RNT1_YEAST Ribonuclease III (EC 3.1.26.3) (RNase III)....    38   0.45    Saccharomyces cerevisiae [brewer's yeast]
gb:HSA132258_2000276 Homo sapiens mRNA for staufen protein, part...    36   1.3     
gb:AL133174_1918218 Human DNA sequence from clone RP3-470L14 on ...    36   1.3     
gb:AL133174_1918215 Human DNA sequence from clone RP3-470L14 on ...    36   1.3     
gb:AF061938_1879929 Homo sapiens staufen protein (STAU) mRNA, al...    36   1.3     
gb:HSM801575_1186268 Homo sapiens mRNA; cDNA DKFZp564J1516 (from...    36   1.3     
gb:CR860639_1184698 Pongo pygmaeus mRNA; cDNA DKFZp459A0124 (fro...    36   1.3     
sp|O95793|STAU_HUMAN|STAU_HUMAN Double-stranded RNA-binding protein Staufen...    36   1.3     
gb:AY380826_2339269 Lymphocystis disease virus - isolate China, ...    36   1.7     
pir|G85095|G85095 hypothetical protein AT4g09410 [imported] - Ar...    36   1.7     
sp|Q52698|RNC_RHOCA|RNC_RHOCA Ribonuclease III (EC 3.1.26.3) (RNase III).>...    36   1.7     
gb:AY394485_2531665 Oncorhynchus mykiss Dicer gene, partial cds....    35   2.2     
gb:AX877626_1477089 Sequence 12531 from Patent EP1074617.              35   3.8     
gb:AB098950_1410273 Bos taurus mRNA for similar to hypothetical ...    35   3.8     
gb:HSSONA_2020455 Homo sapiens son-a mRNA.                             34   5.0     
gb:AF380182_1899476 Homo sapiens SON DNA binding protein isoform...    34   5.0     
gb:AF380179_1899473 Homo sapiens SON DNA binding protein isoform...    34   5.0     
pir|T04745|T04745 hypothetical protein F6G17.160 - Arabidopsis t...    34   5.0     
gb:AY236058_601197 Ehrlichia ruminantium Welgevonden pCS20 regio...    34   6.5     
sp|Q9A805|RNC_CAUCR|RNC_CAUCR Ribonuclease III (EC 3.1.26.3) (RNase III).>...    34   6.5     
gb:BT008181_2151113 Synthetic construct Homo sapiens TAR (HIV) R...    33   8.5     
gb:HUMTRBP_2037861 Human TAR RNA binding protein (TRBP) mRNA, co...    33   8.5     
gb:HSU08998_2021916 Homo sapiens TAR RNA binding protein 2 (TRBP...    33   8.5     
gb:BC005860_1969888 Homo sapiens TAR (HIV) RNA binding protein 2...    33   8.5     
gb:DME271740_1379102 Drosophila melanogaster D-Titin gene, exons...    33   8.5     
gb:DME245406_1379000 Drosophila melanogaster partial kettin gene.      33   8.5     
gb:AB026845_1194400 Drosophila melanogaster mRNA for kettin, com...    33   8.5     
gb:AE014296_1134317 Drosophila melanogaster chromosome 3L, compl...    33   8.5     
gb:AE014296_1134316 Drosophila melanogaster chromosome 3L, compl...    33   8.5     
gb:AF205068_488272 Lactobacillus reuteri endogenous plasmid, com...    33   8.5     
pir|A38430|A38430 trans-activation-responsive RNA-binding protei...    33   8.5     
sp|Q15633|TRBP_HUMAN|TRBP_HUMAN TAR RNA-binding protein 2 (Trans-activation...    33   8.5     


>gb:ATAC012328_1543409 Arabidopsis thaliana chromosome III BAC T17B22
            genomic sequence, complete sequence.
          Length = 2042

 Score =  291 bits (746), Expect = 1e-77
 Identities = 154/301 (51%), Positives = 212/301 (70%), Gaps = 1/301 (0%)
 Frame = -3

Query: 1139 SGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFP 960
            S  +Y   RR +  +++ADV E+LIGA+LS  GE+AAL F+ W+G+ +DF    I  + P
Sbjct: 1735 SRNIYVASRRNLKRKSVADVVESLIGAYLSEGGELAALMFMNWVGIKVDFTTTKIQRDSP 1794

Query: 959  LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYA 783
            + AE++VNV  +ES  LLNY+F D SLLVEALTHGSY+ P   + YQRLEFLGD+VLDY 
Sbjct: 1795 IQAEKLVNVGYMES--LLNYSFEDKSLLVEALTHGSYMMPEIPRCYQRLEFLGDSVLDYL 1852

Query: 782  VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
            +T+H YD+YP L PG LT++RS SVNN CYAL +VKA LH +IL++S  L   I+  V  
Sbjct: 1853 ITKHLYDKYPCLSPGLLTDMRSASVNNECYALVAVKANLHKHILYASHHLHKHISRTVSE 1912

Query: 602  IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES 423
             EQSS  STFGW    SFP VL D+IES+AGAI++DSG   ++VF  I+P+L  M+TPE+
Sbjct: 1913 FEQSSLQSTFGWESDISFPKVLGDVIESLAGAIFVDSGYNKEVVFASIKPLLGCMITPET 1972

Query: 422  LRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRL 243
            ++L+PV+ELTELCQK ++ + +     KD ++  T+EV A     + ++ A ++K AK+L
Sbjct: 1973 VKLHPVRELTELCQKWQFELSKA----KDFDS-FTVEVKAKEMSFAHTAKASDKKMAKKL 2027

Query: 242  A 240
            A
Sbjct: 2028 A 2028



>gb:AC133333_1741340 Oryza sativa chromosome 3 BAC OJ1785_A05 genomic
            sequence, complete sequence.
          Length = 1017

 Score =  238 bits (606), Expect = 2e-61
 Identities = 131/304 (43%), Positives = 189/304 (62%), Gaps = 2/304 (0%)
 Frame = -3

Query: 1145 LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG 969
            L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct: 697  LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER 756

Query: 968  NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL 792
               + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct: 757  KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL 814

Query: 791  DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF 612
            D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct: 815  DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY 874

Query: 611  VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT 432
            ++   QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct: 875  LEEFGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT 934

Query: 431  PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PE++  +PVK L E C +R +++      H DG +     V A     S + S   +  A
Sbjct: 935  PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPCKLVA 993

Query: 251  KRLA 240
            K+LA
Sbjct: 994  KKLA 997



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 45/199 (22%), Positives = 83/199 (41%), Gaps = 17/199 (8%)
 Frame = -3

Query: 830  SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL 651
            S + LE LGD+ L Y  TRH + +Y     G LT+++   ++NA     +  + L  YI 
Sbjct: 611  SQESLETLGDSFLKYVTTRHLFSEYRLQHEGILTKMKKNLISNAALCQLACSSNLVGYIH 670

Query: 650  HSSTALRSSIADFVKNIEQSSASSTF----GWVLKTSFPWV---LADIIESIAGAIYLDS 492
                  R  I   +   E+ +   +F    G   +         +AD +E++ GA    +
Sbjct: 671  AEEFNPRDWIIPCLDYDERDNKKISFLAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTA 730

Query: 491  GLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMK----------EPVVVH 342
            G +   +  K            SL +N ++  TE+  +RK  MK          E ++ +
Sbjct: 731  GEKAAFLLMK------------SLGMN-IEFHTEIPVERKISMKAEEFINVRSLEGMLGY 777

Query: 341  KDGEACTTIEVMANGGVRS 285
            K  ++   +E + +G  ++
Sbjct: 778  KFNDSLLLLEALTHGSYQT 796



>gb:AC133003_1741248 Oryza sativa chromosome 3 BAC OSJNBa0010D22
            genomic sequence, complete sequence.
          Length = 1410

 Score =  238 bits (606), Expect = 2e-61
 Identities = 131/304 (43%), Positives = 189/304 (62%), Gaps = 2/304 (0%)
 Frame = -3

Query: 1145 LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG 969
            L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct: 1090 LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER 1149

Query: 968  NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL 792
               + AE+ +NV+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct: 1150 KISMKAEEFINVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL 1207

Query: 791  DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF 612
            D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct: 1208 DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY 1267

Query: 611  VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT 432
            ++   QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct: 1268 LEEFGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT 1327

Query: 431  PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PE++  +PVK L E C +R +++      H DG +     V A     S + S   +  A
Sbjct: 1328 PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSGPCKLVA 1386

Query: 251  KRLA 240
            K+LA
Sbjct: 1387 KKLA 1390



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 45/199 (22%), Positives = 83/199 (41%), Gaps = 17/199 (8%)
 Frame = -3

Query: 830  SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL 651
            S + LE LGD+ L Y  TRH + +Y     G LT+++   ++NA     +  + L  YI 
Sbjct: 1004 SQESLETLGDSFLKYVTTRHLFSEYRLQHEGILTKMKKNLISNAALCQLACSSNLVGYIH 1063

Query: 650  HSSTALRSSIADFVKNIEQSSASSTF----GWVLKTSFPWV---LADIIESIAGAIYLDS 492
                  R  I   +   E+ +   +F    G   +         +AD +E++ GA    +
Sbjct: 1064 AEEFNPRDWIIPCLDYDERDNKKISFLAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTA 1123

Query: 491  GLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMK----------EPVVVH 342
            G +   +  K            SL +N ++  TE+  +RK  MK          E ++ +
Sbjct: 1124 GEKAAFLLMK------------SLGMN-IEFHTEIPVERKISMKAEEFINVRSLEGMLGY 1170

Query: 341  KDGEACTTIEVMANGGVRS 285
            K  ++   +E + +G  ++
Sbjct: 1171 KFNDSLLLLEALTHGSYQT 1189



>gb:AP005782_1857755 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OSJNBb0079G12.>gb:AP005802_1858067 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OSJNBa0057D11.
          Length = 1375

 Score =  227 bits (579), Expect = 3e-58
 Identities = 131/304 (43%), Positives = 188/304 (61%), Gaps = 2/304 (0%)
 Frame = -3

Query: 1145 LTSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF-IDAPIVG 969
            L    +YS+ +  + ++ IAD  EALIGA+LSTAGE AA   ++ LG++I+F  + P+  
Sbjct: 1059 LAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTAGEKAAFLLMKSLGMNIEFHTEIPVER 1118

Query: 968  NFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVL 792
               + AE+ ++V+ LE   +L Y F D  LL+EALTHGSY   G T  YQRLEFLGDA+L
Sbjct: 1119 KISMKAEEFIDVRSLEG--MLGYKFNDSLLLLEALTHGSYQTSGPTSCYQRLEFLGDAIL 1176

Query: 791  DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF 612
            D+  T ++Y +YP   P  LT+LRS SVNN CYA ++VK+GL+ +ILHSS+ L   ++ +
Sbjct: 1177 DHLFTEYYYSKYPDCTPELLTDLRSASVNNNCYAHAAVKSGLNKHILHSSSELHRKMSYY 1236

Query: 611  VKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT 432
               + QS    ++GW      P VL D+IESIAGAIYLDS    ++V+  ++ +LEP+ T
Sbjct: 1237 ---LGQSFTGPSYGWEAGIGLPKVLGDVIESIAGAIYLDSKCDKEVVWRSMKRLLEPLAT 1293

Query: 431  PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PE++  +PVK L E C +R +++      H DG +     V A     S + S    K A
Sbjct: 1294 PETIEPDPVKGLQEFCDRRSFKITYE-KNHVDGVSSVIARVKAGETTYSATKSG-PCKLA 1351

Query: 251  KRLA 240
            K+LA
Sbjct: 1352 KKLA 1355



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 45/199 (22%), Positives = 83/199 (41%), Gaps = 17/199 (8%)
 Frame = -3

Query: 830  SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL 651
            S + LE LGD+ L Y  TRH + +Y     G LT+++   ++NA     +  + L  YI 
Sbjct: 973  SQESLETLGDSFLKYVTTRHLFSEYRLQHEGILTKMKKNLISNAALCQLACSSNLVGYIH 1032

Query: 650  HSSTALRSSIADFVKNIEQSSASSTF----GWVLKTSFPWV---LADIIESIAGAIYLDS 492
                  R  I   +   E+ +   +F    G   +         +AD +E++ GA    +
Sbjct: 1033 AEEFNPRDWIIPCLDYDERGNKKISFLAPNGMYSQRKMSIKSKRIADSVEALIGAYLSTA 1092

Query: 491  GLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMK----------EPVVVH 342
            G +   +  K            SL +N ++  TE+  +RK  MK          E ++ +
Sbjct: 1093 GEKAAFLLMK------------SLGMN-IEFHTEIPVERKISMKAEEFIDVRSLEGMLGY 1139

Query: 341  KDGEACTTIEVMANGGVRS 285
            K  ++   +E + +G  ++
Sbjct: 1140 KFNDSLLLLEALTHGSYQT 1158



>gb:AF187317_1775183 Arabidopsis thaliana CAF protein (CAF) mRNA,
            complete cds.
          Length = 1909

 Score =  196 bits (499), Expect = 6e-49
 Identities = 120/298 (40%), Positives = 178/298 (59%), Gaps = 7/298 (2%)
 Frame = -3

Query: 1112 RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE 948
            R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct: 1495 RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL 1554

Query: 947  QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF 768
            + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct: 1555 KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL 1612

Query: 767  YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS 588
            +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct: 1613 FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES 1672

Query: 587  ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
            +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct: 1673 SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM 1732

Query: 413  NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA 240
            +PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct: 1733 HPVRELQERCQQQAEGLE--YKASRSGNT-ATVEVFID-GVQVGVAQNPQKKMAQKLA 1786



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 7/116 (6%)
 Frame = -3

Query: 980  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ 822
            P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct: 1318 PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE 1375

Query: 821  RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
            R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct: 1376 RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI 1431



>sp|Q9SP32|DICE_ARATH Endoribonuclease Dicer homolog (EC 3.1.26.-)
            (CARPEL FACTORY protein) (SHORT INTEGUMENTS 1 protein)
            (SUSPENSOR1 protein).>gb:AF292940_1783844 Arabidopsis
            thaliana short integuments 1 (SIN1) mRNA, complete
            cds.>gb:AF292941_1783845 Arabidopsis thaliana short
            integuments 1 (SIN1) gene, complete cds.
          Length = 1909

 Score =  196 bits (499), Expect = 6e-49
 Identities = 120/298 (40%), Positives = 178/298 (59%), Gaps = 7/298 (2%)
 Frame = -3

Query: 1112 RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE 948
            R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct: 1495 RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL 1554

Query: 947  QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF 768
            + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct: 1555 KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL 1612

Query: 767  YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSS 588
            +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL   I +FVK ++  S
Sbjct: 1613 FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQIREFVKEVQTES 1672

Query: 587  ASSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
            +   F    +     P VL DI+ESIAGAI+LDSG  T   ++  +P+L+PMVTPE+L +
Sbjct: 1673 SKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGKDTTAAWKVFQPLLQPMVTPETLPM 1732

Query: 413  NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA 240
            +PV+EL E CQ++   ++      + G    T+EV  + GV+   +    +K A++LA
Sbjct: 1733 HPVRELQERCQQQAEGLE--YKASRSGNT-ATVEVFID-GVQVGVAQNPQKKMAQKLA 1786



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 7/116 (6%)
 Frame = -3

Query: 980  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ 822
            P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct: 1318 PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE 1375

Query: 821  RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
            R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct: 1376 RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI 1431



>gb:AC105363_1737955 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1705B08, complete sequence.
          Length = 1883

 Score =  195 bits (495), Expect = 2e-48
 Identities = 119/299 (39%), Positives = 180/299 (60%), Gaps = 8/299 (2%)
 Frame = -3

Query: 1112 RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG----LDIDFIDAPIVGNFPLNAEQ 945
            R + ++T+ADV EALIG +    G+IAA   ++W+G    LD + I  P   + P +  +
Sbjct: 1475 RVLSSKTLADVVEALIGVYYVAGGKIAANHLMKWIGIHAELDPEEIPPPKPYDIPESIMR 1534

Query: 944  MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY 765
             +N   L+   +L   F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH +
Sbjct: 1535 SINFDTLKG--VLGIEFQNKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHLF 1592

Query: 764  DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA 585
              Y  L PG LT+LR+ +VNN  +A  +VK  LH ++ H S+AL + I +FVK++++   
Sbjct: 1593 FTYTDLPPGRLTDLRAAAVNNENFARVAVKHKLHVHLRHGSSALETQIREFVKDVQEELL 1652

Query: 584  SSTFG--WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN 411
               F    +     P VL DI+ESIAGAI+LDSG  T +V++  +P+L PMVTPE+L ++
Sbjct: 1653 KPGFNSFGLGDCKAPKVLGDIVESIAGAIFLDSGYDTSVVWKVFQPLLHPMVTPETLPMH 1712

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAKRLA 240
            PV+EL E CQ++   ++     +K   A    T+EV  + GV+   +    +K A++LA
Sbjct: 1713 PVRELQERCQQQAEGLE-----YKASRAGNIATVEVFVD-GVQIGVAQNPQKKMAQKLA 1765



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 34/116 (29%), Positives = 56/116 (48%), Gaps = 7/116 (6%)
 Frame = -3

Query: 980  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ 822
            P+ G+    A+++ ++ R     LL    +D        + ++EALT  S     T  Y+
Sbjct: 1296 PLPGSLVRGAQRLPSIMRRVESMLLAVQLKDIIDYPVPATKILEALTAASC--QETLCYE 1353

Query: 821  RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
            R E LGDA L + V+R  + +YP    G LT +R + V+N      ++   L +YI
Sbjct: 1354 RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQYALNKTLQSYI 1409



>gb:OSJN00068_1694251 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0065L13, complete sequence.
          Length = 1604

 Score =  189 bits (480), Expect = 9e-47
 Identities = 103/300 (34%), Positives = 170/300 (56%), Gaps = 3/300 (1%)
 Frame = -3

Query: 1124 SRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAP---IVGNFPLN 954
            +R    +  + IADV E+LIGAFL   G  AA +FL W+G+D+DF +     ++ +  +N
Sbjct: 1093 TRSHHWLHRKVIADVVESLIGAFLVEGGFKAAFAFLHWIGIDVDFNNPALYRVLDSSSIN 1152

Query: 953  AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR 774
               M        + L+ Y F+   LL++A  H S+  H    YQRLEFLGDAVL+Y +T 
Sbjct: 1153 LSLMDYTDIAGLEELIGYKFKHKGLLLQAFVHPSFSQHSGGCYQRLEFLGDAVLEYVITS 1212

Query: 773  HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
            + Y  YP + PG +T+LRS +V N   A ++V+  +H +++  S  L S+I+ F   ++ 
Sbjct: 1213 YLYSTYPDIKPGQITDLRSLAVGNDSLAYAAVEKSIHKHLIKDSNHLTSAISKFEMYVKL 1272

Query: 593  SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
            S++      + + + P  L DI+ES  GA+ LDSG   + V++ +  +L+P++T  ++  
Sbjct: 1273 SNSEKDL--LEEPACPKALGDIVESCIGAVLLDSGFNLNYVWKVMLMLLKPVLTFANMHT 1330

Query: 413  NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
            NP++EL ELCQ   + +  P  +  DGE    +EV     +  C+++ RN K A++ A +
Sbjct: 1331 NPMRELRELCQCHGFELGLPKPMKADGEYHVKVEVNIKSKIIICTAANRNSKAARKFAAQ 1390



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 39/144 (27%), Positives = 62/144 (43%), Gaps = 23/144 (15%)
 Frame = -3

Query: 830  SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI- 654
            S +R E LGDA L Y V RH +  Y GL  G LT  RS+ VNN+     S++  L  YI 
Sbjct: 988  SLERFEVLGDAFLKYVVGRHKFITYEGLDEGQLTRRRSDVVNNSHLYELSIRKKLQVYIR 1047

Query: 653  -------------------LHSSTALRSSIADFVKNIEQS---SASSTFGWVLKTSFPWV 540
                                ++   +R    D   +  ++     + +  W+ +     V
Sbjct: 1048 DQQFEPTQFFAPGRPCKVVCNTDVEVRLHQMDIHPDNRENCNLRCTRSHHWLHRK----V 1103

Query: 539  LADIIESIAGAIYLDSGLRTDIVF 468
            +AD++ES+ GA  ++ G +    F
Sbjct: 1104 IADVVESLIGAFLVEGGFKAAFAF 1127



>gb:AE005172_889156 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC007323_1535786 Genomic sequence
            for Arabidopsis thaliana BAC T25K16 from chromosome I,
            complete sequence.
          Length = 2024

 Score =  182 bits (461), Expect = 1e-44
 Identities = 120/325 (36%), Positives = 178/325 (54%), Gaps = 34/325 (10%)
 Frame = -3

Query: 1112 RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGL----DIDFIDAPIVG-NFPLNAE 948
            R + ++T+ADV EALIG +    G+IAA   ++W+G+    D D +D  +   N P +  
Sbjct: 1583 RVLSSKTLADVVEALIGVYYVEGGKIAANHLMKWIGIHVEDDPDEVDGTLKNVNVPESVL 1642

Query: 947  QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHF 768
            + ++   LE    L Y F++  LLVEA+TH S    G   YQRLEF+GDAVLD+ +TRH 
Sbjct: 1643 KSIDFVGLER--ALKYEFKEKGLLVEAITHASRPSSGVSCYQRLEFVGDAVLDHLITRHL 1700

Query: 767  YDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS------------- 627
            +  Y  L PG LT+LR+ +VNN  +A  +VK  LH Y+ H S+AL               
Sbjct: 1701 FFTYTSLPPGRLTDLRAAAVNNENFARVAVKHKLHLYLRHGSSALEKQVNKIKKQSILFS 1760

Query: 626  --------------SIADFVKNIEQSSASSTFG--WVLKTSFPWVLADIIESIAGAIYLD 495
                           I +FVK ++  S+   F    +     P VL DI+ESIAGAI+LD
Sbjct: 1761 KSFKCLTVWLLFVFQIREFVKEVQTESSKPGFNSFGLGDCKAPKVLGDIVESIAGAIFLD 1820

Query: 494  SGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTI 315
            SG  T   ++  +P+L+PMVTPE+L ++PV+EL E CQ++   ++      + G    T+
Sbjct: 1821 SGKDTTAAWKVFQPLLQPMVTPETLPMHPVRELQERCQQQAEGLE--YKASRSGNT-ATV 1877

Query: 314  EVMANGGVRSCSSSARNRKTAKRLA 240
            EV  + GV+   +    +K A++LA
Sbjct: 1878 EVFID-GVQVGVAQNPQKKMAQKLA 1901



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 35/116 (30%), Positives = 57/116 (49%), Gaps = 7/116 (6%)
 Frame = -3

Query: 980  PIVGNFPLNAEQMVNVKRLESDSLLNYTFRD-------PSLLVEALTHGSYIPHGTQSYQ 822
            P+ G+    A+++ ++ R     LL    ++        S ++EALT  S     T  Y+
Sbjct: 1406 PLSGSLIRGAQRLPSIMRRVESMLLAVQLKNLISYPIPTSKILEALTAASC--QETFCYE 1463

Query: 821  RLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
            R E LGDA L + V+R  + +YP    G LT +R + V+N      ++  GL +YI
Sbjct: 1464 RAELLGDAYLKWVVSRFLFLKYPQKHEGQLTRMRQQMVSNMVLYQFALVKGLQSYI 1519



>gb:AE016959_1023161 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC087182_1733976 Oryza sativa
            chromosome 10 BAC OSJNBa0029C15 genomic sequence,
            complete sequence.>gb:AE017107_1752980 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 61 of 77
            of the complete sequence.
          Length = 1458

 Score =  179 bits (454), Expect = 1e-43
 Identities = 112/309 (36%), Positives = 165/309 (53%), Gaps = 6/309 (1%)
 Frame = -3

Query: 1136 GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPL 957
            GK   RG R M ++TI+D  EAL+GA+    G  AAL  +RW G+DI   D  ++     
Sbjct: 1032 GKPCDRGHRWMCSKTISDCVEALVGAYYVGGGIAAALWVMRWFGIDIK-CDMKLLQEVKF 1090

Query: 956  NAEQMVNVKRL----ESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRLEFLGDAVL 792
            NA  + ++ ++    E ++ L Y F    LL+EA+TH S    G    YQRLEFLGD+VL
Sbjct: 1091 NASHLCSLSKINDIEELEAKLKYNFSVKGLLLEAITHPSLQELGVDYCYQRLEFLGDSVL 1150

Query: 791  DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF 612
            D  +TRH Y  +  + PG LT+LRS  V+N  +A + V+  +H+++ H S  L   I ++
Sbjct: 1151 DLLLTRHLYATHTDVDPGELTDLRSALVSNENFAQAVVRNNIHSHLQHGSGILLEQITEY 1210

Query: 611  VK-NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV 435
            V+ N+E     S F        P VL DI+ESIAGA+++D+    D+V+E   P+L P++
Sbjct: 1211 VRSNLECQGKESEFLQHTTCKVPKVLGDIMESIAGAVFIDTDFNVDMVWEIFEPLLSPLI 1270

Query: 434  TPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKT 255
            TP+ L L P +EL ELC      +       K  E    + +     +       RN+K 
Sbjct: 1271 TPDKLALPPYRELLELCSHIGCFLNSK-CTSKGEEVIIEMSLQLRDELLVAQGHDRNKKR 1329

Query: 254  AKRLACERM 228
            AK  A  R+
Sbjct: 1330 AKAKAASRI 1338



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 23/61 (37%), Positives = 34/61 (55%)
 Frame = -3

Query: 836  TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNY 657
            T S +RLE LGD+VL Y V    + +YP    G L+++RS++V NA      +   L  Y
Sbjct: 924  TFSLERLELLGDSVLKYVVGCDLFLRYPMKHEGQLSDMRSKAVCNATLHKHGIWRSLQGY 983

Query: 656  I 654
            +
Sbjct: 984  V 984



>gb:AP003416_1829165 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0456E05.
          Length = 1651

 Score =  169 bits (429), Expect = 8e-41
 Identities = 108/264 (40%), Positives = 153/264 (57%), Gaps = 8/264 (3%)
 Frame = -3

Query: 1136 GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPL 957
            GK   +G R M ++TIAD  EA+IGA+ +  G  AA++ L+WLG+  + I+  ++    L
Sbjct: 1169 GKACDKGHRWMCSKTIADCVEAIIGAYYAGGGLRAAMAVLKWLGIGAE-IEEDLIVQAIL 1227

Query: 956  NAEQMVNVKRLES----DSLLNYTFRDPSLLVEALTHGSYIPHGTQ-SYQRLEFLGDAVL 792
            +A     + +       ++ L Y+F    LLVEALTH S    G +  Y+RLEFLGDAVL
Sbjct: 1228 SASVQTYLPKDNVFEMLEAKLGYSFSVKGLLVEALTHPSQQELGAKYCYERLEFLGDAVL 1287

Query: 791  DYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF 612
            D  +TR+ ++ +     G LT+LRS SVNN  +A  +VK   H+++ HSS  L   I ++
Sbjct: 1288 DILLTRYLFNSHKDTNEGELTDLRSASVNNENFAQVAVKHNFHHFLQHSSGLLLDQITEY 1347

Query: 611  VKNIEQSSASSTFGWVLKTSF---PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEP 441
            V  +E SS       +L       P VL DI+ESIAGAI LD+ L  D+V+    P+L P
Sbjct: 1348 VNRLEGSSMDKV--ELLSDGLPKGPKVLGDIVESIAGAILLDTKLDLDVVWGIFEPLLSP 1405

Query: 440  MVTPESLRLNPVKELTELCQKRKY 369
            +VTPE+L L P +EL E C K  Y
Sbjct: 1406 IVTPENLELPPYRELIEWCGKHGY 1429



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 36/139 (25%), Positives = 58/139 (41%), Gaps = 23/139 (16%)
 Frame = -3

Query: 830  SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL 651
            S +RLE LGD+VL YAV+ H + ++P    G L+ +R   + NA      ++  +  Y+ 
Sbjct: 1064 SMERLELLGDSVLKYAVSCHLFLKFPNKDEGQLSSIRCHMICNATLYKLGIERNVQGYVR 1123

Query: 650  HSSTALRSSIADFVKNIEQS-------------------SASSTFGWVLKTSFPWV---- 540
             ++   R  +A    +I  S                     +   G        W+    
Sbjct: 1124 DAAFDPRRWLAPGQLSIRPSPCECPVKSEVVTDDIHIIDDKAIVLGKACDKGHRWMCSKT 1183

Query: 539  LADIIESIAGAIYLDSGLR 483
            +AD +E+I GA Y   GLR
Sbjct: 1184 IADCVEAIIGAYYAGGGLR 1202



>pir|T48946|T48946 hypothetical protein T15B3.60 - Arabidopsis
            thaliana>gb:ATT15B3_1554499 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T15B3.
          Length = 1531

 Score =  166 bits (420), Expect = 8e-40
 Identities = 102/299 (34%), Positives = 163/299 (54%), Gaps = 4/299 (1%)
 Frame = -3

Query: 1136 GKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDF---IDAPIVGN 966
            GK    G R + +++++D  EALIGA+  + G  A+L  ++WLG+D+DF   +    +  
Sbjct: 1077 GKSCDMGHRWVVSKSVSDCAEALIGAYYVSGGLSASLHMMKWLGIDVDFDPNLVVEAINR 1136

Query: 965  FPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY 786
              L        + +E +  + + F    LL EA+TH S     + SY+RLEFLGD+VLD+
Sbjct: 1137 VSLRCYIPKEDELIELERKIQHEFSAKFLLKEAITHSSL--RESYSYERLEFLGDSVLDF 1194

Query: 785  AVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVK 606
             +TRH ++ Y    PG +T+LRS  VNN  +A  +VK  LH ++   +T L + I D++ 
Sbjct: 1195 LITRHLFNTYEQTGPGEMTDLRSACVNNENFAQVAVKNNLHTHLQRCATVLETQINDYLM 1254

Query: 605  NIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE 426
            + ++     T   +     P  L D++ESIAGA+ +D+ L  D V+    P+L P+VTP+
Sbjct: 1255 SFQK--PDETGRSIPSIQGPKALGDVVESIAGALLIDTRLDLDQVWRVFEPLLSPLVTPD 1312

Query: 425  SLRLNPVKELTELCQKRKYRMKEPVVVHKDG-EACTTIEVMANGGVRSCSSSARNRKTA 252
             L+L P +EL ELC    Y  +  V    DG +A  TI++  +  + +   S +  K A
Sbjct: 1313 KLQLPPYRELNELCDSLGYFFR--VKCSNDGVKAQATIQLQLDDVLLTGDGSEQTNKLA 1369



 Score = 38.1 bits (87), Expect = 0.35
 Identities = 35/147 (23%), Positives = 56/147 (38%), Gaps = 28/147 (19%)
 Frame = -3

Query: 830  SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYIL 651
            S +RLE LGD+VL Y  + H + +YP    G L+  R   ++N+     +    L  YI 
Sbjct: 971  SMERLELLGDSVLKYVASCHLFLKYPDKDEGQLSRQRQSIISNSNLHRLTTSRKLQGYIR 1030

Query: 650  HSSTALRSSIAD-------------------------FVKNIE---QSSASSTFGWVLKT 555
            + +   R   A                          F +N+      S      WV+  
Sbjct: 1031 NGAFEPRRWTAPGQFSLFPVPCKCGIDTREVPLDPKFFTENMTIKIGKSCDMGHRWVVSK 1090

Query: 554  SFPWVLADIIESIAGAIYLDSGLRTDI 474
            S    ++D  E++ GA Y+  GL   +
Sbjct: 1091 S----VSDCAEALIGAYYVSGGLSASL 1113



>gb:AY050230_1289943 Drosophila melanogaster SD01621 full length cDNA.
          Length = 865

 Score =  150 bits (378), Expect = 6e-35
 Identities = 112/346 (32%), Positives = 162/346 (46%), Gaps = 50/346 (14%)
 Frame = -3

Query: 1115 RRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG---------LDIDFIDAPIVGNF 963
            +  + +++IAD  EALIGA+L   G   AL F+ WLG         LD    +  I G+ 
Sbjct: 511  QHSIPDKSIADCVEALIGAYLIECGPRGALLFMAWLGVRVLPITRQLDGGNQEQRIPGST 570

Query: 962  PLNAEQMVNVKRL---------------------------ESDSLLNYTFRDPSLLVEAL 864
              NAE +V V                              E +  L Y FRD S L++A+
Sbjct: 571  KPNAENVVTVYGAWPTPRSPLLHFAPNATEELDQLLSGFEEFEESLGYKFRDRSYLLQAM 630

Query: 863  THGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYAL 687
            TH SY P+  T  YQRLEFLGDAVLDY +TRH Y+      PG LT+LRS  VNN  +A 
Sbjct: 631  THASYTPNRLTDCYQRLEFLGDAVLDYLITRHLYEDPRQHSPGALTDLRSALVNNTIFAS 690

Query: 686  SSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL----------KTSFPWVL 537
             +V+ G H +  H S  L   I  FV+  +++    +  + L              P  L
Sbjct: 691  LAVRHGFHKFFRHLSPGLNDVIDRFVRIQQENGHCISEEYYLLSEEECDDAEDVEVPKAL 750

Query: 536  ADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT--PESLRLNPVKELTELCQKRKYRM 363
             D+ ESIAGAI+LDS +  D+V+     ++ P +     S+  +P++EL EL +    + 
Sbjct: 751  GDVFESIAGAIFLDSNMSLDVVWHVYSNMMSPEIEQFSNSVPKSPIRELLEL-EPETAKF 809

Query: 362  KEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRK-TAKRLACERM 228
             +P  +        T++V   G  R    + R  K TA + A  ++
Sbjct: 810  GKPEKLADGRRVRVTVDVFCKGTFRGIGRNYRIAKCTAAKCALRQL 855



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 24/70 (34%), Positives = 41/70 (58%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           L+ +    PS++++ALT  +   +   + +RLE +GD+ L YA+T + Y  Y  +  G L
Sbjct: 331 LVGHPGPSPSIILQALTMSN--ANDGINLERLETIGDSFLKYAITTYLYITYENVHEGKL 388

Query: 731 TELRSESVNN 702
           + LRS+ V N
Sbjct: 389 SHLRSKQVAN 398



>gb:AE014297_1140875 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003740_1222868 Drosophila melanogaster
            chromosome 3R, section 78 of 118 of the complete
            sequence.>gb:AX287266_1465308 Sequence 3 from Patent
            WO0168836.
          Length = 2249

 Score =  150 bits (378), Expect = 6e-35
 Identities = 112/346 (32%), Positives = 162/346 (46%), Gaps = 50/346 (14%)
 Frame = -3

Query: 1115 RRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLG---------LDIDFIDAPIVGNF 963
            +  + +++IAD  EALIGA+L   G   AL F+ WLG         LD    +  I G+ 
Sbjct: 1895 QHSIPDKSIADCVEALIGAYLIECGPRGALLFMAWLGVRVLPITRQLDGGNQEQRIPGST 1954

Query: 962  PLNAEQMVNVKRL---------------------------ESDSLLNYTFRDPSLLVEAL 864
              NAE +V V                              E +  L Y FRD S L++A+
Sbjct: 1955 KPNAENVVTVYGAWPTPRSPLLHFAPNATEELDQLLSGFEEFEESLGYKFRDRSYLLQAM 2014

Query: 863  THGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYAL 687
            TH SY P+  T  YQRLEFLGDAVLDY +TRH Y+      PG LT+LRS  VNN  +A 
Sbjct: 2015 THASYTPNRLTDCYQRLEFLGDAVLDYLITRHLYEDPRQHSPGALTDLRSALVNNTIFAS 2074

Query: 686  SSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL----------KTSFPWVL 537
             +V+ G H +  H S  L   I  FV+  +++    +  + L              P  L
Sbjct: 2075 LAVRHGFHKFFRHLSPGLNDVIDRFVRIQQENGHCISEEYYLLSEEECDDAEDVEVPKAL 2134

Query: 536  ADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT--PESLRLNPVKELTELCQKRKYRM 363
             D+ ESIAGAI+LDS +  D+V+     ++ P +     S+  +P++EL EL +    + 
Sbjct: 2135 GDVFESIAGAIFLDSNMSLDVVWHVYSNMMSPEIEQFSNSVPKSPIRELLEL-EPETAKF 2193

Query: 362  KEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRK-TAKRLACERM 228
             +P  +        T++V   G  R    + R  K TA + A  ++
Sbjct: 2194 GKPEKLADGRRVRVTVDVFCKGTFRGIGRNYRIAKCTAAKCALRQL 2239



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 24/70 (34%), Positives = 41/70 (58%)
 Frame = -3

Query: 911  LLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            L+ +    PS++++ALT  +   +   + +RLE +GD+ L YA+T + Y  Y  +  G L
Sbjct: 1715 LVGHPGPSPSIILQALTMSN--ANDGINLERLETIGDSFLKYAITTYLYITYENVHEGKL 1772

Query: 731  TELRSESVNN 702
            + LRS+ V N
Sbjct: 1773 SHLRSKQVAN 1782



>gb:AY386319_2531051 Danio rerio Dicer1 (dicer1) mRNA, partial cds.
          Length = 1243

 Score =  143 bits (360), Expect = 8e-33
 Identities = 107/317 (33%), Positives = 161/317 (50%), Gaps = 34/317 (10%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI----------------DFIDAPIVG 969
            +++IAD  EAL+G +L++ GE AA  FL  LGL +                 ++  P   
Sbjct: 910  DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKVLPPEKQSSGGSAELQYGWLKIPPRC 969

Query: 968  NFPL-NAEQMVN---VKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLG 804
             F   +AE+ +N      L  +S +NYTF++ + L++A TH SY  +  T  YQRLEFLG
Sbjct: 970  MFEHPDAERTLNHLISGFLNFESKINYTFKNKAYLLQAFTHASYHYNTITDCYQRLEFLG 1029

Query: 803  DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS 624
            DA+LDY +T+H Y+      PG LT+LRS  VNN  +A  +VK   H Y    S  L   
Sbjct: 1030 DAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHV 1089

Query: 623  IADFVKNIEQSSASSTFGWVLKTS-----------FPWVLADIIESIAGAIYLDSGLRTD 477
            I DFV+   + +        L+ S            P  + DI ES+AGAIY+DSG+  +
Sbjct: 1090 IDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLE 1149

Query: 476  IVFEKIRPVLEPMVTPESLRL--NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMA 303
             V++   P++ P++   S  +  +PV+EL E+  + +     P     DG+   T+EV+ 
Sbjct: 1150 TVWQVYYPMMRPLIEKFSANVPRSPVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVG 1207

Query: 302  NGGVRSCSSSARNRKTA 252
             G  +    S R  K+A
Sbjct: 1208 KGKFKGVGRSYRIAKSA 1224



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 25/77 (32%), Positives = 43/77 (55%), Gaps = 2/77 (2%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPHGTQSY--QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           +P L+++ALT    + + +  +  +RLE LGD+ L +A+T + +  YP    G L+ +RS
Sbjct: 653 NPGLILQALT----LSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRS 708

Query: 716 ESVNNACYALSSVKAGL 666
           + V+N        K GL
Sbjct: 709 KKVSNCNLYRLGKKKGL 725



>pir|S44849|S44849 K12H4.8 protein - Caenorhabditis elegans
          Length = 1822

 Score =  139 bits (349), Expect = 1e-31
 Identities = 107/333 (32%), Positives = 157/333 (47%), Gaps = 38/333 (11%)
 Frame = -3

Query: 1115 RRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI--------------DFIDAP 978
            ++ + +++IAD  EALIG  L T G    L  + W+GL +               FID P
Sbjct: 1477 QQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTP 1536

Query: 977  IVGNFPLN----AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLE 813
               N  LN      Q     +LE    + Y F++ + LV+A TH SYI +  T  YQRLE
Sbjct: 1537 TNPNASLNFLNNLWQQFQFTQLEEK--IGYRFKERAYLVQAFTHASYINNRVTGCYQRLE 1594

Query: 812  FLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTAL 633
            FLGDAVLDY +TR+ ++      PG LT+LRS  VNN  +A  +VK     + +     L
Sbjct: 1595 FLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGL 1654

Query: 632  RSSIADFVKNIEQSSASSTF---------------GWVLKTSFPWVLADIIESIAGAIYL 498
               I  FVK   + +  + F               G       P  + DI ES+AGAIYL
Sbjct: 1655 YHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYL 1714

Query: 497  DSGLRTD----IVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGE 330
            DSG   D    ++F  +R  +E  +   +   +P++EL E  ++ K R  +   + + G+
Sbjct: 1715 DSGRNLDTTWQVIFHMMRGTIE--LCCANPPRSPIRELMEF-EQSKVRFSKMERILESGK 1771

Query: 329  ACTTIEVMANGGVRSCSSSARNRKTAKRLACER 231
               T+EV+ N      +   RN + AK  A +R
Sbjct: 1772 VRVTVEVVNN---MRFTGMGRNYRIAKATAAKR 1801



>sp|P34529|DCR1_CAEEL Endoribonuclease dcr-1 (EC
            3.1.26.-).>gb:L14331_1386863 Caenorhabditis elegans
            cosmid K12H4, complete sequence.
          Length = 1845

 Score =  139 bits (349), Expect = 1e-31
 Identities = 107/333 (32%), Positives = 157/333 (47%), Gaps = 38/333 (11%)
 Frame = -3

Query: 1115 RRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI--------------DFIDAP 978
            ++ + +++IAD  EALIG  L T G    L  + W+GL +               FID P
Sbjct: 1500 QQHISDKSIADAVEALIGVHLLTLGPNPTLKVMNWMGLKVIQKDQKSDVPSPLLRFIDTP 1559

Query: 977  IVGNFPLN----AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLE 813
               N  LN      Q     +LE    + Y F++ + LV+A TH SYI +  T  YQRLE
Sbjct: 1560 TNPNASLNFLNNLWQQFQFTQLEEK--IGYRFKERAYLVQAFTHASYINNRVTGCYQRLE 1617

Query: 812  FLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTAL 633
            FLGDAVLDY +TR+ ++      PG LT+LRS  VNN  +A  +VK     + +     L
Sbjct: 1618 FLGDAVLDYMITRYLFEDSRQYSPGVLTDLRSALVNNTIFASLAVKFEFQKHFIAMCPGL 1677

Query: 632  RSSIADFVKNIEQSSASSTF---------------GWVLKTSFPWVLADIIESIAGAIYL 498
               I  FVK   + +  + F               G       P  + DI ES+AGAIYL
Sbjct: 1678 YHMIEKFVKLCSERNFDTNFNAEMYMVTTEEEIDEGQEEDIEVPKAMGDIFESVAGAIYL 1737

Query: 497  DSGLRTD----IVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGE 330
            DSG   D    ++F  +R  +E  +   +   +P++EL E  ++ K R  +   + + G+
Sbjct: 1738 DSGRNLDTTWQVIFHMMRGTIE--LCCANPPRSPIRELMEF-EQSKVRFSKMERILESGK 1794

Query: 329  ACTTIEVMANGGVRSCSSSARNRKTAKRLACER 231
               T+EV+ N      +   RN + AK  A +R
Sbjct: 1795 VRVTVEVVNN---MRFTGMGRNYRIAKATAAKR 1824



>gb:AP005914_1860046 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBb0027A16.
          Length = 299

 Score =  135 bits (340), Expect = 2e-30
 Identities = 83/230 (36%), Positives = 133/230 (57%), Gaps = 2/230 (0%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGS-YIPHGTQ-SYQRLEFLGDAVLDYAVTRHFYDQYPGLF 744
           +SLL Y FRD +L+ EALTHGS Y P+    +Y+RLE+LGDAVL   V+R  +  Y  L 
Sbjct: 43  ESLLGYEFRDKALVEEALTHGSFYYPYRPGVTYERLEYLGDAVLTCVVSREVFLTYGQLQ 102

Query: 743 PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWV 564
           PG LT LR+ +V+    A  +V  GLH+++ H +  L   I DF++ +      S     
Sbjct: 103 PGPLTRLRAANVDKEKLARVAVVHGLHHFLRHKAPNLDGQITDFIEELSMYPIHSNG--- 159

Query: 563 LKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                P VL D++ES+ GAIY DS    +IV++  + + +P+++ E+L  +PV EL E C
Sbjct: 160 -LLDPPKVLCDVVESLIGAIYCDSNFNQEIVWQVFQKLADPLISLETLGKHPVSELFEFC 218

Query: 383 QKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
           QK +  +K   +V  + +   T+EV+ +G +   ++ A+ ++ A+  A +
Sbjct: 219 QKTRRGVK---IVKDEWDKNLTVEVLIDGEMVGRATYAQKKEIAQNRAAK 265



>gb:AY239359_1312355 Anopheles gambiae strain G3 dicer-1 mRNA,
            complete cds.
          Length = 2259

 Score =  131 bits (329), Expect = 3e-29
 Identities = 89/265 (33%), Positives = 128/265 (48%), Gaps = 33/265 (12%)
 Frame = -3

Query: 923  ESDSLLNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
            E +  L Y FRD S L++A+TH SY P+  T  YQRLEFLGDA+LDY +TRH Y+     
Sbjct: 1984 EFEQALGYRFRDRSYLLQAMTHASYSPNRLTDCYQRLEFLGDAILDYLITRHLYEDRRQH 2043

Query: 746  FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST--- 576
             PG LT+LRS  VNN  +A  +V+ G H Y LH S  L+  I  FV+  +++    T   
Sbjct: 2044 SPGALTDLRSALVNNTIFASLAVRHGFHKYFLHLSPGLQEVIDRFVRIQQENGHRITEEE 2103

Query: 575  --------------------------FGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
                                       G       P  L D+ ESIAGAI+LDS +  D 
Sbjct: 2104 YYLPDEDDELGEYGAMGEDGPGEGRGVGEAEDVEVPKALGDVFESIAGAIFLDSDMSLDT 2163

Query: 473  VFEKIRPVLEPMVT--PESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMAN 300
            V++  R ++ P +     S+  +P++EL E+ +    +  +P  +        T+EV   
Sbjct: 2164 VWKVYRKMMGPEIEKFSSSVPKSPIRELLEM-EPETAKFGKPEKLTDGRRVRVTVEVFGK 2222

Query: 299  GGVRSCSSSARNRK-TAKRLACERM 228
            G  R    + R  K TA + A  ++
Sbjct: 2223 GTFRGIGRNYRIAKCTAAKCALRQL 2247



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/62 (35%), Positives = 40/62 (64%)
 Frame = -3

Query: 887  PSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
            P+++++ALT  +   +   + +RLE +GD+ L YA+T + Y +Y  +  G L+ LRS+ V
Sbjct: 1664 PAIILQALTMSN--ANDGINLERLETIGDSFLKYAITTYLYCRYDNVHEGKLSHLRSKQV 1721

Query: 707  NN 702
            +N
Sbjct: 1722 SN 1723



>gb:AK129241_2069472 Mus musculus mRNA for mKIAA0928 protein.
          Length = 1475

 Score =  129 bits (325), Expect = 9e-29
 Identities = 83/233 (35%), Positives = 124/233 (53%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1226 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1285

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFVK   + +        L+ S
Sbjct: 1286 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRRS 1345

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  ++V++   P+++P++   S  +  +
Sbjct: 1346 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRS 1405

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1406 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1456



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 9/115 (7%)
 Frame = -3

Query: 983  APIVGNFPLNAEQMVNVK-RLESDSL--LNYTFR----DPSLLVEALTHGSYIPHGTQSY 825
            +P V   P     +  +K R++S+    + Y+ R    +P L+++ALT    + + +  +
Sbjct: 814  SPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSSRTLGPNPGLILQALT----LSNASDGF 869

Query: 824  --QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGL 666
              +RLE LGD+ L +A+T + +  YP    G L+ +RS+ V+N        K GL
Sbjct: 870  NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGL 924



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1111 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1145



>gb:AF484523_2066919 Mus musculus endoribonuclease Dicer (Dicer)
           gene, partial cds.
          Length = 361

 Score =  129 bits (325), Expect = 9e-29
 Identities = 83/233 (35%), Positives = 124/233 (53%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 112 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 171

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           T+LRS  VNN  +A  +VK   H Y    S  L   I DFVK   + +        L+ S
Sbjct: 172 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRRS 231

Query: 551 -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                       P  + DI ES+AGAIY+DSG+  ++V++   P+++P++   S  +  +
Sbjct: 232 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRS 291

Query: 410 PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
           PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 292 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 342



>gb:AF430845_2065648 Mus musculus dicer-like protein (Dicer1) mRNA,
            complete cds.
          Length = 1917

 Score =  129 bits (325), Expect = 9e-29
 Identities = 83/233 (35%), Positives = 124/233 (53%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1668 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1727

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFVK   + +        L+ S
Sbjct: 1728 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRRS 1787

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  ++V++   P+++P++   S  +  +
Sbjct: 1788 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRS 1847

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1848 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1898



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 9/115 (7%)
 Frame = -3

Query: 983  APIVGNFPLNAEQMVNVK-RLESDSL--LNYTFR----DPSLLVEALTHGSYIPHGTQSY 825
            +P V   P     +  +K R++S+    + Y+ R    +P L+++ALT    + + +  +
Sbjct: 1256 SPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSSRTLGPNPGLILQALT----LSNASDGF 1311

Query: 824  --QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGL 666
              +RLE LGD+ L +A+T + +  YP    G L+ +RS+ V+N        K GL
Sbjct: 1312 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGL 1366



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1553 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1587



>sp|Q8R418|DICE_MOUSE Endoribonuclease Dicer (EC 3.1.26.-)
            (Double-strand-specific ribonuclease mDCR-1).
          Length = 1906

 Score =  129 bits (325), Expect = 9e-29
 Identities = 83/233 (35%), Positives = 124/233 (53%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1657 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1716

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFVK   + +        L+ S
Sbjct: 1717 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRRS 1776

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  ++V++   P+++P++   S  +  +
Sbjct: 1777 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRS 1836

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1837 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1887



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 9/115 (7%)
 Frame = -3

Query: 983  APIVGNFPLNAEQMVNVK-RLESDSL--LNYTFR----DPSLLVEALTHGSYIPHGTQSY 825
            +P V   P     +  +K R++S+    + Y+ R    +P L+++ALT    + + +  +
Sbjct: 1245 SPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSSRTLGPNPGLILQALT----LSNASDGF 1300

Query: 824  --QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGL 666
              +RLE LGD+ L +A+T + +  YP    G L+ +RS+ V+N        K GL
Sbjct: 1301 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGL 1355



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1542 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1576



>gb:AB081470_2047705 Mus musculus mRNA for double-strand-specific
            ribonuclease MDCR, complete cds.
          Length = 1906

 Score =  129 bits (324), Expect = 1e-28
 Identities = 83/233 (35%), Positives = 124/233 (53%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1657 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1716

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFVK   + +        L+ S
Sbjct: 1717 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEMQGMDSELRRS 1776

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  ++V++   P+++P++   S  +  +
Sbjct: 1777 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSANVPRS 1836

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1837 PVRELLEM--EPETAEFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1887



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/115 (28%), Positives = 59/115 (51%), Gaps = 9/115 (7%)
 Frame = -3

Query: 983  APIVGNFPLNAEQMVNVK-RLESDSL--LNYTFR----DPSLLVEALTHGSYIPHGTQSY 825
            +P V   P     +  +K R++S+    + Y+ R    +P L+++ALT    + + +  +
Sbjct: 1245 SPAVSTMPAMMNAVKALKDRMDSEQSPSVGYSSRTLGPNPGLILQALT----LSNASDGF 1300

Query: 824  --QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGL 666
              +RLE LGD+ L +A+T + +  YP    G L+ +RS+ V+N        K GL
Sbjct: 1301 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGL 1355



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1542 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1576



>gb:AY386968_1429974 Bos taurus dicer (dicer) mRNA, complete cds.
          Length = 1923

 Score =  126 bits (316), Expect = 1e-27
 Identities = 82/233 (35%), Positives = 122/233 (52%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1674 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1733

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFV+   + +        L+ S
Sbjct: 1734 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRS 1793

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  + V++   P++ P++   S  +  +
Sbjct: 1794 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRS 1853

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1854 PVRELLEM--EPEITKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1904



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1557 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1591



>gb:AB023145_1865467 Homo sapiens mRNA for KIAA0928 protein, partial
            cds.
          Length = 1922

 Score =  125 bits (315), Expect = 1e-27
 Identities = 82/233 (35%), Positives = 122/233 (52%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1673 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1732

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFV+   + +        L+ S
Sbjct: 1733 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRS 1792

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  + V++   P++ P++   S  +  +
Sbjct: 1793 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRS 1852

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1853 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1903



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 32/115 (27%), Positives = 61/115 (53%), Gaps = 9/115 (7%)
 Frame = -3

Query: 983  APIVGNFPLNAEQMVNVK-RLESDSL--LNYTFR----DPSLLVEALTHGSYIPHGTQSY 825
            +P++   P   + +  +K R++S+    + Y+ R    +P L+++ALT    + + +  +
Sbjct: 1255 SPVMAVMPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALT----LSNASDGF 1310

Query: 824  --QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGL 666
              +RLE LGD+ L +A+T + +  YP    G L+ +RS+ V+N        K GL
Sbjct: 1311 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGL 1365



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1556 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1590



>gb:AX877989_1477248 Sequence 12894 from Patent EP1074617.
          Length = 554

 Score =  125 bits (315), Expect = 1e-27
 Identities = 82/233 (35%), Positives = 122/233 (52%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 305 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 364

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           T+LRS  VNN  +A  +VK   H Y    S  L   I DFV+   + +        L+ S
Sbjct: 365 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRS 424

Query: 551 -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                       P  + DI ES+AGAIY+DSG+  + V++   P++ P++   S  +  +
Sbjct: 425 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRS 484

Query: 410 PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
           PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 485 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 535



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 188  DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 222



>gb:AX287264_1465307 Sequence 1 from Patent
            WO0168836.>gb:AB028449_1865773 Homo sapiens mRNA for
            helicase-MOI, complete cds.
          Length = 1924

 Score =  125 bits (315), Expect = 1e-27
 Identities = 82/233 (35%), Positives = 122/233 (52%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1675 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1734

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFV+   + +        L+ S
Sbjct: 1735 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRS 1794

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  + V++   P++ P++   S  +  +
Sbjct: 1795 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRS 1854

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1855 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1905



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 32/115 (27%), Positives = 61/115 (53%), Gaps = 9/115 (7%)
 Frame = -3

Query: 983  APIVGNFPLNAEQMVNVK-RLESDSL--LNYTFR----DPSLLVEALTHGSYIPHGTQSY 825
            +P++   P   + +  +K R++S+    + Y+ R    +P L+++ALT    + + +  +
Sbjct: 1257 SPVMAVMPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALT----LSNASDGF 1312

Query: 824  --QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGL 666
              +RLE LGD+ L +A+T + +  YP    G L+ +RS+ V+N        K GL
Sbjct: 1313 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGL 1367



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1558 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1592



>gb:HSM801262_1186110 Homo sapiens mRNA; cDNA DKFZp434A0427 (from
           clone DKFZp434A0427).
          Length = 525

 Score =  125 bits (315), Expect = 1e-27
 Identities = 82/233 (35%), Positives = 122/233 (52%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 276 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 335

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           T+LRS  VNN  +A  +VK   H Y    S  L   I DFV+   + +        L+ S
Sbjct: 336 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRS 395

Query: 551 -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                       P  + DI ES+AGAIY+DSG+  + V++   P++ P++   S  +  +
Sbjct: 396 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRS 455

Query: 410 PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
           PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 456 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 506



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 159  DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 193



>pir|T34544|T34544 hypothetical protein DKFZp434A0427.1 - human
           (fragment)
          Length = 525

 Score =  125 bits (315), Expect = 1e-27
 Identities = 82/233 (35%), Positives = 122/233 (52%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 276 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 335

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           T+LRS  VNN  +A  +VK   H Y    S  L   I DFV+   + +        L+ S
Sbjct: 336 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRS 395

Query: 551 -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                       P  + DI ES+AGAIY+DSG+  + V++   P++ P++   S  +  +
Sbjct: 396 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRS 455

Query: 410 PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
           PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 456 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 506



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 159  DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 193



>sp|Q9UPY3|DICE_HUMAN Endoribonuclease Dicer (EC 3.1.26.-) (Helicase
            with RNase motif) (Helicase-MOI).>gb:HSA132261_2000277
            Homo sapiens mRNA for hypothetical helicase K12H4.8-like
            protein.
          Length = 1912

 Score =  125 bits (315), Expect = 1e-27
 Identities = 82/233 (35%), Positives = 122/233 (52%), Gaps = 14/233 (6%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
            +NY F++ + L++A TH SY  +  T  YQRLEFLGDA+LDY +T+H Y+      PG L
Sbjct: 1663 INYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVL 1722

Query: 731  TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            T+LRS  VNN  +A  +VK   H Y    S  L   I DFV+   + +        L+ S
Sbjct: 1723 TDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRS 1782

Query: 551  -----------FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL--N 411
                        P  + DI ES+AGAIY+DSG+  + V++   P++ P++   S  +  +
Sbjct: 1783 EEDEEKEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRS 1842

Query: 410  PVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTA 252
            PV+EL E+  + +     P     DG+   T+EV+  G  +    S R  K+A
Sbjct: 1843 PVRELLEM--EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSA 1893



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 32/115 (27%), Positives = 61/115 (53%), Gaps = 9/115 (7%)
 Frame = -3

Query: 983  APIVGNFPLNAEQMVNVK-RLESDSL--LNYTFR----DPSLLVEALTHGSYIPHGTQSY 825
            +P++   P   + +  +K R++S+    + Y+ R    +P L+++ALT    + + +  +
Sbjct: 1245 SPVMAVMPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALT----LSNASDGF 1300

Query: 824  --QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGL 666
              +RLE LGD+ L +A+T + +  YP    G L+ +RS+ V+N        K GL
Sbjct: 1301 NLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGL 1355



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 17/35 (48%), Positives = 25/35 (71%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDI 996
            +++IAD  EAL+G +L++ GE AA  FL  LGL +
Sbjct: 1546 DKSIADCVEALLGCYLTSCGERAAQLFLCSLGLKV 1580



>gb:AB024036_1515857 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MQC12.
          Length = 391

 Score =  112 bits (280), Expect = 1e-23
 Identities = 81/253 (32%), Positives = 141/253 (55%), Gaps = 3/253 (1%)
 Frame = -3

Query: 983 APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG 804
           +P   + P+++E M +++ +E   +LNY F + SLL EA+TH S       SY+RLEF+G
Sbjct: 45  SPSAPSVPVSSE-MESMEAVEK--ILNYKFSNKSLLKEAITHTSCTDF--PSYERLEFIG 99

Query: 803 DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS 624
           D+ +  A++ + Y  YP L P  L+ LR+ +V+    A  S+  GL++++  ++ +L   
Sbjct: 100 DSAIGLAISNYLYLTYPSLEPHDLSLLRAANVSTEKLARVSLNHGLYSFLRRNAPSLDEK 159

Query: 623 IADFVKNI-EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL 447
           + +F + + ++   S ++G ++K   P VLAD+ ES+AGA+Y+D       ++   R +L
Sbjct: 160 VKEFSEAVGKEDDLSVSYGGLVKA--PKVLADLFESLAGAVYVDVNFDLQRLWVIFRGLL 217

Query: 446 EPMVTPESLRL--NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSS 273
           EP+VT + L+    PV  L +LC K K R+   +   KDG    +I V+        S  
Sbjct: 218 EPIVTLDDLQKQPQPVSMLFKLCHKHKKRI--DIKNWKDGN--VSIAVIYLDDELLASGR 273

Query: 272 ARNRKTAKRLACE 234
           A N+  A+ +A +
Sbjct: 274 AENKDIARLIAAK 286



>gb:AY042815_1560880 Arabidopsis thaliana Unknown protein (MQC12.19)
           mRNA, complete cds.>gb:AY081681_1568941 Arabidopsis
           thaliana unknown protein (At3g20450) mRNA, complete cds.
          Length = 391

 Score =  112 bits (279), Expect = 2e-23
 Identities = 81/253 (32%), Positives = 141/253 (55%), Gaps = 3/253 (1%)
 Frame = -3

Query: 983 APIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLG 804
           +P   + P+++E M +++ +E   +LNY F + SLL EA+TH S       SY+RLEF+G
Sbjct: 45  SPSAPSVPVSSE-MESMEAVEK--ILNYKFSNKSLLKEAVTHTSCTDF--PSYERLEFIG 99

Query: 803 DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS 624
           D+ +  A++ + Y  YP L P  L+ LR+ +V+    A  S+  GL++++  ++ +L   
Sbjct: 100 DSAIGLAISNYLYLTYPSLEPHDLSLLRAANVSTEKLARVSLNHGLYSFLRRNAPSLDEK 159

Query: 623 IADFVKNI-EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVL 447
           + +F + + ++   S ++G ++K   P VLAD+ ES+AGA+Y+D       ++   R +L
Sbjct: 160 VKEFSEAVGKEDDLSVSYGGLVKA--PKVLADLFESLAGAVYVDVNFDLQRLWVIFRGLL 217

Query: 446 EPMVTPESLRL--NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSS 273
           EP+VT + L+    PV  L +LC K K R+   +   KDG    +I V+        S  
Sbjct: 218 EPIVTLDDLQKQPQPVSMLFKLCHKHKKRI--DIKNWKDGN--VSIAVIYLDDELLASGR 273

Query: 272 ARNRKTAKRLACE 234
           A N+  A+ +A +
Sbjct: 274 AENKDIARLIAAK 286



>gb:BT011073_1357680 Drosophila melanogaster SD11113 full insert cDNA.
          Length = 1640

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 68/193 (35%), Positives = 97/193 (50%), Gaps = 14/193 (7%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG--NFPLNAEQM-VNVK 930
            N+ IAD  EAL+G  +   G   A   L +  +    ID P+    N  L  ++M  NV 
Sbjct: 1342 NKVIADTLEALLGVIVKNYGLQHAFKMLEYFKICRADIDKPLTQLLNLELGGKKMRANVN 1401

Query: 929  RLESDSLL----------NYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYA 783
              E D  L           YTF+D   L++ALTH SY  +  T SYQ LEF+GDA+LD+ 
Sbjct: 1402 TTEIDGFLINHYYLEKNLGYTFKDRRYLLQALTHPSYPTNRITGSYQELEFIGDAILDFL 1461

Query: 782  VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
            ++ + ++    + PG LT+LRS  VNN   A   V+  LH +IL  +  L   I+ FV N
Sbjct: 1462 ISAYIFENNTKMNPGALTDLRSALVNNTTLACICVRHRLHFFILAENAKLSEIISKFV-N 1520

Query: 602  IEQSSASSTFGWV 564
             ++S       +V
Sbjct: 1521 FQESQGHRVTNYV 1533



>gb:AB073024_1197454 Drosophila melanogaster dcr-2 mRNA for
            double-strand-specific ribonuclease, complete cds.
          Length = 1722

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 68/193 (35%), Positives = 97/193 (50%), Gaps = 14/193 (7%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG--NFPLNAEQM-VNVK 930
            N+ IAD  EAL+G  +   G   A   L +  +    ID P+    N  L  ++M  NV 
Sbjct: 1363 NKVIADTLEALLGVIVKNYGLQHAFKMLEYFKICRADIDKPLTQLLNLELGGKKMRANVN 1422

Query: 929  RLESDSLL----------NYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYA 783
              E D  L           YTF+D   L++ALTH SY  +  T SYQ LEF+GDA+LD+ 
Sbjct: 1423 TTEIDGFLINHYYLEKNLGYTFKDRRYLLQALTHPSYPTNRITGSYQELEFIGDAILDFL 1482

Query: 782  VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
            ++ + ++    + PG LT+LRS  VNN   A   V+  LH +IL  +  L   I+ FV N
Sbjct: 1483 ISAYIFENNTKMNPGALTDLRSALVNNTTLACICVRHRLHFFILAENAKLSEIISKFV-N 1541

Query: 602  IEQSSASSTFGWV 564
             ++S       +V
Sbjct: 1542 FQESQGHRVTNYV 1554



>gb:AE013599_1132453 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003802_1225199 Drosophila melanogaster
            chromosome 2R, section 48 of 74 of the complete sequence.
          Length = 1722

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 68/193 (35%), Positives = 97/193 (50%), Gaps = 14/193 (7%)
 Frame = -3

Query: 1100 NETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVG--NFPLNAEQM-VNVK 930
            N+ IAD  EAL+G  +   G   A   L +  +    ID P+    N  L  ++M  NV 
Sbjct: 1363 NKVIADTLEALLGVIVKNYGLQHAFKMLEYFKICRADIDKPLTQLLNLELGGKKMRANVN 1422

Query: 929  RLESDSLL----------NYTFRDPSLLVEALTHGSYIPHG-TQSYQRLEFLGDAVLDYA 783
              E D  L           YTF+D   L++ALTH SY  +  T SYQ LEF+GDA+LD+ 
Sbjct: 1423 TTEIDGFLINHYYLEKNLGYTFKDRRYLLQALTHPSYPTNRITGSYQELEFIGDAILDFL 1482

Query: 782  VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
            ++ + ++    + PG LT+LRS  VNN   A   V+  LH +IL  +  L   I+ FV N
Sbjct: 1483 ISAYIFENNTKMNPGALTDLRSALVNNTTLACICVRHRLHFFILAENAKLSEIISKFV-N 1541

Query: 602  IEQSSASSTFGWV 564
             ++S       +V
Sbjct: 1542 FQESQGHRVTNYV 1554



>pir|G71418|G71418 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV41_1545344 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 41.>gb:ATFCA3_1551592
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 3.
          Length = 778

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 58/152 (38%), Positives = 91/152 (59%)
 Frame = -3

Query: 950 EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRH 771
           +Q++ ++ LE   +LNY F+D SLL++A T  SY+   ++SY+ LE LGD++L+  +   
Sbjct: 49  DQLMEIESLEK--ILNYKFKDKSLLLKAFTDASYVDDKSESYELLELLGDSILNMGIIYD 106

Query: 770 FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS 591
           F   YP   PG LT+LR+ +V+    A  +V   L++Y+ H    L   I +FV+ +E+ 
Sbjct: 107 FIKLYPKEAPGPLTKLRAVNVDTEKLARVAVNHQLYSYLRHKKPLLEEQILEFVEAMEKY 166

Query: 590 SASSTFGWVLKTSFPWVLADIIESIAGAIYLD 495
              S    +LK   P VLADI+ES  GAI++D
Sbjct: 167 PLHS--NGLLKV--PKVLADIVESTIGAIFMD 194



>gb:AB012240_1511680 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18C1.
          Length = 957

 Score = 97.4 bits (241), Expect = 5e-19
 Identities = 55/170 (32%), Positives = 96/170 (56%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           + +LNY+F + +LL EA+T  S +      + RLEF GD++L+ A T +    YP L   
Sbjct: 8   EKILNYSFVNKTLLKEAITQKSPL------FDRLEFFGDSILEVAFTNYICHTYPNLKVK 61

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L +LR+ +V+N  +A  +V   LH+++L  + +L   + +F + + +      +G ++K
Sbjct: 62  ELRDLRTANVSNEKFARIAVNHNLHHFLLLQNPSLFKKVKNFAEAVRKEDDPVPYGGLVK 121

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP 408
              P +LAD +ESIA  +++D       ++E  R +LEP+ TP+ L L P
Sbjct: 122 A--PKILADTLESIAATVFIDVNYDVKRLWEIFRSLLEPIYTPDDLLLQP 169



 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 67/231 (29%), Positives = 109/231 (47%), Gaps = 3/231 (1%)
 Frame = -3

Query: 917  DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
            + +LNY+F + +LL E LTH +     +  +Q L F+G++ L  A T+H Y  YP L P 
Sbjct: 419  EKILNYSFVNKTLLKELLTHNN-----SPLFQGLMFVGESALSLAFTKHLYLTYPMLEPK 473

Query: 737  CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
             L+ LR  +  +  YA  +VK G++   + S         DF++ + +         V+K
Sbjct: 474  DLSVLRDANTCHDKYACVAVKKGIYQSFIGSVPKPEKMTTDFIELMGKEDDPYR---VVK 530

Query: 557  TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL---NPVKELTEL 387
               P +L +++  +AGA+Y+D       + E  R +LEP+ T + LR+    P   L  L
Sbjct: 531  A--PKILVNLLAGVAGAVYIDVKYNVQRLLEIFRVLLEPIYTLDDLRMQLKQPFLMLFRL 588

Query: 386  CQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
              K   ++       KDG +   I  +    +   S  A+   TAK LA E
Sbjct: 589  ADKHGKQI--DFRYSKDGGSRKNIAQVYMDDMFIASGCAKRIDTAKLLAAE 637



>gb:SPCC188_1721124 S.pombe chromosome III cosmid c188.
          Length = 653

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 76/229 (33%), Positives = 119/229 (51%), Gaps = 11/229 (4%)
 Frame = -3

Query: 1142 TSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN- 966
            TS K      +K+  + IAD+ EA IGA L  +G  +AL   + L + +  I      N 
Sbjct: 284  TSDKCRYAVLQKLSVKRIADMVEASIGACLLDSGLDSALKICKSLSVGLLDISNWDEWNN 343

Query: 965  -FPLN--AEQMVNVKRLES---DSLLNYTFRDPSLLVEALTHGSYIPHGT--QSYQRLEF 810
             F LN  A+ + NV+   S   +  + Y+F++  LL  A  H S +      ++YQ+LEF
Sbjct: 344  YFDLNTYADSLRNVQFPYSSYIEETIGYSFKNKKLLHLAFIHPSMMSQQGIYENYQQLEF 403

Query: 809  LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR 630
            LGDAVLDY + ++ Y +YP    G LT+ +S  V N   +       LH YI H S A+ 
Sbjct: 404  LGDAVLDYIIVQYLYKKYPNATSGELTDYKSFYVCNKSLSYIGFVLNLHKYIQHESAAMC 463

Query: 629  SSIADFVKNIE--QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSG 489
             +I ++ + IE  + +AS    +  +   P  ++D +E++  AI+LDSG
Sbjct: 464  DAIFEYQELIEAFRETASENPWFWFEIDSPKFISDTLEAMICAIFLDSG 512



>sp|Q09884|YQ3D_SCHPO Putative helicase C188.13c (EC
            3.6.1.-).>pir|T39130|S62524 probable RNA
            helicase/ribonuclease SPAC8A4.08c - fission yeast
            (Schizosaccharomyces pombe)>gb:SPCC584_1721435 S.pombe
            chromosome III cosmid c584.
          Length = 1374

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 76/229 (33%), Positives = 119/229 (51%), Gaps = 11/229 (4%)
 Frame = -3

Query: 1142 TSGKLYSRGRRKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGN- 966
            TS K      +K+  + IAD+ EA IGA L  +G  +AL   + L + +  I      N 
Sbjct: 1005 TSDKCRYAVLQKLSVKRIADMVEASIGACLLDSGLDSALKICKSLSVGLLDISNWDEWNN 1064

Query: 965  -FPLN--AEQMVNVKRLES---DSLLNYTFRDPSLLVEALTHGSYIPHGT--QSYQRLEF 810
             F LN  A+ + NV+   S   +  + Y+F++  LL  A  H S +      ++YQ+LEF
Sbjct: 1065 YFDLNTYADSLRNVQFPYSSYIEETIGYSFKNKKLLHLAFIHPSMMSQQGIYENYQQLEF 1124

Query: 809  LGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALR 630
            LGDAVLDY + ++ Y +YP    G LT+ +S  V N   +       LH YI H S A+ 
Sbjct: 1125 LGDAVLDYIIVQYLYKKYPNATSGELTDYKSFYVCNKSLSYIGFVLNLHKYIQHESAAMC 1184

Query: 629  SSIADFVKNIE--QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSG 489
             +I ++ + IE  + +AS    +  +   P  ++D +E++  AI+LDSG
Sbjct: 1185 DAIFEYQELIEAFRETASENPWFWFEIDSPKFISDTLEAMICAIFLDSG 1233



>gb:AC115634_1739216 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1653_D06, complete
           sequence.>gb:AC137002_1743363 Oryza sativa (japonica
           cultivar-group) chromosome 5 BAC clone OSJNBb0061M13,
           complete sequence.
          Length = 344

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 75/244 (30%), Positives = 113/244 (46%), Gaps = 38/244 (15%)
 Frame = -3

Query: 995 DFIDAPIVGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRL 816
           D ++ P  G     AE    V+RL     L Y FRD  LL EALTH S+      SYQRL
Sbjct: 14  DPVELPPPGFVADRAEAAARVERL-----LRYQFRDGRLLEEALTHQSFADDAV-SYQRL 67

Query: 815 EFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTA 636
           EF+GD+ L  A +   Y   P L PG L+ LR+ +++    A  +V+  L+  +  +   
Sbjct: 68  EFVGDSALGLAFSNFLYLTNPTLGPGPLSTLRAANISTEKLARVAVRHDLYPLLRRNCPR 127

Query: 635 LRSSIADFVKNIEQS-----SASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIV 471
           L   +  F++ ++Q      S     G V+K   P VLADI+E+IA A+Y+D     + +
Sbjct: 128 LDLLVGQFIETVKQEPEDDLSTVPYGGSVVKA--PKVLADIVEAIAAAVYVDCKFDLEKL 185

Query: 470 FEKI---------------------------------RPVLEPMVTPESLRLNPVKELTE 390
           ++++                                 R + EP++T E++   PV  L E
Sbjct: 186 WKRLTWLHGLQEIRWTVNTNNIKDWINNFIYGKRLVTRWLFEPIITAETIDEQPVTMLHE 245

Query: 389 LCQK 378
           LCQK
Sbjct: 246 LCQK 249



>gb:AP003933_1835453 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:OSJNBa0066C06.>gb:AP004258_1839259 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0024F24.
          Length = 256

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 65/182 (35%), Positives = 97/182 (53%), Gaps = 6/182 (3%)
 Frame = -3

Query: 914 SLLNYTFRDPS--LLVEALTHGSYIPH---GTQSYQRLEFLGDAVLDYAVTRHFYDQYPG 750
           +L  Y+FRD    LL +ALTH  +      G   +QRLEFLGDA L  A    FY   PG
Sbjct: 27  ALGGYSFRDGGALLLEDALTHSVHPRDEAGGRARHQRLEFLGDAALGLAFATIFYRDDPG 86

Query: 749 LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS-SIADFVKNIEQSSASSTF 573
           L  G LT LRS +V+    A  +V+  L+  +   + A +   ++ F K++E   +    
Sbjct: 87  LDQGDLTVLRSANVSTQKLARVAVRRRLYPLLRRYNCAPQDHEVSRFTKSVEGPYSGDPI 146

Query: 572 GWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELT 393
                   P VLADI+E+I GA+YLDS L  +++ +  + + EP++T ++L  +P   L 
Sbjct: 147 ------EGPRVLADIVEAIVGAVYLDSKLDLEVLQKVAKLLCEPIITKKALLEDPESMLN 200

Query: 392 EL 387
           EL
Sbjct: 201 EL 202



>sp|P74368|RNC_SYNY3 Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|S76204|S76204 hypothetical protein -
           Synechocystis sp. (strain PCC 6803)>gb:BA000022_689242
           Synechocystis sp. PCC 6803 DNA, complete genome.
          Length = 231

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 64/178 (35%), Positives = 86/178 (48%), Gaps = 7/178 (3%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           DP L +EALTH SY     GT SY RLEFLGDAVL + V R  +++YP      LT LRS
Sbjct: 11  DPQLKLEALTHRSYCNEHPGTPSYDRLEFLGDAVLGFVVGRILFERYPHFTEAELTRLRS 70

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
           + VN    A  +         LH +  +R S     ++  QSS             P +L
Sbjct: 71  QLVNQNQLAYLA-------RFLHIAPEIRLS-QSLARDDGQSS-------------PSIL 109

Query: 536 ADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPE---SLRLNPVKELTELCQK 378
           AD+ ES+ GA  LD GL    D + E   P+LE     +   S +L P  ++  + Q+
Sbjct: 110 ADVFESLLGAALLDRGLTAVEDFIQELFVPILEQWEKSQDGRSPKLVPTMDVKSMLQQ 167



>gb:BX571662_779163 Wolinella succinogenes, complete genome; segment
           6/7.
          Length = 238

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 69/239 (28%), Positives = 115/239 (48%), Gaps = 9/239 (3%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLF 744
           E +  L Y F++ +LL+EALTH SY      + +RLEFLGDAVLD  +    + ++P   
Sbjct: 6   EFEKRLGYRFQNKNLLIEALTHKSY--KKPYNNERLEFLGDAVLDLVIGEFLFLKFPKAD 63

Query: 743 PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWV 564
            G L+++R+  VN   +A  + +  L  +I             F+ N E+++        
Sbjct: 64  EGELSKMRASLVNEKGFAKLAERVSLGRHI-------------FISNAEENNKG------ 104

Query: 563 LKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE---PMVTPESLRLNPVKELT 393
                P +L++  E+  GAIYL++GL   +V E +  +L+   P +   SL  +    L 
Sbjct: 105 --REKPSLLSNAFEATMGAIYLETGL--SVVREVVHRLLDEVYPKIDLGSLFRDYKTALQ 160

Query: 392 ELCQKRKYRMKEPVVVHKDG-----EACTTIEVMANGGVRSCSSSARN-RKTAKRLACE 234
           EL Q +     E V++   G     E    + V+ +   R+C SS +  ++ A R+A E
Sbjct: 161 ELTQAKFGETPEYVILGSSGPDHKKEFEVAVCVLGSEYARACGSSKKEAQQEAARIALE 219



>sp|O84299|RNC_CHLTR Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|C71532|C71532 probable ribonuclease III -
           Chlamydia trachomatis (serotype D, strain
           UW3/Cx)>gb:AE001302_34225 Chlamydia trachomatis
           D/UW-3/CX section 29 of 87 of the complete
           genome.>gb:AE001273_1098251 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 231

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 77/252 (30%), Positives = 118/252 (46%), Gaps = 12/252 (4%)
 Frame = -3

Query: 950 EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY---IPHGTQSYQRLEFLGDAVLDYAV 780
           +  V+++ +ES   LN+TF  P LL+ ALTH SY    P   +  +RLEFLGDAVL   V
Sbjct: 2   QHTVDIQAIESK--LNFTFSHPRLLITALTHPSYRNEFPSAEEDSERLEFLGDAVLGLVV 59

Query: 779 TRHFYDQYPGLFPGCLTELRSESVN-NACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
           T H +  +P L  G L+  R+  VN  AC+  +  K  L  ++L         I    K 
Sbjct: 60  TEHLFLLFPALNEGLLSTTRAALVNAEACFEYTQ-KLSLGEHLL---------IGRGEKM 109

Query: 602 IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL---RTDIV-----FEKIRPVL 447
                  S +            A+++E+I GA+YLD GL   R  IV      E I P++
Sbjct: 110 QSHRGKISAY------------ANLLEAILGAVYLDGGLSPARQIIVPLLPDKESILPLM 157

Query: 446 EPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSAR 267
             +V P+    N +++ T+   K     K      +DG     ++V  NG +      A 
Sbjct: 158 --LVNPK----NRLQQFTQQTLKVLPSYKALPWKSEDGSPGYHVQVFVNGDLWG-EGFAG 210

Query: 266 NRKTAKRLACER 231
           ++K A++LA ++
Sbjct: 211 SKKEAEKLAAKQ 222



>gb:BX640418_806831 Bordetella pertussis strain Tohama I, complete
           genome; segment 8/12.>gb:BX640433_811532 Bordetella
           parapertussis strain 12822, complete genome; segment
           11/14.>gb:BX640448_816395 Bordetella bronchiseptica
           strain RB50, complete genome; segment 12/16.
          Length = 256

 Score = 77.4 bits (189), Expect = 5e-13
 Identities = 60/199 (30%), Positives = 98/199 (49%), Gaps = 2/199 (1%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           ++ L++ F D +LL +ALTH S   HG +  +RLEFLGD+VL++ V    +++Y  L  G
Sbjct: 10  ETRLDHRFGDKALLEQALTHRS---HGARHNERLEFLGDSVLNFVVAAMLFERYGKLDEG 66

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L+ LR+  V  A  A  + +  L  Y+      L+S    F +                
Sbjct: 67  DLSRLRANLVKQASLADIAQRLDLSQYLRLGEGELKS--GGFRR---------------- 108

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
              P +LAD +E++ GA++LD+G      ++  + +PV+   V P++L  +    L E  
Sbjct: 109 ---PSILADTVEALFGAVFLDAGFEAARRVIVRQYQPVM-AHVDPKTLGKDAKTLLQEFL 164

Query: 383 QKRKYRMKEPVVVHKDGEA 327
           Q RK  + +  VV   G A
Sbjct: 165 QGRKLALPQYTVVATHGAA 183



>gb:AY658047_2147057 Synthetic construct Peudomonas aeruginosa clone
           FLH040397.01F PA0770 gene, partial cds.
          Length = 230

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 66/204 (32%), Positives = 95/204 (46%), Gaps = 4/204 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF+D  L+V ALTH SY     ++ +RLEFLGDA+L++ +    +  +P    G L+
Sbjct: 12  LGYTFKDRDLMVLALTHRSY---AGRNNERLEFLGDAILNFVIGEALFHHFPQAREGQLS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  V     AL +    + +Y+   S  L+S                  G   + S 
Sbjct: 69  RLRARLVKGETLALLARGFEVGDYLRLGSGELKS------------------GGFRRES- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPM---VTPESLRLNPVKELTELCQK 378
             +LAD +E++ GAIYLD+G+  D   E+I   L P    +TP     +P   L E  Q 
Sbjct: 110 --ILADAMEALIGAIYLDTGM--DSARERIIAWLGPQLRELTPVDTNKDPKTRLQEFLQS 165

Query: 377 RKYRMKEPVVVHKDGEA-CTTIEV 309
           R   +    VV   GE  C T  V
Sbjct: 166 RGCDLPRYEVVDIQGEPHCRTFFV 189



>gb:AB182481_1202518 Tetrahymena thermophila DCL1 mRNA for
            Dicer-related RNase III protein Dcl1p, complete cds.
          Length = 1275

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 68/229 (29%), Positives = 111/229 (48%), Gaps = 14/229 (6%)
 Frame = -3

Query: 950  EQMVNVKRLESDSLLNYTFRDPSLLVEALT--HGSYIPHGTQSYQRLEFLGDAVLDYAVT 777
            EQ +++     + +LNYTF+D SLL++AL     S   H  Q YQ LEFLGDA+++  V 
Sbjct: 1004 EQTLDIAISGFEKILNYTFKDKSLLIKALNCHSNSNFEHYFQDYQILEFLGDALIEILVV 1063

Query: 776  RHFYD-----QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADF 612
             H Y      Q     P    E++S  ++N   +  ++    H Y L+ S   +  I  F
Sbjct: 1064 SHGYHISRNRQKKINSPYFFCEMKSLLLSNDFMSRMAILNKFHYYALNISKYQQDEIIQF 1123

Query: 611  VKNIEQSSASSTFGWVL--KTSFPWVLADIIESIAGAIYLDSGLRTDI-VFEKI-RPVLE 444
               IE  + ++ F   +  + + P VL D+ ES+AGAI +DS + T + ++ K+  P + 
Sbjct: 1124 ---IEDCNLNTKFKESVSHQANSPKVLGDLWESVAGAIIMDSDISTFVSIYGKLYAPYII 1180

Query: 443  PMVTPESLRLNPVKELTELCQKRKYRMK---EPVVVHKDGEACTTIEVM 306
              VT     +  VKE  +L  ++ Y        VV   DG+    + ++
Sbjct: 1181 HFVTFYQKIIFNVKEKVQLVAQQTYEQLGKITEVVKDTDGQYKVKVTIL 1229



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 38/148 (25%), Positives = 67/148 (45%), Gaps = 3/148 (2%)
 Frame = -3

Query: 890  DPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSES 711
            D  LL+E+ +  SY    T++ + LE +GD V+ Y  + + Y   P      LT +R+  
Sbjct: 732  DLELLIESFSQISYSK--TKNLELLEVIGDVVIKYISSLYLYLHLPNQSENALTMIRTIF 789

Query: 710  VNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWV--- 540
            +NN    +S+ + GL  Y+       R S  D+  N+   ++ +      K SF      
Sbjct: 790  INNKYLGISAFRNGLQFYV----QTKRPSSYDWRFNLFNLNSFTEAPQDQKQSFQLSYSN 845

Query: 539  LADIIESIAGAIYLDSGLRTDIVFEKIR 456
            L+D +ES+ G  Y  +    +   + I+
Sbjct: 846  LSDTLESVVGCFYASNQFTLNTCIQLIK 873



>sp|Q9XCX9|RNC_PSEAE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|E83548|E83548 ribonuclease III PA0770
           [imported] - Pseudomonas aeruginosa  (strain
           PAO1)>gb:AE004512_55005 Pseudomonas aeruginosa PAO1,
           section 73 of 529 of the complete
           genome.>gb:AF123492_480944 Pseudomonas aeruginosa
           rnc-era-recO operon, complete
           sequence.>gb:AE004091_969105 Pseudomonas aeruginosa
           PAO1, complete genome.
          Length = 229

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 66/204 (32%), Positives = 95/204 (46%), Gaps = 4/204 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF+D  L+V ALTH SY     ++ +RLEFLGDA+L++ +    +  +P    G L+
Sbjct: 12  LGYTFKDRDLMVLALTHRSY---AGRNNERLEFLGDAILNFVIGEALFHHFPQAREGQLS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  V     AL +    + +Y+   S  L+S                  G   + S 
Sbjct: 69  RLRARLVKGETLALLARGFEVGDYLRLGSGELKS------------------GGFRRES- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPM---VTPESLRLNPVKELTELCQK 378
             +LAD +E++ GAIYLD+G+  D   E+I   L P    +TP     +P   L E  Q 
Sbjct: 110 --ILADAMEALIGAIYLDTGM--DSARERIIAWLGPQLRELTPVDTNKDPKTRLQEFLQS 165

Query: 377 RKYRMKEPVVVHKDGEA-CTTIEV 309
           R   +    VV   GE  C T  V
Sbjct: 166 RGCDLPRYEVVDIQGEPHCRTFFV 189



>gb:BX321864_774653 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 9/10.
          Length = 245

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 67/230 (29%), Positives = 102/230 (44%), Gaps = 7/230 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF+ P LL EALTH S    G  + +R EFLGD+VL+ AV+   + ++P L  G LT
Sbjct: 31  LGYTFKQPDLLREALTHRSL---GFPNNERFEFLGDSVLNCAVSTLLFKRFPSLPEGDLT 87

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  VN       +   G+   IL      +S                          
Sbjct: 88  RLRANFVNQQALHRLASALGIGELILLGEGERKSG---------------------GHHR 126

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV---TPESLRLNPVKELTELCQK 378
           P +LA+ +E+I GAIYL+SG    +V + I  + EP++    P++   +    L E  Q 
Sbjct: 127 PSILANAVEAIIGAIYLESGFA--VVEQVIVALYEPLIRQLDPDTSGKDSKTLLQEYLQS 184

Query: 377 RKYRMKEPVVVHKDGEACTTIE----VMANGGVRSCSSSARNRKTAKRLA 240
           RK  + E  V+   G+    +     V+   G+R+       R+  +  A
Sbjct: 185 RKIALPEYSVLLAQGDPHAQVFHVECVIPGFGIRTRGEGTSRRRAEQEAA 234



>gb:AE017340_456572 Idiomarina loihiensis L2TR, complete genome.
          Length = 229

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 64/230 (27%), Positives = 104/230 (45%), Gaps = 2/230 (0%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLF 744
           E + ++ Y+F    LL +A+TH S     +   +RLEFLGD++L   +    Y ++P + 
Sbjct: 10  ELEKIVGYSFEQQGLLHQAMTHRSA---SSTHNERLEFLGDSILGLVIAEALYQKFPKVA 66

Query: 743 PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWV 564
            G L+ +R+  V     A    K GL +++      L+S                  G  
Sbjct: 67  EGDLSRMRAAIVCGRSLAKLGKKMGLGDFLSLGQGELKS------------------GGY 108

Query: 563 LKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTE 390
            + S   +LAD +E+I GAIYLDS + T   ++     P L  ++ P + + +P   L E
Sbjct: 109 RRES---ILADAVEAIIGAIYLDSDMDTIRQVILNWFEPQL-TLIEPGTSQKDPKTRLQE 164

Query: 389 LCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA 240
           L Q R+  + E  VV   G+A    +   N  V    S  +   T++R A
Sbjct: 165 LLQARQKPLPEYDVVATQGQAHNQ-QFTVNCSVEGIESPFKGTGTSRRKA 213



>gb:AE017157_393400 Chlamydophila pneumoniae TW-183, section 1 of 4
           of the complete genome.>gb:AE009440_1027662
           Chlamydophila pneumoniae TW-183, complete genome.
          Length = 237

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 72/242 (29%), Positives = 110/242 (45%), Gaps = 13/242 (5%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGT---QSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           ++ LN+TF  P LL  ALTH SY        +  +RLEFLGDAVL   VT H +  +P +
Sbjct: 11  EAKLNFTFTQPKLLEIALTHPSYKNESAVQIEDSERLEFLGDAVLGLIVTEHLFLLFPSM 70

Query: 746 FPGCLTELRSESVN-NACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFG 570
             G L+  R+  VN  AC   ++V  G+ +Y+L         I    K   +    S + 
Sbjct: 71  DEGTLSTARASLVNAKACCRYTTV-LGIGDYLL---------IGKGEKIQSERGRLSAY- 119

Query: 569 WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL-----NPV 405
                      A++ ESI GA+YLD GL         R +  P++ P    L     NP 
Sbjct: 120 -----------ANLFESILGAVYLDGGL------SPARKLTVPLLPPREEILPLMSGNPK 162

Query: 404 KELTELCQKRKYRM----KEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLAC 237
             L +  QK ++R+    +   V    G     I+V+ N  V     +A ++K A+++A 
Sbjct: 163 NLLQQFTQK-QFRVLPVYQSTAVTDAQGNVSYQIQVLVNQEVWG-EGNASSKKEAEKIAA 220

Query: 236 ER 231
           ++
Sbjct: 221 QQ 222



>sp|Q9Z9C7|RNC_CHLPN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|G86497|G86497 ribonuclease III [imported] -
           Chlamydophila pneumoniae  (strain
           J138)>pir|D72126|D72126 ribonuclease III CP0721
           [imported] - Chlamydophila pneumoniae (strains CWL029
           and AR39)>gb:AE001590_36919 Chlamydia pneumoniae section
           6 of 103 of the complete genome.>gb:AE002231_44198
           Chlamydophila pneumoniae AR39, section 59 of 94 of the
           complete genome.>gb:BA000008_663428 Chlamydophila
           pneumoniae J138 genomic DNA, complete
           sequence.>gb:AE002161_886323 Chlamydophila pneumoniae
           AR39, complete genome.>gb:AE001363_941476 Chlamydia
           pneumoniae, complete genome.
          Length = 237

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 69/241 (28%), Positives = 106/241 (43%), Gaps = 12/241 (4%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGT---QSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           ++ LN+TF  P LL  ALTH SY        +  +RLEFLGDAVL   VT H +  +P +
Sbjct: 11  EAKLNFTFTQPKLLEIALTHPSYKNESAVQIEDSERLEFLGDAVLGLIVTEHLFLLFPSM 70

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G L+  R+  VN       +   G+ +Y+L         I    K   +    S +  
Sbjct: 71  DEGTLSTARASLVNAKACCRYTTMLGIGDYLL---------IGKGEKIQSERGRLSAY-- 119

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL-----NPVK 402
                     A++ ESI GA+YLD GL         R +  P++ P    L     NP  
Sbjct: 120 ----------ANLFESILGAVYLDGGL------SPARKLTVPLLPPREEILPLMSGNPKN 163

Query: 401 ELTELCQKRKYRM----KEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
            L +  QK ++R+    +   V    G     I+V+ N  V     +A ++K A+++A +
Sbjct: 164 LLQQFTQK-QFRVLPVYQSTAVTDAQGNVSYQIQVLVNQEVWG-EGNASSKKEAEKIAAQ 221

Query: 233 R 231
           +
Sbjct: 222 Q 222



>sp|Q98514|A464_CHVP1 Putative protein A464R.>pir|T17966|T17966
           ribonuclease III homolog A464R - Chlorella virus
           PBCV-1>gb:PBU42580_2445923 Paramecium bursaria Chlorella
           virus 1, complete genome.
          Length = 275

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 58/207 (28%), Positives = 95/207 (45%), Gaps = 4/207 (1%)
 Frame = -3

Query: 848 IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAG 669
           I  G  +Y+R+EF+GD+VL + + R+ YD +PG   G L+ LR++ V+    +  +++ G
Sbjct: 77  IVEGEATYERMEFVGDSVLGFIIARYLYDNFPGKDEGFLSRLRTKFVSGKFLSSIALRMG 136

Query: 668 LHNY-ILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDS 492
           LHNY I+H     R                   GW    + P +L D+ E++ GAIY D 
Sbjct: 137 LHNYVIMHQKGLYR-------------------GW---NTNPRILEDVFEALMGAIYFDL 174

Query: 491 GLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP---VVVHKDGEACT 321
           G+     F      L      +SL L+   +   L   RK  +  P    V  K G   +
Sbjct: 175 GINAAKQF--FMTTLAKYADMQSLMLDTNYKDRLLKHTRKVELPRPEFVSVFEKGGANPS 232

Query: 320 TIEVMANGGVRSCSSSARNRKTAKRLA 240
            I  +   G +  + + ++RK A++ A
Sbjct: 233 FIVDVVINGQKISTGTGKSRKDAEQNA 259



>sp|Q9PK97|RNC_CHLMU Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|C81688|C81688 ribonuclease III TC0570
           [imported] - Chlamydia muridarum  (strain
           Nigg)>gb:AE002324_45156 Chlamydia muridarum Nigg section
           55 of 85 of the complete genome.>gb:AE002160_1149296
           Chlamydia muridarum Nigg, complete genome.
          Length = 232

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 72/252 (28%), Positives = 111/252 (44%), Gaps = 12/252 (4%)
 Frame = -3

Query: 950 EQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSY---IPHGTQSYQRLEFLGDAVLDYAV 780
           ++ VN++ +ES   L +TF  P LLV ALTH SY    P   +  +RLEFLGDAVL   V
Sbjct: 2   QRTVNIQAVESK--LKFTFSQPRLLVTALTHPSYRNEFPSDGEDSERLEFLGDAVLGLVV 59

Query: 779 TRHFYDQYPGLFPGCLTELRSESVN-NACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
           T H +  +P L  G L+  RS  VN  AC+          NY    S      I    K 
Sbjct: 60  TEHLFLLFPSLNEGLLSTTRSALVNAEACF----------NYTQKLSLGEHLLIGRGEKM 109

Query: 602 IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES 423
                  S +            A++ E+I GA+YLD GL         R ++ P++  + 
Sbjct: 110 QSHRGKISAY------------ANLFEAILGAVYLDGGL------APARQIIVPLLPNKE 151

Query: 422 -----LRLNPVKELTELCQKRKYRMKEPVVV---HKDGEACTTIEVMANGGVRSCSSSAR 267
                + +NP   L +  Q+    +   + +    +DG     ++V  N  +      A 
Sbjct: 152 AILPLMLVNPKNRLQQFTQQTLKVLPTYIALPWSSEDGTPGYHVQVFVNEKLWG-EGFAG 210

Query: 266 NRKTAKRLACER 231
           ++K A++LA ++
Sbjct: 211 SKKEAEKLAAKQ 222



>gb:AJ749949_532012 Francisella tularensis subsp. tularensis
           complete genome.>gb:AY774167_2148880 Synthetic construct
           Francisella tularensis clone FLH155365.01X NT02FT1862
           gene, complete cds.
          Length = 230

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 61/235 (25%), Positives = 110/235 (46%), Gaps = 6/235 (2%)
 Frame = -3

Query: 914 SLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGC 735
           ++L Y F+D +LL+ ALTH S      ++Y+RLEFLGD+VL + +    Y Q+  L  G 
Sbjct: 10  NILGYNFKDYTLLIRALTHRSKTK---KNYERLEFLGDSVLSFVIAEVLYKQFIDLAEGK 66

Query: 734 LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT 555
           L++LRS+ V  A  A  +    +  YI+  ++             EQ             
Sbjct: 67  LSQLRSKLVKGATLAQLASSLKMDEYIILGAS-------------EQGGHKR-------- 105

Query: 554 SFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVK-ELTELC 384
               +L D+ E++ GAIYLDS   T   ++ +  +P++   +  +++++   K +L E+ 
Sbjct: 106 --EKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPIIS-SINLDTIKVKDSKSKLQEIL 162

Query: 383 QKRKYRMKE---PVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
            +    + E     +  KD E   T+  ++        +   +RK A++   E+M
Sbjct: 163 LQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTAEKM 217



>gb:CR628337_115034 Legionella pneumophila str. Lens complete
           genome.
          Length = 224

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 5/243 (2%)
 Frame = -3

Query: 941 VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD 762
           +N++RL     LNY F + + L +ALTH S    G+ +Y+R EFLGD++L + +    ++
Sbjct: 3   INLERL--CRRLNYHFNNMAYLKQALTHCSA---GSDNYERFEFLGDSILSFVIANELFN 57

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           ++P    G L+ LRS  V     A  + + GL +Y+      LRS               
Sbjct: 58  RFPLHSEGQLSRLRSFLVKGEMLAEIAREIGLGDYLFLGQGELRS--------------- 102

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNP 408
              G   +TS   +LAD +E+I  AIYLD G+     I+       L+       L+ + 
Sbjct: 103 ---GGFRRTS---ILADALEAILAAIYLDGGMTAAKQIILMLYSSRLDDPDLNHCLK-DA 155

Query: 407 VKELTELCQKRKYRMKEPVVVHKDGEACTTI---EVMANGGVRSCSSSARNRKTAKRLAC 237
             +L E  Q  K+ + E V+   +G+    I        G  +    +  NR+ A++LA 
Sbjct: 156 KTQLQEFLQASKFALPEYVLTKVEGDEHAQIFHVTCTIEGVSQVAYGTGPNRRKAEQLAA 215

Query: 236 ERM 228
           + M
Sbjct: 216 KAM 218



>sp|Q87XG1|RNC_PSESM Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE016871_353585 Pseudomonas syringae pv. tomato
           str. DC3000 section 16 of 21 of the complete
           genome.>gb:AE016853_1038760 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 229

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 72/242 (29%), Positives = 111/242 (45%), Gaps = 8/242 (3%)
 Frame = -3

Query: 941 VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD 762
           V++ RLE    L YTF+D  L++ ALTH S+     ++ +RLEFLGDA+L++      ++
Sbjct: 3   VSLSRLERQ--LGYTFKDQELMILALTHRSF---AGRNNERLEFLGDAILNFVAGEALFE 57

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           ++P    G L+ LR+  V     AL +    L  Y+   S  L+S               
Sbjct: 58  RFPQAREGQLSRLRARLVKGETLALLARGFDLGEYLRLGSGELKS--------------- 102

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPE--SLRL-- 414
              G   + S   +LAD +E++ GAIYLD+G+      E  R  +   +T E  SL L  
Sbjct: 103 ---GGFRRES---ILADALEALIGAIYLDAGM------EAARERVLAWLTTEFDSLTLVD 150

Query: 413 ---NPVKELTELCQKRKYRMKEPVVVHKDGEA-CTTIEVMANGGVRSCSSSARNRKTAKR 246
              +P   L E  Q R   +    VV   GE  C T  V     +   +  +R +  ++R
Sbjct: 151 TNKDPKTRLQEFLQSRACDLPRYEVVDIQGEPHCRTFFVECE--INLLNEKSRGQGVSRR 208

Query: 245 LA 240
           +A
Sbjct: 209 IA 210



>sp|Q823R4|RNC_CHLCV Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE016995_374405 Chlamydophila caviae GPIC
           section 2 of 4 of the complete
           genome.>gb:AE015925_994084 Chlamydophila caviae GPIC
           complete genome.
          Length = 237

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 72/251 (28%), Positives = 114/251 (45%), Gaps = 13/251 (5%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHG---TQSYQRLEFLGDAVLDYAVTR 774
           ++N+K +E+   LN+TF  P LLV ALTH SY       T+  +RLEFLGDAVL   VT 
Sbjct: 4   LINIKEVEAK--LNFTFTQPKLLVTALTHPSYRNETVTITEDSERLEFLGDAVLCLIVTE 61

Query: 773 HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
           H +  +P +  G L+  R+  +N       +   GL  ++L           + ++N E+
Sbjct: 62  HLFLLFPSMDEGTLSTARAALINAVSCCQYTDALGLGEHLLIGK-------GERIQN-ER 113

Query: 593 SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
              S+              A++ E++ GA+YLD GL         R +  P++  +   L
Sbjct: 114 GRTSA-------------YANLFEAVLGAVYLDGGL------APARQITVPLLPSKKDIL 154

Query: 413 -----NPVKELTELCQKRKYRMKEPVV-----VHKDGEACTTIEVMANGGVRSCSSSARN 264
                NP   L +L QK+   +  PV        + G     I V+ N  V      A +
Sbjct: 155 PLMLGNPKNRLQQLTQKQLRTL--PVYQCTPWTSQQGVPGYHIRVIVNDEVWG-EGCALS 211

Query: 263 RKTAKRLACER 231
           +K A++LA ++
Sbjct: 212 KKEAEKLAAQK 222



>gb:AE017282_428217 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 230

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 68/233 (29%), Positives = 103/233 (44%), Gaps = 6/233 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L   FRDP LL  ALTH S    G  + +RLEFLGD+VL + VT + Y ++P    G L+
Sbjct: 12  LGIPFRDPGLLRNALTHRS--AEGVNN-ERLEFLGDSVLGFVVTEYLYQRFPSADEGVLS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  VN    A  + +  L  Y++  S  L+S                  G   + S 
Sbjct: 69  RLRATLVNETSLARIARELELGEYLILGSGELKS------------------GGYRRDS- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL---RLNPVKELTELCQK 378
             +L+D +E+I GA+  D G+  D     I  + E  ++  SL   + +P   L EL Q 
Sbjct: 110 --ILSDALEAILGAVLRDQGI--DACRALILTLFERPLSALSLDDWKKDPKTRLQELMQG 165

Query: 377 RKYRMKEPVVVHKDG---EACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
           R   +    ++ + G   +    +       V  C     +RK A++ A E M
Sbjct: 166 RGLPLPVYTLIDQSGLPHDQHFRVRCEVPLAVEPCVGEGSSRKKAEQQAAENM 218



>gb:CR628336_111950 Legionella pneumophila str. Paris complete
           genome.
          Length = 224

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 68/243 (27%), Positives = 111/243 (45%), Gaps = 5/243 (2%)
 Frame = -3

Query: 941 VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD 762
           +N++RL     LNY F + + L +ALTH S    G+ +Y+R EFLGD++L + +    ++
Sbjct: 3   INLERL--CRRLNYHFNNIAYLKQALTHCSA---GSDNYERFEFLGDSILSFVIANELFN 57

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           ++P    G L+ LRS  V     A  + + GL +Y+      LRS               
Sbjct: 58  RFPLHSEGQLSRLRSFLVKGEMLAEIAREIGLGDYLFLGQGELRS--------------- 102

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNP 408
              G   +TS   +LAD +E+I  AIYLD G+     I+       L+       L+ + 
Sbjct: 103 ---GGFRRTS---ILADALEAILAAIYLDGGMTAAKQIILMLYSSRLDDPDLNHCLK-DA 155

Query: 407 VKELTELCQKRKYRMKEPVVVHKDGEACTTI---EVMANGGVRSCSSSARNRKTAKRLAC 237
             +L E  Q  K+ + E V+   +G+    I        G  +    +  NR+ A++LA 
Sbjct: 156 KTQLQEFLQASKFALPEYVLTKIEGDEHAQIFHVTCTIEGVSQVAYGTGPNRRKAEQLAA 215

Query: 236 ERM 228
           + M
Sbjct: 216 KAM 218



>sp|P57805|RNC_PASMU Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE006042_214949 Pasteurella multocida subsp.
           multocida str. Pm70 section 9 of 204 of the complete
           genome.>gb:AE004439_1117679 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 225

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 70/242 (28%), Positives = 111/242 (45%), Gaps = 5/242 (2%)
 Frame = -3

Query: 938 NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQ 759
           N++RL+    + Y F  P+LL +ALTH S      +  +RLEFLGDA+L++ +    Y Q
Sbjct: 4   NLERLQRQ--IGYQFNQPALLKQALTHRSA---AVKHNERLEFLGDAILNFIIAEALYHQ 58

Query: 758 YPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS 579
           +P    G L+ +R+  V     A  + +  L +Y+      L+S                
Sbjct: 59  FPKCNEGELSRMRATLVREPTLASLARQFELGDYLSLGPGELKS---------------- 102

Query: 578 TFGWVLKTSFPWVLADIIESIAGAIYLDSGL--RTDIVFEKIRPVLEPMVTPESLRLNPV 405
             G   + S   +LAD +E+I GAI LDS L   T IV    +  L+  + P   + +P 
Sbjct: 103 --GGFRRES---ILADCVEAIIGAISLDSDLATTTKIVQHWYQAQLK-QIQPGDNQKDPK 156

Query: 404 KELTELCQKRKYRMKEPVVVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
             L E  Q ++  +    VV   GEA     T+E       R+   S  +R+ A++ A E
Sbjct: 157 TRLQEYLQGKRLPLPTYNVVEIKGEAHCQTFTVECYVKNIDRTFMGSGASRRKAEQAAAE 216

Query: 233 RM 228
           ++
Sbjct: 217 KI 218



>sp|Q819V8|RNC_BACCR Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE017010_378725 Bacillus cereus ATCC 14579
           section 13 of 18 of the complete
           genome.>gb:AE016877_1018975 Bacillus cereus ATCC 14579
           complete genome.
          Length = 245

 Score = 73.2 bits (178), Expect = 1e-11
 Identities = 58/202 (28%), Positives = 93/202 (46%), Gaps = 8/202 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYI------PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           +  TF D  LL++A TH SY+      PH  +  +RLEFLGDAVL+  V+++ + +YP +
Sbjct: 26  IGITFTDEKLLIQAFTHSSYVNEHRKKPH--EDNERLEFLGDAVLELTVSQYLFQKYPTM 83

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G LT+LR      A            N +   S  L     +     E+         
Sbjct: 84  SEGELTKLR------AAIVCEPSLVRFANELSFGSLVLLGKGEEMTGGRER--------- 128

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR--LNPVKELT 393
                 P +LAD+ E+  GA+YLD GL T  V+E ++ ++ P +   +    ++   +L 
Sbjct: 129 ------PALLADVFEAFIGALYLDQGLET--VWEFLKEIVYPKINEGAFSHVMDYKSQLQ 180

Query: 392 ELCQKRKYRMKEPVVVHKDGEA 327
           EL Q+      E  ++ + G A
Sbjct: 181 ELIQRDGSGNVEYQILQEKGPA 202



>gb:AB182480_1202517 Tetrahymena thermophila DCR2 mRNA for
            Dicer-related RNase III protein Dcr2p, partial cds.
          Length = 1838

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/158 (29%), Positives = 79/158 (50%), Gaps = 6/158 (3%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            QRLEFLGDAVLD  +  + ++++P   PG LT++++  V N    L ++  G + +I+ S
Sbjct: 1623 QRLEFLGDAVLDLIIVEYLFNKFPNSDPGELTQMKTSLVQNKTLCLINLMKGFYKFIIGS 1682

Query: 644  STALRSSIADFVKNIE--QSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTD-- 477
                +  I   + N+E      S  +      S    L D+IES+ GAI++D+ L  +  
Sbjct: 1683 IQHNKEEIELLLNNVEMFMGDTSLMYDTTYNQSLIKTLGDVIESLVGAIFIDNNLDYEIT 1742

Query: 476  --IVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKY 369
              IV E +   +    T +  RL  ++   E   K+++
Sbjct: 1743 KKIVMETLFAEILQYFTGQEHRLKNLQLYIEKVLKKEF 1780



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 28/89 (31%), Positives = 41/89 (46%), Gaps = 1/89 (1%)
 Frame = -3

Query: 884  SLLVEALTHGSYIPHGTQS-YQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
            S L+++LT   Y  +  +S  +R EFLGD VL    +   Y ++P      L   R+  +
Sbjct: 1307 SELMKSLTSLEYAVNNKESSLERYEFLGDTVLKCLSSTQIYFEHPKSMEDHLHVHRTIII 1366

Query: 707  NNACYALSSVKAGLHNYILHSSTALRSSI 621
             N   A  +VK  +  YIL S     S I
Sbjct: 1367 QNRNLAQIAVKKKIFKYILSSKIETLSPI 1395



 Score = 33.9 bits (76), Expect = 6.5
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 5/89 (5%)
 Frame = -3

Query: 1112 RKMDNETIADVTEALIGAFLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM--- 942
            R +  +T+AD  E++IG F     ++    +L +    ++  D     ++  + +Q    
Sbjct: 1464 RHIKGKTLADTLESIIGVFFQQKKDLNLCQYLLFSLQVLNKPDLTFNHSYDRSLQQSQLQ 1523

Query: 941  --VNVKRLESDSLLNYTFRDPSLLVEALT 861
              + V+  E +S+L YTF++ +LL +A T
Sbjct: 1524 NPIYVQLKEIESILGYTFQNINLLFQAFT 1552



>sp|Q8KAN7|RNC_CHLTE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE012960_287577 Chlorobium tepidum TLS section
           181 of 194 of the complete genome.>gb:AE006470_934745
           Chlorobium tepidum TLS complete genome.
          Length = 272

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 69/227 (30%), Positives = 106/227 (46%), Gaps = 15/227 (6%)
 Frame = -3

Query: 869 ALTHGSYI------PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
           ALTH S +       H  +S QRLEFLGDAVLD  ++ H + Q+PG   G L+  R++ V
Sbjct: 51  ALTHRSVLHDHHSEEHKPESNQRLEFLGDAVLDLLISEHLFKQFPGSDEGHLSSNRAKIV 110

Query: 707 NNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADI 528
           N    A  +++  L  +++   +A +  I        ++S S+             LAD 
Sbjct: 111 NRKSLAAFALELQLGEHLIIGESADKQKI--------RTSESA-------------LADA 149

Query: 527 IESIAGAIYLDSGLR------TDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRKYR 366
           +E++ GAIYLD GL       T+ V  K+   L  +V  E    N    L E  Q R+  
Sbjct: 150 LEALVGAIYLDQGLAGAERFITNHVIAKVD--LHKLVEAE---YNYKSRLIEYTQSRQLP 204

Query: 365 MKEPVVVHKDG---EACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
                V+ ++G   E    +EV  NG      ++ R +K A++LA +
Sbjct: 205 PPLYTVITEEGAEHEKTFVVEVSCNGQPLGRGTAPR-KKDAEQLAAK 250



>gb:AY458647_620010 Uncultured bacterium 580 clone EBAC000-36A07
           genomic sequence.
          Length = 231

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 65/229 (28%), Positives = 107/229 (46%), Gaps = 4/229 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           + Y F+D  LL  A+TH S   H   + +RLEFLGD++L++ V    + ++  L  G L+
Sbjct: 13  IKYKFKDDKLLALAMTHRS---HSGMNNERLEFLGDSILNFVVADLLFKKFNDLDEGDLS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LRS+ V      LS +   L              I DF+ N+      S+ GW      
Sbjct: 70  RLRSQLVKEE--PLSKLGNEL-------------KIGDFL-NLGVGELKSS-GW----RR 108

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVF-EKIRPVLEPMVTPESLRLNPVKELTELCQKRK 372
           P +LAD  E++ GAI++D G+++   F E     L   + P+ +  +P   L E  Q +K
Sbjct: 109 PSILADAFEALIGAIFIDGGMKSAYKFIEDSYADLIEKINPKEIYKDPKTILQEFLQAQK 168

Query: 371 YRMKEPVVVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
             +    V++ +GEA     T+  + +          R+RK A++ A +
Sbjct: 169 VPLPSYEVINVEGEAHNQLFTVTCVVSKFDVKVEGGGRSRKIAEQEAAK 217



>sp|Q9ZBQ7|RNC_STRCO Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|T35656|T35656 ribonuclease III - Streptomyces
           coelicolor>gb:SCO939124_179244 Streptomyces coelicolor
           A3(2) complete genome; segment 21/29.
          Length = 272

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 70/225 (31%), Positives = 103/225 (45%), Gaps = 6/225 (2%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           + +LLV ALTH SY     G  + +RLEFLGD+VL   VT   Y  +P L  G L +LR+
Sbjct: 39  ESALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTHPDLPEGQLAKLRA 98

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
             VN+   AL+ V  GL              +  F++           G   K S   +L
Sbjct: 99  AVVNSR--ALAEVGRGL-------------ELGSFIR---LGRGEEGTGGRDKAS---IL 137

Query: 536 ADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES---LRLNPVKELTELCQKRKYR 366
           AD +E++ GA+YLD GL  D   E +  + +P++   S     L+    L EL       
Sbjct: 138 ADTLEAVIGAVYLDQGL--DAASELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLG 195

Query: 365 MKEPVVVHKDGEACTTIEVMAN-GGVRSCSSSARNRKTAKRLACE 234
           + E +V     +   T    A  GGV   + + R++K A++ A E
Sbjct: 196 VPEYLVTETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAAE 240



>gb:AE017328_444253 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076609
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 229

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 60/239 (25%), Positives = 108/239 (45%), Gaps = 9/239 (3%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYDQY 756
           E    + + F+D  LL +A TH SY+        +  +RLEFLGDAVL+  V+ + +++Y
Sbjct: 6   ELQESVGFDFKDVELLKQAFTHSSYVNEHRRENVKDNERLEFLGDAVLELTVSNYLFNKY 65

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
           P +  G +T++R+                    +   S    +    F K +        
Sbjct: 66  PDMAEGHMTKMRAA------------------IVCEPSLVEFAEAVHFSKYVRLGKGEEK 107

Query: 575 FGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL--RLNPVK 402
            G   +   P +LAD+ ES  GA+YLD+G+   + F  +  V+ P +   +    ++   
Sbjct: 108 AGGRTR---PALLADVFESFIGALYLDNGIDKVVTF--LERVIFPKIDAGAYLQTVDYKT 162

Query: 401 ELTELCQKRKYRMKEPVVVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
           +L E+ Q+ +  + E  ++ + G A       +V+ NG V     S R +K A++ A +
Sbjct: 163 QLQEIVQRDRDVLIEYDILGETGPAHNKAFDAQVIVNGQVLG-KGSGRTKKQAEQSAAQ 220



>gb:CR555306_108559 Azoarcus sp. EbN1 complete genome.
          Length = 225

 Score = 71.2 bits (173), Expect = 4e-11
 Identities = 63/229 (27%), Positives = 106/229 (46%), Gaps = 4/229 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L + F +P+LL +ALTH S+   G  + +RLEFLGD++L+  V    ++++  L  G ++
Sbjct: 12  LGHRFDNPALLEQALTHRSF---GQPNNERLEFLGDSILNCVVAIALFERFASLREGEMS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  V          + GLH        AL   + ++++  E    S  F        
Sbjct: 69  RLRASLV---------CQDGLHR------VALELDLGEYLRLGEGEMKSGGF------RR 107

Query: 548 PWVLADIIESIAGAIYLDSGL-RTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRK 372
           P +LAD +E++  A +LD G      V +++   +   + P     +P   L EL Q RK
Sbjct: 108 PSILADALEAVFAATFLDQGFAAAKAVIDRLYDPMIAAIDPGVAAKDPKTALQELLQGRK 167

Query: 371 YRMKEPVVVHKDGEA-CTTIEVMANGGVRSCSSSAR--NRKTAKRLACE 234
             +   V+    GEA     EV+      +  ++ R  NR+ A++ A E
Sbjct: 168 LPLPTYVMAKVHGEAHAQEFEVVCEVNALNLRTTGRGTNRRAAEQQAAE 216



>gb:AP006840_568642 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 235

 Score = 70.9 bits (172), Expect = 5e-11
 Identities = 48/143 (33%), Positives = 71/143 (49%), Gaps = 2/143 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG--TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGC 735
           L Y FRD SLL+EALTH +Y       ++ +RLEFLGD+VL   +  H Y++YP L  G 
Sbjct: 18  LGYEFRDESLLLEALTHTTYANEHPRARANERLEFLGDSVLGMVIAAHLYERYPDLPEGE 77

Query: 734 LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT 555
           LT++R+  V     A  +   G+  +       +R    + V   ++ S           
Sbjct: 78  LTKIRAAVVCEPSLAERARVLGIGRH-------MRFGRGEAVSGRDRDS----------- 119

Query: 554 SFPWVLADIIESIAGAIYLDSGL 486
                L+D  E++ GA+YLD GL
Sbjct: 120 ----TLSDAFEAVVGALYLDGGL 138



>gb:AE017276_425095 Bacillus cereus ATCC 10987, section 13 of 18 of
           the complete genome.>gb:AE017194_1063514 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 245

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/162 (32%), Positives = 75/162 (46%), Gaps = 12/162 (7%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYI------PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           +  TF D  LL++A TH SY+      PH  +  +RLEFLGDAVL+  V+++ + +YP +
Sbjct: 26  IGITFTDEKLLIQAFTHSSYVNEHRKKPH--EDNERLEFLGDAVLELTVSQYLFQKYPTM 83

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G LT+LR      A            N +   S  L     +     E+         
Sbjct: 84  SEGELTKLR------AAIVCEPSLVRFANELSFGSLVLLGKGEEMTGGRER--------- 128

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRT------DIVFEKI 459
                 P +LAD+ E+  GA+YLD GL T      +IV+ KI
Sbjct: 129 ------PALLADVFEAFIGALYLDQGLETVWGFLKEIVYPKI 164



>sp|Q81WI8|RNC_BACAN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE017036_383957 Bacillus anthracis str. Ames
           section 13 of 18 of the complete
           genome.>gb:AE017225_409078 Bacillus anthracis str.
           Sterne, complete genome.>gb:AE017334_453804 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE017355_464886 Bacillus thuringiensis
           serovar konkukian str. 97-27, complete
           genome.>gb:AE016879_1013662 Bacillus anthracis str. Ames
           complete genome.
          Length = 245

 Score = 70.5 bits (171), Expect = 6e-11
 Identities = 52/162 (32%), Positives = 75/162 (46%), Gaps = 12/162 (7%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYI------PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           +  TF D  LL++A TH SY+      PH  +  +RLEFLGDAVL+  V+++ + +YP +
Sbjct: 26  IGITFTDEKLLIQAFTHSSYVNEHRKKPH--EDNERLEFLGDAVLELTVSQYLFQKYPTM 83

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G LT+LR      A            N +   S  L     +     E+         
Sbjct: 84  SEGELTKLR------AAIVCEPSLVRFANELSFGSLVLLGKGEEMTGGRER--------- 128

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRT------DIVFEKI 459
                 P +LAD+ E+  GA+YLD GL T      +IV+ KI
Sbjct: 129 ------PALLADVFEAFIGALYLDQGLETVWGFLKEIVYPKI 164



>gb:BA000030_700551 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 276

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 69/225 (30%), Positives = 103/225 (45%), Gaps = 6/225 (2%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           + +LLV ALTH SY     G  + +RLEFLGD+VL   VT   Y  +P L  G L +LR+
Sbjct: 33  ESALLVRALTHRSYAYENGGLPTNERLEFLGDSVLGLVVTDTLYRTHPDLPEGQLAKLRA 92

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
             VN+   AL+ V  GL              +  F++           G   K S   +L
Sbjct: 93  AVVNSR--ALAEVGRGL-------------ELGSFIR---LGRGEEGTGGRDKAS---IL 131

Query: 536 ADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPES---LRLNPVKELTELCQKRKYR 366
           AD +E++ GA+YLD GL  +   E +  + +P++   S     L+    L EL       
Sbjct: 132 ADTLEAVIGAVYLDQGL--EAAGELVHRLFDPLIEKSSNLGAGLDWKTSLQELTATEGLG 189

Query: 365 MKEPVVVHKDGEACTTIEVMAN-GGVRSCSSSARNRKTAKRLACE 234
           + E +V     +   T    A  GGV   + + R++K A++ A E
Sbjct: 190 VPEYLVTETGPDHEKTFTAAARVGGVSYGTGTGRSKKEAEQQAAE 234



>gb:AE017354_460228 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 224

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 67/243 (27%), Positives = 110/243 (45%), Gaps = 5/243 (2%)
 Frame = -3

Query: 941 VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYD 762
           +N++RL     LNY F + + L +ALTH S    G+ +Y+R EFLGD++L + +    ++
Sbjct: 3   INLERL--CRRLNYHFNNIAYLKQALTHCSA---GSDNYERFEFLGDSILSFVIANELFN 57

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           ++P    G L+ LRS  V     A  + +  L +Y+      LRS               
Sbjct: 58  RFPLHSEGQLSRLRSFLVKGEMLAEIAREIDLGDYLFLGQGELRS--------------- 102

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGL--RTDIVFEKIRPVLEPMVTPESLRLNP 408
              G   +TS   +LAD +E+I  AIYLD G+     I+       L+       L+ + 
Sbjct: 103 ---GGFRRTS---ILADALEAILAAIYLDGGMIAAKQIILMLYSSRLDDPDLNHCLK-DA 155

Query: 407 VKELTELCQKRKYRMKEPVVVHKDGEACTTI---EVMANGGVRSCSSSARNRKTAKRLAC 237
             +L E  Q  K+ + E V+   +G+    I        G  +    +  NR+ A++LA 
Sbjct: 156 KTQLQEFLQASKFALPEYVLTKIEGDEHAQIFHVTCTIEGVSQVAYGTGPNRRKAEQLAA 215

Query: 236 ERM 228
           + M
Sbjct: 216 KAM 218



>gb:AE008692_241113 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 223

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 65/231 (28%), Positives = 103/231 (44%), Gaps = 4/231 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L +  +DP+L + A+TH S   HG   YQRLEFLGD VL   +    YD +P    G L+
Sbjct: 14  LGHRPKDPALFLRAMTHPS---HGNSDYQRLEFLGDRVLGLVIANWLYDLFPREPEGKLS 70

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
              +  V+ A  A  +   GL  ++     A            + ++AS           
Sbjct: 71  RRLNSLVSGASCASIARIVGLPQWLRLGKQA----------RDDGAAASDN--------- 111

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT-PESLRLNPVKELTELCQKRK 372
             VL D++E++ GAI+L+SG+  +   + I     P+VT  ES   +P   L E      
Sbjct: 112 --VLGDVMEAMIGAIFLESGI--EAAGKLIHKYWAPLVTGQESAPKHPKSALQEWAAAHN 167

Query: 371 YRMKEPVVVHKDG---EACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
            R     +V + G     C TI+V +  GV   S+   +++ A+  A + +
Sbjct: 168 RRPPVYEIVSRTGPQHNPCFTIQV-SIAGVGEASAEGSSKQEAQTAAAQAL 217



>gb:CP000001_854210 Bacillus cereus ZK, complete genome.
          Length = 245

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 51/162 (31%), Positives = 76/162 (46%), Gaps = 12/162 (7%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYI------PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           +  TF D  LL++A TH SY+      PH  +  +RLEFLGDAVL+  V+++ + +YP +
Sbjct: 26  IGITFTDEKLLIQAFTHSSYVNEHRKKPH--EDNERLEFLGDAVLELTVSQYLFQKYPTM 83

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G LT+LR+  V        + +      +L              K  E +        
Sbjct: 84  SEGELTKLRAAIVCEPSLVRFANELSFGGLVL------------LGKGEEMTGGRER--- 128

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRT------DIVFEKI 459
                 P +LAD+ E+  GA+YLD GL T      +IV+ KI
Sbjct: 129 ------PALLADVFEAFIGALYLDQGLETVWGFLKEIVYPKI 164



>sp|Q9Z5U2|RNC_ZYMMO Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AF124349_481009 Zymomonas mobilis ZM4 fosmid
           clone 41A4, complete sequence.
          Length = 222

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 64/226 (28%), Positives = 101/226 (44%), Gaps = 4/226 (1%)
 Frame = -3

Query: 893 RDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSE 714
           +DP+L + A+TH S   HG   YQRLEFLGD VL   +    YD +P    G L+   + 
Sbjct: 18  KDPALFLRAMTHPS---HGNSDYQRLEFLGDRVLGLVIANWLYDLFPREPEGKLSRRLNS 74

Query: 713 SVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLA 534
            V+ A  A  +   GL  ++     A            + ++AS             VL 
Sbjct: 75  LVSGASCASIARIVGLPQWLRLGKQA----------RDDGAAASDN-----------VLG 113

Query: 533 DIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT-PESLRLNPVKELTELCQKRKYRMKE 357
           D++E++ GAI+L+SG+  +   + I     P+VT  ES   +P   L E       R   
Sbjct: 114 DVMEAMIGAIFLESGI--EAAGKLIHKYWAPLVTGQESAPKHPKSALQEWAAAHNRRPPV 171

Query: 356 PVVVHKDG---EACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
             +V + G     C TI+V +  GV   S+   +++ A+  A + +
Sbjct: 172 YEIVSRTGPQHNPCFTIQV-SIAGVGEASAEGSSKQEAQTAAAQAL 216



>sp|Q9PM40|RNC_CAMJE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|A81260|A81260 ribonuclease III (EC 3.1.26.3)
           Cj1635c [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X6_847993 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment 6/6.
          Length = 224

 Score = 69.7 bits (169), Expect = 1e-10
 Identities = 53/154 (34%), Positives = 80/154 (51%), Gaps = 2/154 (1%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY--QRLEFLGDAVLDYAVTRH 771
           M N+++LE    L Y F+D +LL+ ALTH S+     +SY  +RLEFLGDAVLD  V  +
Sbjct: 1   MKNIEKLEQS--LTYEFKDKNLLIHALTHKSF----KKSYNNERLEFLGDAVLDLVVGEY 54

Query: 770 FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS 591
            + ++     G L++LR+  VN   +A  +    L ++IL                   S
Sbjct: 55  LFHKFAKDAEGDLSKLRAALVNEKSFAKIANSLNLGDFIL------------------MS 96

Query: 590 SASSTFGWVLKTSFPWVLADIIESIAGAIYLDSG 489
            A    G   K   P +L+D +E+I GAI+L++G
Sbjct: 97  VAEENNGGKEK---PSILSDALEAIIGAIHLEAG 127



>sp|Q9KPB2|RNC_VIBCH Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|B82073|B82073 ribonuclease III VC2461
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004316_52833 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 224 of 251 of the
           complete chromosome.>gb:AE003852_1053607 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 225

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 62/198 (31%), Positives = 93/198 (46%), Gaps = 2/198 (1%)
 Frame = -3

Query: 914 SLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGC 735
           S L YTF++  LL  ALTH S   +G  + +RLEFLGD++L + +    Y ++P +  G 
Sbjct: 10  SKLGYTFKETELLNLALTHRS--ANGKHN-ERLEFLGDSILSFVIADELYRRFPKVNEGD 66

Query: 734 LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT 555
           ++ +R+  V     A    +  L +Y+      L+S                  G   + 
Sbjct: 67  MSRMRATLVRGNTLAELGREFDLGDYLKLGPGELKS------------------GGFRRD 108

Query: 554 SFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQ 381
           S   +LAD +E+I GAIYLDS L T   IV E     LE  + P + + +P   L E  Q
Sbjct: 109 S---ILADAVEAIIGAIYLDSDLETARSIVLEWYHGRLEE-IKPGASQKDPKTRLQEFLQ 164

Query: 380 KRKYRMKEPVVVHKDGEA 327
            R+  +    V +  GEA
Sbjct: 165 GRRKPLPVYTVTNIKGEA 182



>gb:AE017155_392988 Haemophilus ducreyi strain 35000HP section 5 of
           6 of the complete genome.>gb:AE017143_1027250
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 222

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 55/205 (26%), Positives = 103/205 (50%), Gaps = 2/205 (0%)
 Frame = -3

Query: 935 VKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQY 756
           ++RL+    + Y F +   L++ALTH S      ++ +RLEFLGD++L+YA+ +  ++++
Sbjct: 3   IERLQKK--IGYQFANLDYLLQALTHRSA---AAKNNERLEFLGDSILNYAIGQALFERF 57

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
           P    G L+ +R+  V     A+ + +  L  Y+   +  L+S                 
Sbjct: 58  PQANEGELSRMRATLVREQTLAILARQFDLGEYMKLGAGELKS----------------- 100

Query: 575 FGWVLKTSFPWVLADIIESIAGAIYLDSGL--RTDIVFEKIRPVLEPMVTPESLRLNPVK 402
            G   + S   +L+D +E+I  AIYLD+G+   ++ ++   + +L+ M  P   + +P  
Sbjct: 101 -GGYRRES---ILSDCVEAIIAAIYLDAGMDKASERIYAWYQTLLDEM-KPGDAQKDPKT 155

Query: 401 ELTELCQKRKYRMKEPVVVHKDGEA 327
            L E  Q R+ ++ E  V+   GEA
Sbjct: 156 RLQEFLQGRRLKLPEYEVLDIKGEA 180



>sp|Q99UN7|RNC_STAAN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|D89896|D89896 RNase III [imported] -
           Staphylococcus aureus (strain N315)>gb:CP000046_91387
           Staphylococcus aureus subsp. aureus COL, complete
           genome.>gb:BA000018_679510 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BA000033_711408 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_780655 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_783388 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 243

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 51/167 (30%), Positives = 83/167 (49%), Gaps = 4/167 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSY----QRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           L +T+++  L  +A +H S+I     +     +RLEFLGDAVL+  V+R+ +D++P L  
Sbjct: 24  LGFTYQNIDLYQQAFSHSSFINDFNMNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPE 83

Query: 740 GCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL 561
           G LT++R+  V      + + K GL+  IL              K  E++   +      
Sbjct: 84  GNLTKMRATIVCEPSLVIFANKIGLNEMIL------------LGKGEEKTGGRTR----- 126

Query: 560 KTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL 420
               P +++D  E+  GA+YLD GL  DIV++    V+ P V    L
Sbjct: 127 ----PSLISDAFEAFIGALYLDQGL--DIVWKFAEKVIFPHVEQNEL 167



>sp|Q931T1|RNC_STAAM Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:BA000017_676924 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.
          Length = 243

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 51/167 (30%), Positives = 83/167 (49%), Gaps = 4/167 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSY----QRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           L +T+++  L  +A +H S+I     +     +RLEFLGDAVL+  V+R+ +D++P L  
Sbjct: 24  LGFTYQNIDLYQQAFSHSSFINDFNMNRLDHNERLEFLGDAVLELTVSRYLFDKHPNLPE 83

Query: 740 GCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL 561
           G LT++R+  V      + + K GL+  IL              K  E++   +      
Sbjct: 84  GNLTKMRATIVCEPSLVIFANKIGLNEMIL------------LGKGEEKTGGRTR----- 126

Query: 560 KTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL 420
               P +++D  E+  GA+YLD GL  DIV++    V+ P V    L
Sbjct: 127 ----PSLISDAFEAFIGALYLDQGL--DIVWKFAEKVIFPHVEQNEL 167



>gb:BX908798_829830 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 242

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 60/200 (30%), Positives = 89/200 (44%), Gaps = 5/200 (2%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHG---TQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           ++ L YTF+DP LLV A  H S+I       Q  +RLEFLGD+VL   ++ + Y + P  
Sbjct: 22  EAKLGYTFKDPQLLVLAFVHRSFINENREVNQHNERLEFLGDSVLGMLISDYLYCKLPKT 81

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G L+ LRS  V  +          L  Y+L              + +       +   
Sbjct: 82  PEGQLSYLRSRLVEASSCVHYIQSLDLSGYLLLGKG----------ERMNDGRGRES--- 128

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELT 393
                   +LAD+ E+I GAIYLD GL+   D +F+     +E ++    LR N    L 
Sbjct: 129 --------ILADLFEAIIGAIYLDGGLQAAKDFLFKNFHQHIE-IILATPLR-NWKALLQ 178

Query: 392 ELCQKRKYRMKEPVVVHKDG 333
           + CQK   +     V+H+ G
Sbjct: 179 DYCQKNYQQTPLYQVLHESG 198



>gb:AE016827_341997 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 224

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 67/232 (28%), Positives = 103/232 (44%), Gaps = 5/232 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           ++Y F+D +LL +ALTH S     T+  +RLEFLGDA+L+Y +    Y Q+P    G L+
Sbjct: 11  ISYEFKDITLLKQALTHRSA---ATKHNERLEFLGDAILNYTIADALYHQFPKCNEGELS 67

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A+ + +  L  Y+      L+S                  G   + S 
Sbjct: 68  RMRATLVREPTLAILARQFKLGEYMALGHGELKS------------------GGFRRES- 108

Query: 548 PWVLADIIESIAGAIYLDSGL--RTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E+I GAI LDS L   T I       +L   + P   + +P   L E  Q  
Sbjct: 109 --ILADCVEAIIGAISLDSSLVSATQITLHWYEKLLRE-IKPGENQKDPKTRLQEYLQGH 165

Query: 374 KYRMKEPVVVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
           +  +    V    GEA     TIE       R+      +R+ A++ A E++
Sbjct: 166 RLALPTYDVKDIKGEAHCQTFTIECHVPNLDRTFIGVGSSRRKAEQAAAEQI 217



>gb:CP000033_89542 Lactobacillus acidophilus NCFM, complete genome.
          Length = 228

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 47/144 (32%), Positives = 67/144 (46%), Gaps = 4/144 (2%)
 Frame = -3

Query: 905 NYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           N  F +  LL EA TH SY       G + Y++LEFLGDAVL+ AV+ + Y  YP L  G
Sbjct: 15  NIEFNNEKLLEEAFTHSSYSNEHPDDGIRDYEKLEFLGDAVLELAVSNYLYRHYPKLNEG 74

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            LT LRS  V    ++  +++ G                  F K I   +     G    
Sbjct: 75  ELTRLRSNIVRTEGFSEFAIECG------------------FQKEIHLGNGEEKAG---A 113

Query: 557 TSFPWVLADIIESIAGAIYLDSGL 486
            +   +L D+ E+  GA++LD G+
Sbjct: 114 RNRKTLLEDVFEAFNGALFLDQGM 137



>sp|Q87C06|RNC_XYLFT Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE012558_284687 Xylella fastidiosa Temecula1,
           section 6 of 9 of the complete
           genome.>gb:AE009442_961263 Xylella fastidiosa Temecula1,
           complete genome.
          Length = 227

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 62/213 (29%), Positives = 97/213 (45%), Gaps = 5/213 (2%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY 765
           M++ K  +    + Y F DPSLL++AL H S    GT   +RLEFLGD+V++  +    +
Sbjct: 1   MISSKASDYQQRIGYVFTDPSLLLQALRHRSA---GTPHNERLEFLGDSVVNLLIAEALF 57

Query: 764 DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA 585
            ++P    G LT  RSE V     A  +    L   ++     L+S              
Sbjct: 58  QRWPRADEGALTRARSELVRETSLASIARTMQLGEQLILGPGELKS-------------- 103

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL---RTDIV--FEKIRPVLEPMVTPESL 420
               G   + S   +LAD +E++  AIYLD+ L   RT ++  FE     L P+  PE  
Sbjct: 104 ----GGHRRDS---ILADAVEAVIAAIYLDADLATCRTVVLPWFETALTAL-PVGKPEK- 154

Query: 419 RLNPVKELTELCQKRKYRMKEPVVVHKDGEACT 321
             +P   L E  Q R++ +    ++ + G+  T
Sbjct: 155 --DPKTRLQEWLQARQWSLPVYELIFESGDPHT 185



>sp|Q8Y691|RNC_LISMO Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|AE1300|AE1300 ribonuclease III homolog rncS
           [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591981_536296 Listeria monocytogenes strain
           EGD, complete genome, segment 9/12.
          Length = 229

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 59/239 (24%), Positives = 108/239 (45%), Gaps = 9/239 (3%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYDQY 756
           E    + + F++  LL +A TH SY+        +  +RLEFLGDAVL+  V+ + +++Y
Sbjct: 6   ELQESVGFDFKNVELLKQAFTHSSYVNEHRRENVKDNERLEFLGDAVLELTVSDYLFNKY 65

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
           P +  G +T++R+                    +   S    +    F K +        
Sbjct: 66  PDMAEGHMTKMRAA------------------IVCEPSLVEFAEAVHFSKYVRLGKGEEK 107

Query: 575 FGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL--RLNPVK 402
            G   +   P +LAD+ ES  GA+YLD+G+   + F  +  V+ P +   +    ++   
Sbjct: 108 AGGRTR---PALLADVFESFIGALYLDNGIDKVVTF--LERVIFPKIDAGAYLQTVDYKT 162

Query: 401 ELTELCQKRKYRMKEPVVVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
           +L E+ Q+ +  + E  ++ + G A       +V+ NG V     S R +K A++ A +
Sbjct: 163 QLQEIVQRDRDVLIEYDILGETGPAHNKAFDAQVIVNGQVLG-KGSGRTKKQAEQSAAQ 220



>sp|Q92AK3|RNC_LISIN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|AE1672|AE1672 ribonuclease III homolog rncS
           [imported] - Listeria innocua  (strain
           Clip11262)>gb:AL596170_539263 Listeria innocua Clip11262
           complete genome, segment 8/12.
          Length = 229

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 60/239 (25%), Positives = 109/239 (45%), Gaps = 9/239 (3%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYDQY 756
           E    + + F++  LL +A TH SY+        +  +RLEFLGDAVL+  V+ + +++Y
Sbjct: 6   ELQESVGFDFQNVELLQQAFTHSSYVNEHRRENVKDNERLEFLGDAVLELTVSDYLFNKY 65

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
           P +  G +T++R+                    +   S    +    F K +        
Sbjct: 66  PDMAEGHMTKMRAA------------------IVCEPSLVEFAEAVHFSKYVRLGKGEEK 107

Query: 575 FGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL--RLNPVK 402
            G   +   P +LAD+ ES  GA+YLD+G+  D V + +  V+ P +   +    ++   
Sbjct: 108 AGGRTR---PALLADVFESFIGALYLDNGI--DKVVKFLERVIFPKIDAGAYLQTVDYKT 162

Query: 401 ELTELCQKRKYRMKEPVVVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
           +L E+ Q+ +  + E  ++ + G A       +V+ NG V     S R +K A++ A +
Sbjct: 163 QLQEIVQRDRDVLIEYDILGETGPAHNKAFDAQVIVNGQVLG-KGSGRTKKQAEQSAAQ 220



>gb:CP000025_879530 Campylobacter jejuni RM1221, complete genome.
          Length = 224

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 50/154 (32%), Positives = 81/154 (52%), Gaps = 2/154 (1%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY--QRLEFLGDAVLDYAVTRH 771
           M N+++LE    L Y F+D +LL+ ALTH S+     +SY  +RLEFLGDAVLD  V  +
Sbjct: 1   MKNIEKLERS--LTYEFKDKNLLIHALTHKSF----KKSYNNERLEFLGDAVLDLVVGEY 54

Query: 770 FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS 591
            + ++     G L++LR+  VN   +A  +    L ++I             F+   E++
Sbjct: 55  LFHKFAKDAEGDLSKLRAALVNEKSFAKIANSLNLGDFI-------------FMSVAEEN 101

Query: 590 SASSTFGWVLKTSFPWVLADIIESIAGAIYLDSG 489
           +             P +L+D +E+I GAI+L++G
Sbjct: 102 NGG--------REKPSILSDALEAIIGAIHLEAG 127



>gb:CP000020_872263 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 223

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 69/240 (28%), Positives = 108/240 (45%), Gaps = 5/240 (2%)
 Frame = -3

Query: 938 NVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQ 759
           +++RLE    + Y F+D S L  ALTH S   +GT + +RLEFLGD++L + V    Y +
Sbjct: 4   SLQRLEKK--IGYQFKDESFLKLALTHRS--ANGTHN-ERLEFLGDSILSFVVADDLYHR 58

Query: 758 YPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS 579
           +P +  G ++ +R+  V     A    +  L +Y+      L+S                
Sbjct: 59  FPKVDEGDMSRMRATLVRGHTLAELGREFQLGDYLYLGPGELKS---------------- 102

Query: 578 TFGWVLKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPV 405
             G   + S   +LAD +E+I GAIYLDS   T   I+       LE  + P   + +P 
Sbjct: 103 --GGFRRDS---ILADAVEAIIGAIYLDSDTETVRGIILSWYNTRLE-SIEPGVSQKDPK 156

Query: 404 KELTELCQKRKYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACE 234
             L E  Q R+  +    V    GEA     TIE +  G  +       +R+ A++ A +
Sbjct: 157 TRLQEYLQGRRKPLPTYTVTKIKGEAHNQEFTIECIVAGLDKPVIGKGSSRRKAEQSAAD 216



>sp|Q9PB98|RNC_XYLFA Ribonuclease III (EC 3.1.26.3) (RNase III).
          Length = 227

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 62/213 (29%), Positives = 97/213 (45%), Gaps = 5/213 (2%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY 765
           M++ K  +    + Y F DPSLL++AL H S    GT   +RLEFLGD+V++  +    +
Sbjct: 1   MISSKASDYQQRIGYVFTDPSLLLQALRHCSA---GTPHNERLEFLGDSVVNLLIAEALF 57

Query: 764 DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA 585
            ++P    G LT  RSE V     A  +    L   ++     L+S              
Sbjct: 58  QRWPRADEGALTRARSELVRETSLASIARTMQLGEQLILGPGELKS-------------- 103

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL---RTDIV--FEKIRPVLEPMVTPESL 420
               G   + S   +LAD +E++  AIYLD+ L   RT ++  FE     L P+  PE  
Sbjct: 104 ----GGHRRDS---ILADAVEAVIAAIYLDADLATCRTVVLPWFETALTAL-PVGKPEK- 154

Query: 419 RLNPVKELTELCQKRKYRMKEPVVVHKDGEACT 321
             +P   L E  Q R++ +    ++ + G+  T
Sbjct: 155 --DPKTRLQEWLQARQWSLPVYELIFESGDPHT 185



>sp|Q9KA05|RNC_BACHD Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|A83961|A83961 ribonuclease III rncS [imported]
           - Bacillus halodurans  (strain C-125)>gb:BA000004_656435
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 263

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 53/163 (32%), Positives = 80/163 (49%), Gaps = 4/163 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYI-PHGTQSY---QRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           LN TF +  LLV+A TH SY+  H  QS    +RLEFLGDAVL+ AV+++ Y  +  +  
Sbjct: 42  LNLTFANKKLLVQAFTHSSYVNEHRIQSCKDNERLEFLGDAVLELAVSQYLYKAFEQMSE 101

Query: 740 GCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL 561
           G +T+LR+  V     +L+ +   LH             +    K  E +          
Sbjct: 102 GDMTKLRASIVCEP--SLAQLAEELH----------FGELVLLGKGEEMTGGRKR----- 144

Query: 560 KTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVT 432
               P +LAD+ ES  GA+YLD G+  D V+  +   + P ++
Sbjct: 145 ----PALLADVFESFVGALYLDQGM--DAVYLFLERTIYPKIS 181



>gb:BA000037_723657 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 259

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 65/230 (28%), Positives = 101/230 (43%), Gaps = 5/230 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F+D  LL  ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 46  LGYQFQDDELLNLALTHRSA---NSKHNERLEFLGDSILSFVIADELYHRFPKVNEGDMS 102

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A    + GL +Y+      L+S                  G   + S 
Sbjct: 103 RMRATLVRGNTLAELGREFGLGDYLKLGPGELKS------------------GGFRRDS- 143

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E+I GA+YLDS L     IV       LE  + P   + +P   L E  Q R
Sbjct: 144 --ILADAVEAIIGAVYLDSDLEVVRGIVLNWYASRLE-AIKPGVSQKDPKTRLQEFLQGR 200

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACE 234
           +  +    V +  GEA     T+E    G  +       +R+ A++ A E
Sbjct: 201 RKPLPVYTVTNIKGEAHNQEFTVECDIAGMDKPVVGRGTSRRKAEQAAAE 250



>gb:AE017321_441735 Wolbachia endosymbiont strain TRS of Brugia
           malayi, complete genome.
          Length = 243

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 69/264 (26%), Positives = 122/264 (46%), Gaps = 15/264 (5%)
 Frame = -3

Query: 974 VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGT----QSYQRLEFL 807
           +G+ P  A  M ++    S  ++NY F++ ++L EALTH S     +    ++Y+RLEFL
Sbjct: 1   MGDTPFKATSMEDLNDTIS-KIINYRFKNDAILEEALTHPSLNKRNSKNQIENYERLEFL 59

Query: 806 GDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS 627
           GD++L+  V+   +  +P    G L   +++ V     A  + +  L N+I+ +++   +
Sbjct: 60  GDSILNMIVSAILFRLFPKEKEGALARRKTDLVCGNTIANVAKEIKLGNFIIMNNSERCN 119

Query: 626 SIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVF------E 465
                +KN+E +                     +E++ GAIY+D G      F      E
Sbjct: 120 GGKRNLKNLENA---------------------LEALIGAIYIDGGFANVKKFVTKHWEE 158

Query: 464 KIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACT---TIEVMAN-- 300
           + + +L       SL  +P   L E  QK K  + E  ++ + G A +   TI +     
Sbjct: 159 RAKGML-------SLPQDPKTSLQEWTQKNKLPLPEYELMKQTGPAHSPEFTISICIENY 211

Query: 299 GGVRSCSSSARNRKTAKRLACERM 228
           G V +C+SS   +K A++ A E M
Sbjct: 212 GKVFACASS---KKVAEQKAAELM 232



>sp|Q8DC76|RNC_VIBVU Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE016802_336242 Vibrio vulnificus CMCP6
           chromosome I section 6 of 11 of the complete
           sequence.>gb:AE016795_1045966 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 225

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 65/230 (28%), Positives = 101/230 (43%), Gaps = 5/230 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F+D  LL  ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 12  LGYQFQDDELLNLALTHRSA---NSKHNERLEFLGDSILSFVIADELYHRFPKVNEGDMS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A    + GL +Y+      L+S                  G   + S 
Sbjct: 69  RMRATLVRGNTLAELGREFGLGDYLKLGPGELKS------------------GGFRRDS- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E+I GA+YLDS L     IV       LE  + P   + +P   L E  Q R
Sbjct: 110 --ILADAVEAIIGAVYLDSDLEVVRGIVLNWYTSRLE-AIKPGVSQKDPKTRLQEFLQGR 166

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACE 234
           +  +    V +  GEA     T+E    G  +       +R+ A++ A E
Sbjct: 167 RKPLPVYTVTNIKGEAHNQEFTVECDIAGMDKPVVGRGTSRRKAEQAAAE 216



>sp|Q8K9R1|RNC_BUCAP Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE014101_303168 Buchnera aphidicola str. Sg
           (Schizaphis graminum) section 26 of 57 of the complete
           genome.>gb:AE013218_935146 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 226

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 58/226 (25%), Positives = 105/226 (46%), Gaps = 2/226 (0%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +L YTF    LL +ALTH S     ++  +RLEFLGD++L + +    Y  +P +  G +
Sbjct: 12  ILGYTFTHQELLKQALTHRSA---SSKHNERLEFLGDSILSFVIANALYQHFPYIDEGDM 68

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           + +R+  V     A  + +  L  Y+      L+S                  G   + S
Sbjct: 69  SRMRATLVRGNTLAEIAYEFDLGEYLQLGQGELKS------------------GGFRRES 110

Query: 551 FPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQK 378
              +LA+ +E++ G+IYLDS ++T  +++ +     LE  ++P   + +P   L E  Q 
Sbjct: 111 ---ILANTVEALIGSIYLDSNIKTVEELILKWYEKRLE-KISPGDTQKDPKTRLQEYLQS 166

Query: 377 RKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA 240
           +   +    +V   GEA   +  + +  V + S+S   + T++R A
Sbjct: 167 KHLSLPSYFIVEVYGEAHNQLFTI-HCEVSTLSTSFIGKGTSRRKA 211



>gb:BX842651_824822 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 6/11.
          Length = 234

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 57/220 (25%), Positives = 100/220 (45%), Gaps = 3/220 (1%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSY---IPHGTQSYQRLEFLGDAVLDYAVTR 774
           M++  R   +  + + F++P+LL  ALTH S+   + +  +  ++LEFLGDAVLD  V  
Sbjct: 1   MIDQGRKSLEERVGHQFKNPALLERALTHKSFANELRNTVEHNEKLEFLGDAVLDLVVGE 60

Query: 773 HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
             Y+++P    G L++ R+  VN    +  +++ GL+                  K ++ 
Sbjct: 61  FLYEKFPTDTEGGLSKKRASIVNEEVLSELALEMGLN------------------KLMQL 102

Query: 593 SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
               +  G   K   P ++A   E+I GA+YLD G      FE  R  +     P + R+
Sbjct: 103 GKGEALTGGAQK---PRLIASSFEAIVGALYLDGG------FEVARSFIRQEFVPLADRV 153

Query: 413 NPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGG 294
              ++      +R Y+ +   +V K  +     EV+A  G
Sbjct: 154 CGHEDF-----ERDYKTRLQELVQKSSKETPRYEVLAEEG 188



>gb:BX572601_802310 Rhodopseudomonas palustris CGA009 complete
           genome; segment 9/16.
          Length = 272

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 70/234 (29%), Positives = 98/234 (41%), Gaps = 7/234 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG--TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGC 735
           L ++F DPSLL  A TH S +     T SYQRLEFLGD VL   V+   Y  +P    G 
Sbjct: 51  LGHSFADPSLLTTAFTHVSALKSARRTDSYQRLEFLGDHVLGLIVSDMLYRAFPDADEGE 110

Query: 734 LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT 555
           L++  ++ V     A                   RS   D V+ I+  +  +  G  L+ 
Sbjct: 111 LSKRLADLVRKETCA----------------DVARS--LDLVEGIKLGTVGAGAGAKLRK 152

Query: 554 SFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
           S   VL DI E++ GAIYLD G      F + R   E M  P     +P   L E  Q R
Sbjct: 153 S---VLGDICEAVIGAIYLDGGYEAASDFVR-RNWTERMRKPARSLRDPKTVLQEWAQAR 208

Query: 374 -----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
                 YR  E    H D +    + +    G+        +++ A+++A   M
Sbjct: 209 GLPTPVYREVERTGPHHDPQFRVAVIL---PGLEPAEGLGGSKRAAEKVAASAM 259



>gb:AE017260_418939 Wolbachia endosymbiont of Drosophila
           melanogaster, section 5 of 5 of the complete
           genome.>gb:AE017196_1059576 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 232

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 65/239 (27%), Positives = 112/239 (46%), Gaps = 11/239 (4%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQ----SYQRLEFLGDAVLDYAVTRHFYDQYPGLF 744
           +++Y F + ++L EALTH S     ++    SY+RLEFLGD+VL+  V+   +  +P   
Sbjct: 11  IIDYKFTNYAILEEALTHPSVNKRNSKNQIVSYERLEFLGDSVLNMVVSATLFKLFPEEK 70

Query: 743 PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWV 564
            G L + +++ V     A  + +  L ++I+ +++   +     +KN+E S         
Sbjct: 71  EGALAKRKTDLVCGNTIANVAKEIKLGSFIIMNNSERCNGGRCNLKNLENS--------- 121

Query: 563 LKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTE 390
                       +E++ GAIY+D GL      + +    + + M+ P     +P   L E
Sbjct: 122 ------------LEALIGAIYIDGGLENVEKFIIQYWEKLAKGMLDPPQ---DPKTSLQE 166

Query: 389 LCQKRKYRMKEPVVVHKDGEACT---TIEVMAN--GGVRSCSSSARNRKTAKRLACERM 228
             QK K  + E  +V + G A     TI V     G V +C+SS   +K A++ A E M
Sbjct: 167 WTQKNKLPLPEYELVKQTGPAHNPEFTISVCIEDYGKVSACASS---KKIAEQKAAELM 222



>sp|Q8ZD72|RNC_YERPE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|AF0331|AF0331 ribonuclease III (EC 3.1.26.3)
           [imported] - Yersinia pestis  (strain
           CO92)>gb:AE013732_299613 Yersinia pestis KIM section 132
           of 415 of the complete genome.>gb:AE017136_388297
           Yersinia pestis biovar Medievalis str. 91001 section 10
           of 16 of the complete genome.>gb:AJ414153_524507
           Yersinia pestis strain CO92 complete genome; segment
           13/20.>gb:BX936398_837533 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.>gb:AE009952_929796
           Yersinia pestis KIM complete genome.>gb:AE017042_1144863
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 226

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 60/231 (25%), Positives = 104/231 (45%), Gaps = 5/231 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF+   LL++ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 13  LGYTFQQQELLLQALTHRSA---SSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A  + +  L   +      L+S                  G   + S 
Sbjct: 70  RMRATLVRGNTLAEMAREFDLGECLRLGPGELKS------------------GGFRRES- 110

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E++ G ++LDS + T   ++ E     LE  ++P   + +P   L E  Q R
Sbjct: 111 --ILADTVEALIGGVFLDSDIHTIERLILEWYHSRLEE-ISPGDKQKDPKTRLQEYLQGR 167

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACER 231
              +   +VV   GEA     TI    +G       +  +R+ A++ A E+
Sbjct: 168 HLPLPSYLVVQVRGEAHDQEFTIHCQVSGLNEPVIGTGSSRRKAEQAAAEQ 218



>sp|Q8PB52|RNC_XANCP Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE012226_280527 Xanthomonas campestris pv.
           campestris str. ATCC 33913, section 134 of 460 of the
           complete genome.>gb:AE008922_913809 Xanthomonas
           campestris pv. campestris str. ATCC 33913, complete
           genome.
          Length = 226

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 56/200 (28%), Positives = 84/200 (42%), Gaps = 7/200 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           + + F DP LL +AL H S    GT   +RLEFLGD +++  +    Y ++P    G LT
Sbjct: 12  IGHAFADPGLLAQALRHRSA---GTPHNERLEFLGDGIVNLLIAEALYQRWPKADEGALT 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
             R+E V     A+      L   +      L+S                  G   + S 
Sbjct: 69  RARAELVREGALAVIGRTLNLGERLTLGPGELKS------------------GGHRRDS- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL-------NPVKELTE 390
             +LAD +E+I  AIYLD G      FE+ R V+ P   P    L       +P   L E
Sbjct: 110 --ILADAVEAIVAAIYLDCG------FERCRAVVLPWFEPSLAALPVGKAEKDPKTRLQE 161

Query: 389 LCQKRKYRMKEPVVVHKDGE 330
             Q R+  + +  ++ + G+
Sbjct: 162 WLQARQLPLPQYALISESGD 181



>sp|Q92JB0|RNC_RICCN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|E97719|E97719 ribonuclease III (EC 3.1.26.3)
           [imported] - Rickettsia conorii (strain Malish
           7)>gb:AE008582_238521 Rickettsia conorii str. Malish 7,
           section 14 of 114 of the complete
           genome.>gb:AE006914_1120639 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 227

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 46/150 (30%), Positives = 71/150 (47%), Gaps = 4/150 (2%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYDQYPG 750
           + LL+Y+F++  LL+EAL+H S   H      + Y+RLEFLGDAVL+  +T   +  +  
Sbjct: 8   EKLLSYSFKNKELLIEALSHPSLRQHHEYKDDKDYERLEFLGDAVLNLVITEILFRNFAN 67

Query: 749 LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFG 570
              G L ++RS  V      +   K  L NYI+ +     +   D + NIE ++      
Sbjct: 68  YNEGNLAKIRSYLVCKETICMVGAKLTLKNYIIMTHGEEVAGGRDNLNNIENAT------ 121

Query: 569 WVLKTSFPWVLADIIESIAGAIYLDSGLRT 480
                          E++  AIYLDS + T
Sbjct: 122 ---------------EALIAAIYLDSNIET 136



>sp|Q8RGX3|RNC_FUSNN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE010529_264059 Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586, section 71 of 197 of the complete
           genome.>gb:AE009951_911227 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 234

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 66/240 (27%), Positives = 106/240 (44%), Gaps = 7/240 (2%)
 Frame = -3

Query: 926 LESDSLLNYTFRDPSLLVEALTHGSY----IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQ 759
           L+ +  LNY F D +LL  AL H S       +  Q+ +RLE LGDAVLD  V  + Y  
Sbjct: 5   LDLEHKLNYYFNDRNLLKNALLHKSLGNERKEYKNQTNERLELLGDAVLDLIVAEYLYKS 64

Query: 758 YPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS 579
           Y     G + +L++  V+    A  S + G+  +++ S    R  +    +N E      
Sbjct: 65  YKNASEGPIAKLKAMIVSEPILAKISRQIGVGKFLMLS----RGEVMSGGRNRES----- 115

Query: 578 TFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVF--EKIRPVLEPMVTPESLRLNPV 405
                       +LAD  E+I GA+Y+DS L    VF    I+  ++ +   E + L+  
Sbjct: 116 ------------ILADSFEAILGAVYIDSNLDEARVFALSHIKQYIDHIEENEDI-LDFK 162

Query: 404 KELTELCQKR-KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
             L E  QK  K      +V  +  +     E+    G     + ARN+K A++L+ + +
Sbjct: 163 SILQEYVQKEFKTVPTYELVAERGPDHMKEFEIQVIVGNYKEKAVARNKKKAEQLSAKAL 222



>sp|Q8XJN8|RNC_CLOPE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:BA000016_674758 Clostridium perfringens str. 13
           DNA, complete genome.
          Length = 237

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 54/193 (27%), Positives = 88/193 (45%), Gaps = 4/193 (2%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRH 771
           M ++  +E + L+   F +  +L+ ALTH SY       +  +RLEFLGD+VL   VT++
Sbjct: 1   MKDINLIEVEKLIGIEFENKGVLITALTHSSYANQFKDVKYNERLEFLGDSVLQLCVTKY 60

Query: 770 FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS 591
            ++ Y     G LT++R         AL   +  LH    + S           K I  S
Sbjct: 61  LFNNYKDKSEGELTKIR---------ALVVCENSLHKVSKNLSLG---------KYIRMS 102

Query: 590 SASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLR--TDIVFEKIRPVLEPMVTPESLR 417
                 G   +TS   + AD +E++  A+YLD G+    D +    + V++  +  E + 
Sbjct: 103 KGEELTGGRERTS---IQADALEAVIAAVYLDKGIEVANDFILRNFKDVIDKAIN-EEII 158

Query: 416 LNPVKELTELCQK 378
           L+    L E+ QK
Sbjct: 159 LDFKTRLQEVLQK 171



>gb:AE016917_357027 Chromobacterium violaceum ATCC 12472 section 8
           of 16 of the complete genome.>gb:AE016825_1042181
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 236

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 53/195 (27%), Positives = 87/195 (44%), Gaps = 1/195 (0%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L+Y F+ P LL +ALTH SY    + + +R EF+GD++L+Y V R  YDQ+P L  G L+
Sbjct: 15  LDYAFQKPELLRQALTHRSY---SSANNERFEFVGDSILNYTVARMLYDQFPQLTEGELS 71

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  VN    A  + +  L +Y+      L+S                        + 
Sbjct: 72  RLRANLVNQNTLAEIAHELKLGDYLYLGEGELKSG---------------------GFNR 110

Query: 548 PWVLADIIESIAGAIYLDSGL-RTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRK 372
           P +LAD +E+   A+  D+     + V  ++       +       +    L E  Q RK
Sbjct: 111 PSILADALEATFAAVSFDADFAAAEQVVRRLYNQRVATIDTTRQAKDAKTRLQEALQARK 170

Query: 371 YRMKEPVVVHKDGEA 327
             + +  ++ + GEA
Sbjct: 171 LALPKYRILSQSGEA 185



>gb:BX294141_767744 Pirellula sp. strain 1 complete genome; segment
           9/24.
          Length = 297

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 47/167 (28%), Positives = 80/167 (47%), Gaps = 1/167 (0%)
 Frame = -3

Query: 953 AEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTR 774
           A+ +  ++R +   +L Y FRD  LL  ALTH S   H   S +RLEFLGD+VL   V  
Sbjct: 59  ADAVAKIERCQE--ILGYDFRDLDLLRSALTHASGASHRLASNERLEFLGDSVLGLTVCE 116

Query: 773 HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
             +++YP    G LT+++S  V+       + K GL   ++      R+           
Sbjct: 117 WLFNEYPEYSEGDLTKIKSAVVSRRSCGKVACKLGLDQCLIVGRGVTRN----------- 165

Query: 593 SSASSTFGWVLKTSFP-WVLADIIESIAGAIYLDSGLRTDIVFEKIR 456
                        S+P  +++D+ E++  A+Y+D G   +IV ++++
Sbjct: 166 ------------RSYPKSLVSDVFEAVIAALYIDGG--PEIVRDRLK 198



>gb:AE017204_404678 Lactobacillus johnsonii NCC 533, section 5 of 7
           of the complete genome.>gb:AE017198_1123165
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 226

 Score = 66.6 bits (161), Expect = 9e-10
 Identities = 59/226 (26%), Positives = 103/226 (45%), Gaps = 5/226 (2%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTEL 723
           F +  LL +A TH SY     G + Y++LEFLGDAVL+ AV+ + Y  +P L  G LT +
Sbjct: 18  FNNEKLLEDAFTHSSYANEHPGRKDYEKLEFLGDAVLELAVSDYLYRHFPRLNEGELTRM 77

Query: 722 RSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPW 543
           RS  V    ++  +++ G    I            +  K  E++ A        KT    
Sbjct: 78  RSNIVRTEGFSEFAIECGFPEEI------------NLGKGEEKAGARKR-----KT---- 116

Query: 542 VLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP--VKELTELCQ-KRK 372
           +L D+ E+  GA++LD G+    V   +   + P++       +     EL E  Q    
Sbjct: 117 LLEDVFEAFNGALFLDQGM--PAVQHFLHLTVYPLIAEGDFNASRDYKTELQERLQVNGP 174

Query: 371 YRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
            +++  V+   + +    ++++ N G +      RN+K A++ A +
Sbjct: 175 VKIEYQVISEDESKPSFKVQLLVN-GEKVSEGQGRNKKAAEQQAAQ 219



>gb:BA000043_737769 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 246

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 54/205 (26%), Positives = 94/205 (45%), Gaps = 6/205 (2%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIPHGT----QSYQRLEFLGDAVLDYAVTRHFYDQY 756
           E  + +  TFR+  LL++A TH SY+        +  +RLEFLGDAVL+  V+++ + ++
Sbjct: 20  ELQNKIGITFRNEKLLIQAFTHSSYVNEHRRRLHEDNERLEFLGDAVLELTVSQYLFQKF 79

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
           P +  G LT+LR+  V                 ++  + AL       +   E+ +   T
Sbjct: 80  PHMSEGQLTKLRAAIV-------------CEPSLVKFANALSFGELVLLGKGEELTGGRT 126

Query: 575 FGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR--LNPVK 402
                    P +LAD+ E+  GA+YLD G+  D V   +   + P +   +    ++   
Sbjct: 127 --------RPALLADVFEAFIGALYLDQGM--DAVIRFLEKTMFPKIDEGAFSHVMDFKS 176

Query: 401 ELTELCQKRKYRMKEPVVVHKDGEA 327
           +L EL Q+      E  ++ + G A
Sbjct: 177 QLQELVQRDGSGTLEYAILEEKGPA 201



>gb:BX950851_842013 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 226

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 58/234 (24%), Positives = 104/234 (44%), Gaps = 8/234 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF+   LL++ALTH S     ++  +RLEFLGD++L + +    YD++P +  G ++
Sbjct: 13  LGYTFQQYELLLQALTHRSA---SSKHNERLEFLGDSILSFVIANALYDRFPKVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS- 552
            +R+  V                          +++A+  +  E           LK+  
Sbjct: 70  RMRATLVRG------------------------NTLAEIAREFELGECLRLGPGELKSGG 105

Query: 551 --FPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                +LAD +E++ G I+LDS +     ++    +  L+  ++P   + +P   L E  
Sbjct: 106 FRRESILADTVEALIGGIFLDSDILNIERLILNWYQTRLDE-ISPGDKQKDPKTRLQEFL 164

Query: 383 QKRKYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACER 231
           Q R   +   +VV   GEA     TI    +G   S   +  +R+ A++ A E+
Sbjct: 165 QGRHLPLPTYLVVQVRGEAHDQEFTIHCQVSGFSESVIGTGSSRRKAEQAAAEQ 218



>gb:CP000030_83865 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 232

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 67/233 (28%), Positives = 94/233 (40%), Gaps = 8/233 (3%)
 Frame = -3

Query: 902 YTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTEL 723
           Y FRD  LL+EALTH         +Y+RLEFLGDAVL   V+   Y  +P    GCLT  
Sbjct: 19  YQFRDLDLLLEALTHPRLSYKSAANYERLEFLGDAVLSMTVSEMLYRLFPDDDEGCLTRK 78

Query: 722 RSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPW 543
           R+  V  +     +   GL   IL                   S    T G    +  P 
Sbjct: 79  RTALVRGSEVVEIARSIGLGELIL------------------MSGGERTCG---GSDNPG 117

Query: 542 VLADIIESIAGAIYLDSG---LRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRK 372
            L + +E++ GA+Y+D G    R+ I    +        TP     +P   L E  Q R 
Sbjct: 118 TLENALEALIGAMYMDGGPEAYRSFIHKHWLARAQHMSYTPPQ---DPKTALQEWVQGRG 174

Query: 371 YRMKEPVVVHKDGEA-----CTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
           + M    +V K G          + +  +G V    SS   +K A++ A + M
Sbjct: 175 WAMPLYKLVSKSGPEHKPVFAVEVSIQEHGNVLGTGSS---KKLAEQEAAKLM 224



>gb:AE004969_60039 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 239

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 65/234 (27%), Positives = 105/234 (44%), Gaps = 9/234 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y FRD SLL  ALTH S   H  +  +R EF+GD++L+Y V R  +D +P L  G L+
Sbjct: 18  LGYAFRDMSLLRRALTHRS---HHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELS 74

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  VN    A  + +  + + +   +  L+SS   F +                   
Sbjct: 75  RLRASLVNEGVLAEMAAEMNVGDGLYLGAGELKSS--GFRR------------------- 113

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKE----LTELCQ 381
           P +LAD +E++  A+  D+   T    + +R +    V     + N  K+    L E  Q
Sbjct: 114 PSILADAMEAMFAAVSFDADFNT--AEKVVRHLFAERVRRADFQ-NQAKDGKTALQEALQ 170

Query: 380 KR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
            R     KYR++E +    D     + ++   G V  C +   +RK A++ A +
Sbjct: 171 ARRFALPKYRIEEQIGHADDSMFVISCDLGELGFV--CRAKGTSRKAAEQEAAK 222



>sp|Q9K0C8|RNC_NEIMB Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|E81169|E81169 ribonuclease III NMB0686
           [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002423_46138 Neisseria meningitidis
           serogroup B strain MC58 section 65 of 206 of the
           complete genome.>gb:AE002098_896251 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 239

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 64/234 (27%), Positives = 105/234 (44%), Gaps = 9/234 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y FRD SLL +ALTH S   H  +  +R EF+GD++L+Y V R  +D +P L  G L+
Sbjct: 18  LGYAFRDISLLRQALTHRS---HHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELS 74

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  VN    A  + +  + + +   +  L+S    F +                   
Sbjct: 75  RLRASLVNEGVLAEMAAEMNVGDGLYLGAGELKS--GGFRR------------------- 113

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKE----LTELCQ 381
           P +LAD +E++  A+  D+   T    + +R +    V     + N  K+    L E  Q
Sbjct: 114 PSILADAMEAMFAAVSFDADFNT--AEKVVRHLFADRVRRADFQ-NQAKDGKTALQEALQ 170

Query: 380 KR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
            R     KYR++E +    D     + ++   G V  C +   +RK A++ A +
Sbjct: 171 ARRFALPKYRIEEQIGYANDSMFVISCDLGELGFV--CRAKGTSRKAAEQEAAK 222



>sp|P44441|RNC_HAEIN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|G64042|G64042 ribonuclease III (EC 3.1.26.3) -
           Haemophilus influenzae  (strain Rd
           KW20)>gb:U32687_203705 Haemophilus influenzae Rd KW20
           section 2 of 163 of the complete
           genome.>gb:L42023_1096254 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 227

 Score = 65.9 bits (159), Expect = 2e-09
 Identities = 69/246 (28%), Positives = 110/246 (44%), Gaps = 7/246 (2%)
 Frame = -3

Query: 944 MVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY 765
           M ++ RLE    + Y F D +LL +ALTH S     TQ  +RLEFLGD++L++ +    Y
Sbjct: 1   MNHLDRLERK--IGYRFNDIALLKQALTHRSA---ATQHNERLEFLGDSILNFTIAEALY 55

Query: 764 DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA 585
            Q+P    G L+ +R+  V     A+ + +  L +Y+   S  L++              
Sbjct: 56  HQFPRCNEGELSRMRATLVREPTLAILARQFELGDYMSLGSGELKN-------------- 101

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLR-TDIVFEKIRPVLEPMVTPESLRLNP 408
               G   + S   +LAD +E+I GA+ LD GL  T  V       L   + P   + + 
Sbjct: 102 ----GGFRRES---ILADCVEAIIGAMSLDQGLAVTTQVIRNWYQQLLAEIKPGDNQKDA 154

Query: 407 VKELTELCQKRKYRMKEPVVVHKDGEA-CTTIEV-----MANGGVRSCSSSARNRKTAKR 246
              L E  Q +   +    VV+  GEA C    V      A    R+  +   +R+ A++
Sbjct: 155 KTRLQEYLQGKHLPLPTYEVVNIQGEAHCQIFTVKCKVKSAEKIDRTFVAKGSSRRKAEQ 214

Query: 245 LACERM 228
            A E++
Sbjct: 215 AAAEQI 220



>gb:AF542975_520677 Yersinia enterocolitica rnc operon, partial
           sequence.
          Length = 226

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 60/231 (25%), Positives = 103/231 (44%), Gaps = 5/231 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF+   LL++ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 13  LGYTFQQQDLLLQALTHRSA---SSKHNERLEFLGDSILSFVIANELYRRFPRVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A  + +  L   +      L+S                  G   + S 
Sbjct: 70  RMRATLVRGNTLAEMAREFDLGECLRLGPGELKS------------------GGFRRES- 110

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E++ G I+LDS + T   ++       LE  ++P   + +P   L E  Q R
Sbjct: 111 --ILADTVEALIGGIFLDSDIHTIERLILAWYHSRLEE-ISPGDKQKDPKTRLQEYLQGR 167

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACER 231
              +   +VV   GEA     TI    +G       +  +R+ A++ A E+
Sbjct: 168 HLPLPSYLVVQVRGEAHDQEFTIHCQVSGLNEPVIGTGSSRRKAEQAAAEQ 218



>gb:AE016822_340078 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 237

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 64/224 (28%), Positives = 99/224 (44%), Gaps = 7/224 (3%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           DP LL  ALTH SY     G  + +RLEFLGD++L  AVT   + + PGL  G L + R+
Sbjct: 20  DPELLELALTHRSYAYENGGIPNNERLEFLGDSILGQAVTVKLFRENPGLDEGELAKRRA 79

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
             V++   A  +   GL  Y+L      +S         E++S               +L
Sbjct: 80  SLVSSVALAEVARGIGLGEYLLLGRGENQSG------GREKAS---------------IL 118

Query: 536 ADIIESIAGAIYLDSG--LRTDIVFEKIRPVLEPMVTPE--SLRLNPVKELTELCQKRKY 369
           AD +E++ GA+YLD+G    T +V   I P+L     P+     ++P   L E       
Sbjct: 119 ADTVEAVIGAVYLDAGGDEATALVLRLIGPLL---ADPDRFGAAMDPKTSLQEAAAHHGA 175

Query: 368 RMKEPVVVHKDGEACTTIEVMAN-GGVRSCSSSARNRKTAKRLA 240
                 V++   +   T     + GG+ + S    ++K A+  A
Sbjct: 176 GQPVYTVINTGPDHSKTFHATVDVGGLVTASGEGTSKKQAEMAA 219



>gb:CR543861_104439 Acinetobacter sp. ADP1 complete genome.
          Length = 230

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 61/199 (30%), Positives = 91/199 (45%), Gaps = 3/199 (1%)
 Frame = -3

Query: 914 SLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGC 735
           S + Y F+   LL  ALTH S + H   +Y+RLEFLGD++L   +  + Y  YP    G 
Sbjct: 15  SRIGYEFKQLELLQLALTHRS-VSH-KYNYERLEFLGDSLLGMIIANYLYQAYPHENEGR 72

Query: 734 LTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT 555
           LT +R+  V        +    L   ++ S+  L+S                  G   + 
Sbjct: 73  LTRMRATLVRQEALGKIANDLKLSRCLILSTGELKS------------------GGHHRE 114

Query: 554 SFPWVLADIIESIAGAIYLDS---GLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
           S   +LAD +E+I GAIY+DS    L  +IV +   P L+ +   + L+ +P   L E  
Sbjct: 115 S---ILADTVEAIIGAIYVDSNDLNLLKNIVLKWYIPYLDHIEPTDQLK-DPKSRLQEYL 170

Query: 383 QKRKYRMKEPVVVHKDGEA 327
           Q RK  +    VV   G+A
Sbjct: 171 QARKKPLPVYEVVDIQGDA 189



>pir|B97486|B97486 ribonuclease III (RNAse III) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008033_232783 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 91 of 254 of the
           complete sequence.>gb:AE007869_1082452 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 256

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 67/251 (26%), Positives = 110/251 (43%), Gaps = 6/251 (2%)
 Frame = -3

Query: 962 PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYA 783
           PL+A++   + RLE+  L+ Y F++ + L  ALTH S       +Y+RLEFLGD VL   
Sbjct: 23  PLSADE---ISRLEA--LIGYEFKEKARLDRALTHASARSAAAGNYERLEFLGDRVLGLC 77

Query: 782 VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
           V    +  +     G L+   ++ V+    A    + GLHN+I   S          VK 
Sbjct: 78  VAELLFSTFRNASEGELSVRLNQLVSAESCAAIGDEMGLHNFIRTGSD---------VKK 128

Query: 602 IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP-E 426
           +   +  +            V AD++ES+   +YLD GL     F  I    +   T  +
Sbjct: 129 LTGKAMLN------------VRADVVESLIATLYLDGGLEASRKF--ILKYWQGRATSVD 174

Query: 425 SLRLNPVKELTELCQKR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR 261
           + R +   EL E    R      YR+ +      D     T+E+    GV+  +   R++
Sbjct: 175 AGRRDAKTELQEWAHARFAATPAYRVDDRSGPDHDPSFTVTVEI---PGVKPETGVERSK 231

Query: 260 KTAKRLACERM 228
           + A+++A  R+
Sbjct: 232 RAAEQVAATRL 242



>sp|Q87LN9|RNC_VIBPA Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:BA000031_708032 Vibrio parahaemolyticus RIMD
           2210633 DNA, chromosome 1, complete sequence.
          Length = 225

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 63/230 (27%), Positives = 100/230 (43%), Gaps = 5/230 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F+D  L+  ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 12  LGYQFKDAGLINLALTHRSA---NSKHNERLEFLGDSILSFVIADDLYHRFPKVNEGDMS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A    +  L +Y+      L+S                  G   + S 
Sbjct: 69  RMRATLVRGHTLAELGREFDLGDYLKLGPGELKS------------------GGFRRDS- 109

Query: 548 PWVLADIIESIAGAIYLDSGLR--TDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E+I GAIYLDS +     IV       LE  + P   + +P   L E  Q R
Sbjct: 110 --ILADAVEAIIGAIYLDSDIEKVRSIVLSWYNSRLE-AIKPGVSQKDPKTRLQEFLQGR 166

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACE 234
           +  +    V +  GEA     T+E    G  +       +R+ A++ A E
Sbjct: 167 RKPLPVYTVTNIKGEAHNQEFTVECEVAGVDKPVIGKGTSRRKAEQAAAE 216



>sp|P57346|RNC_BUCAI Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|H84959|H84959 ribonuclease III (EC 3.1.26.3)
           [imported] - Buchnera sp.  (strain
           APS)>gb:BA000003_653622 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 226

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 52/197 (26%), Positives = 91/197 (46%), Gaps = 2/197 (1%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +L YTF    LL +ALTH S     ++  +RLEFLGD++L + +    Y  +P +  G +
Sbjct: 12  VLGYTFTHKDLLKQALTHRSA---SSKHNERLEFLGDSILSFVIANALYQHFPYIDEGDM 68

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           + +R+  V     A  + +  L  Y+      L+S                  G   + S
Sbjct: 69  SRMRATLVRGNTLAEIAYEFDLGEYLKLGQGELKS------------------GGFRRES 110

Query: 551 FPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQK 378
              +LA+ +E++ G+IYLDS ++T  +++ +     LE  ++P   + +P   L E  Q 
Sbjct: 111 ---ILANTVEALIGSIYLDSNIKTVEELILKWYEKRLE-KISPGDTQKDPKTRLQEYLQS 166

Query: 377 RKYRMKEPVVVHKDGEA 327
           +   +    +V   GEA
Sbjct: 167 KHLSLPLYFIVEVYGEA 183



>sp|Q8UGK2|RNC_AGRT5 Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|AB2704|AB2704 ribonuclease III [imported] -
           Agrobacterium tumefaciens  (strain C58,
           Dupont)>gb:AE009067_248075 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 93 of 256 of the
           complete sequence.>gb:AE008688_1085918 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 239

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 67/251 (26%), Positives = 110/251 (43%), Gaps = 6/251 (2%)
 Frame = -3

Query: 962 PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYA 783
           PL+A++   + RLE+  L+ Y F++ + L  ALTH S       +Y+RLEFLGD VL   
Sbjct: 6   PLSADE---ISRLEA--LIGYEFKEKARLDRALTHASARSAAAGNYERLEFLGDRVLGLC 60

Query: 782 VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
           V    +  +     G L+   ++ V+    A    + GLHN+I   S          VK 
Sbjct: 61  VAELLFSTFRNASEGELSVRLNQLVSAESCAAIGDEMGLHNFIRTGSD---------VKK 111

Query: 602 IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP-E 426
           +   +  +            V AD++ES+   +YLD GL     F  I    +   T  +
Sbjct: 112 LTGKAMLN------------VRADVVESLIATLYLDGGLEASRKF--ILKYWQGRATSVD 157

Query: 425 SLRLNPVKELTELCQKR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNR 261
           + R +   EL E    R      YR+ +      D     T+E+    GV+  +   R++
Sbjct: 158 AGRRDAKTELQEWAHARFAATPAYRVDDRSGPDHDPSFTVTVEI---PGVKPETGVERSK 214

Query: 260 KTAKRLACERM 228
           + A+++A  R+
Sbjct: 215 RAAEQVAATRL 225



>gb:AF065159_475239 Bradyrhizobium japonicum putative arylsulfatase
           (arsA), putative soluble lytic transglycosylase
           precursor (sltA), dihydrodipicolinate synthase (dapA),
           MscL (mscL), SmpB (smpB), BcpB (bcpB), RnpO (rnpO),
           RelA/SpoT homolog (relA), PdxJ (pdxJ), and acyl carrier
           protein synthase AcpS (acpS) genes, complete cds;
           prokaryotic type I signal peptidase SipF (sipF) gene,
           sipF-sipS allele, complete cds; RNase III (rnc),
           GTP-binding protein Era (era), hypothetical protein,
           recO-like protein, topoisomerase II (gyrA), putative ABC
           transporter, putative GMC-oxidoreductase, hypothetical
           protein, putative cytochrome C binding protein (cyc4),
           putative polytopic integral membrane protein, superoxide
           dismutase SodM-like protein, putative inner membrane
           protein, AttM-like protein (attM), adenylate
           cyclases-like protein, and putative inner membrane
           protein (spcT) genes, complete cds; and unknown genes.
          Length = 231

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 66/233 (28%), Positives = 100/233 (42%), Gaps = 8/233 (3%)
 Frame = -3

Query: 902 YTFRDPSLLVEALTHGSYIPHGTQ---SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +TF DP+LL++ +TH S +  G +   SYQRLEFLGD VL   V+   Y  +P    G L
Sbjct: 12  HTFADPNLLMQGITHVSALKSGRKRGDSYQRLEFLGDHVLGLVVSDMLYHAFPNADEGEL 71

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           ++  +E V     A  +   GL                  + +I+  S   +    L+ S
Sbjct: 72  SKRLAELVRKESCADVAKSLGL------------------LDDIKLGSVGPSADARLRKS 113

Query: 551 FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR- 375
              VL DI E++ GAI+LD G      F K R   E M  P     +P   L E  Q + 
Sbjct: 114 ---VLGDICEAVIGAIFLDGGHAAAAEFVK-RNWTERMHKPRRPLRDPKTVLQEWAQGKG 169

Query: 374 ----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
                YR  E    H D +    +++    G+        +++ A+++A   M
Sbjct: 170 LPTPVYREVERTGPHHDPQFRVAVDL---PGLAPAEGIGGSKRAAEKVAASVM 219



>gb:AE017333_447671 Bacillus licheniformis DSM 13, complete genome.
          Length = 249

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 46/153 (30%), Positives = 71/153 (46%), Gaps = 4/153 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYI-PHGTQSYQ---RLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           ++  F++  LL +A TH SY+  H  + Y+   RLEFLGDAVL+  +++  Y +YP +  
Sbjct: 27  ISVQFQNEKLLYQAFTHSSYVNEHRKKPYEDNERLEFLGDAVLELTISQFLYAKYPAMSE 86

Query: 740 GCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL 561
           G LT+LR+  V        + +      +L              K  E +          
Sbjct: 87  GDLTKLRAAIVCEPSLVSLAHELSFGELVL------------LGKGEEMTGGRKR----- 129

Query: 560 KTSFPWVLADIIESIAGAIYLDSGLRTDIVFEK 462
               P +LAD+ E+  GA+YLD GL   + F K
Sbjct: 130 ----PALLADVFEAFIGALYLDQGLEAVVTFLK 158



>sp|Q8R9W3|RNC_THETN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE013105_289116 Thermoanaerobacter
           tengcongensis MB4, section 132 of 244 of the complete
           genome.>gb:AE008691_1111181 Thermoanaerobacter
           tengcongensis strain MB4, complete genome.
          Length = 228

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 57/196 (29%), Positives = 90/196 (45%), Gaps = 10/196 (5%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQ---SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           +NY F+D +LL+EALTH S+   G     S +RLEFLGD+VL   ++ + Y     L  G
Sbjct: 9   INYEFKDKTLLLEALTHSSWAHEGKNEKVSNERLEFLGDSVLSLVISEYLYKNRKDLEEG 68

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L++ R+E V     A  + K  L ++       LR    + +       +         
Sbjct: 69  SLSKYRAEIVCEPSLARCARKIELGSF-------LRMGKGEEISGGRDRDS--------- 112

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRT------DIVFEKIRPVLEPMVTPE-SLRLNPVKE 399
                +LAD +E++  A+YLD GL        D+  E I  VL+ ++  +   RL  V +
Sbjct: 113 -----ILADAMEALLAAVYLDGGLEAVRRVILDLFKEIIDEVLKGIIYRDYKTRLQEVVQ 167

Query: 398 LTELCQKRKYRMKEPV 351
             E+  K  Y + E +
Sbjct: 168 SMEV-GKITYELVEEI 182



>sp|Q88MY5|RNC_PSEPK Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE016779_330869 Pseudomonas putida KT2440
           section 6 of 21 of the complete
           genome.>gb:AE015451_945946 Pseudomonas putida KT2440
           complete genome.
          Length = 229

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 64/227 (28%), Positives = 102/227 (44%), Gaps = 4/227 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF++   ++ ALTH SY     ++ +RLEFLGDA+L++      ++++P    G L+
Sbjct: 12  LGYTFKNQDQMLLALTHRSY---AGRNNERLEFLGDAILNFVAGEALFERFPQAREGQLS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  V     A  +    L +Y+   S  L+S                  G   + S 
Sbjct: 69  RLRARLVKGETLARLARGFDLGDYLRLGSGELKS------------------GGFRRES- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPM---VTPESLRLNPVKELTELCQK 378
             +LAD +E++ GAIYLD+ +  D   E+I   L      +T      +P   L E  Q 
Sbjct: 110 --ILADALEALIGAIYLDADM--DTARERILAWLADEFEGLTLVDTNKDPKTRLQEFLQS 165

Query: 377 RKYRMKEPVVVHKDGEA-CTTIEVMANGGVRSCSSSARNRKTAKRLA 240
           R   +    VV   GE  C T  V     V   ++ +R +  ++R+A
Sbjct: 166 RSCELPRYEVVDIQGEPHCRTFFVECE--VVLLNNKSRGQGVSRRIA 210



>gb:AX300293_1465434 Sequence 119 from Patent WO0185772.
          Length = 252

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 64/234 (27%), Positives = 105/234 (44%), Gaps = 9/234 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y FRD SLL +ALTH S   H  +  +R EF+GD++L+Y V R  +D +P L  G L+
Sbjct: 31  LGYAFRDISLLRQALTHRS---HHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELS 87

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  VN    A  + +  + + +   +  L+S    F +                   
Sbjct: 88  RLRASLVNEGVLAEMAAEMNVGDGLYLGAGELKS--GGFRR------------------- 126

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKE----LTELCQ 381
           P +LAD +E++  A+  D+   T    + +R +    V     + N  K+    L E  Q
Sbjct: 127 PSILADAMEAMFAAVSFDADFNT--AEKVVRHLFAERVRRVDFQ-NQAKDGKTALQEALQ 183

Query: 380 KR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
            R     KYR++E +    D     + ++   G V  C +   +RK A++ A +
Sbjct: 184 ARRFALPKYRIEEQIGHANDSMFVISCDLGELGFV--CRAKGTSRKAAEQEAAK 235



>gb:BA000040_733321 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 273

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 65/238 (27%), Positives = 103/238 (43%), Gaps = 8/238 (3%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQ---SYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           ++ + ++F DP+LL++ +TH S +  G +   SYQRLEFLGD VL   V+   Y  +P  
Sbjct: 49  EARIGHSFADPNLLMQGITHVSALKSGRKRGDSYQRLEFLGDHVLGLVVSDMLYHAFPNA 108

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G L++  +E V     A  +   GL                  + +I+  S   +   
Sbjct: 109 DEGELSKRLAELVRKESCADVAKSLGL------------------LDDIKLGSVGPSADA 150

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTEL 387
            L+ S   VL DI E++ GAI+LD G      F K R   E M  P     +P   L E 
Sbjct: 151 RLRKS---VLGDICEAVIGAIFLDGGHAAAAEFVK-RNWTERMHKPRRPLRDPKTVLQEW 206

Query: 386 CQKR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
            Q +      YR  E    H D +    +++    G+        +++ A+++A   M
Sbjct: 207 AQGKGLPTPVYREVERTGPHHDPQFRVAVDL---PGLAPAEGIGGSKRAAEKVAASVM 261



>gb:AE015579_315752 Shewanella oneidensis MR-1 section 128 of 457 of
           the complete genome.>gb:AE014299_951349 Shewanella
           oneidensis MR-1 complete genome.
          Length = 226

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 64/237 (27%), Positives = 106/237 (44%), Gaps = 10/237 (4%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F++  LL +ALTH S      +  +RLEFLGD++L   ++   Y Q+P    G L+
Sbjct: 14  LGYEFKNLDLLTQALTHRSA---ANKHNERLEFLGDSILSIVISDALYHQFPKATEGDLS 70

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V      L +    L +Y+      L+S                  G   + S 
Sbjct: 71  RMRATLVRGDTLTLIAQAFKLGDYLFLGPGELKS------------------GGFRRES- 111

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNP---VKELTELCQK 378
             +LAD +E+I GAIYLDS L      E  R +L          + P    K+   L Q+
Sbjct: 112 --ILADAVEAIIGAIYLDSDL------EVCRQLLLNWYAERLAEIQPGINQKDAKTLLQE 163

Query: 377 RKYRMKEPV----VVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
               +K+P+    V++ +G+A     T+E   +   +S    A +R+ A+++A  ++
Sbjct: 164 YLQGLKKPLPDYQVINIEGDAHDQTFTVECRIDDLSQSVIGVASSRRKAEQIAAAQV 220



>gb:D64116_120256 Bacillus subtilis genes for ORF1, ORF2, ORF3, ORF4
           and Srb, partial and complete cds.
          Length = 266

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 51/162 (31%), Positives = 73/162 (45%), Gaps = 7/162 (4%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQ---RLEFLGDAVLDYAVTRHFYDQY 756
           E    ++  F++  LL +A TH SY+  H  + Y+   RLEFLGDAVL+  ++R  + +Y
Sbjct: 22  EFQERISVHFQNEKLLYQAFTHSSYVNEHRKKPYEDNERLEFLGDAVLELTISRFLFPKY 81

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV---KNIEQSSA 585
           P +  G LT+LR+  V                     S A   S  D V   K  E +  
Sbjct: 82  PAMSEGDLTKLRAAIVCEPSLV---------------SLAHELSFGDLVLLGKGEEMTGG 126

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI 459
                       P +LAD+ E+  GA+YLD GL     F K+
Sbjct: 127 RKR---------PALLADVFEAFIGALYLDQGLEPVESFLKV 159



>pir|S60767|S60767 ribonuclease III - Coxiella
           burnetii>gb:COXRER_850630 Coxiella burnetii ribonuclease
           (rnc) gene; GTP-binding protein (era) gene; repair and
           recombination protein (recO) gene, complete cds.
          Length = 233

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 50/143 (34%), Positives = 71/143 (49%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L + F +  LL  ALTH S    G  + +RLEFLGD+VL + +    Y + P    G L+
Sbjct: 11  LGHQFNNLELLKIALTHCS---SGADNNERLEFLGDSVLGFIIASELYQRRPQAREGDLS 67

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  VN    A  S K G++ Y       L+  +       EQ S     G   + S 
Sbjct: 68  RMRASMVNGDELAQMSTKLGINEY-------LQLGVG------EQKS-----GGKRRRS- 108

Query: 548 PWVLADIIESIAGAIYLDSGLRT 480
             +LAD +E+I GAIY+D+GL T
Sbjct: 109 --ILADALETIVGAIYIDAGLET 129



>sp|Q9ZE31|RNC_RICPR Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|C71721|C71721 ribonuclease III (rnc) RP117 -
           Rickettsia prowazekii>gb:RPXX01_166920 Rickettsia
           prowazekii strain Madrid E, complete genome; segment
           1/4.
          Length = 225

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 55/206 (26%), Positives = 92/206 (44%), Gaps = 5/206 (2%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGT----QSYQRLEFLGDAVLDYAVTRHFYDQYPG 750
           ++LL Y+F++  LL+EAL+H S   +      + Y+RLEFLGDAVL+  +T   +  +  
Sbjct: 8   ETLLGYSFKNKELLIEALSHPSLRQYHEYKYDKDYERLEFLGDAVLNLLITEILFKNFEN 67

Query: 749 LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFG 570
              G L ++RS  V      +   K  L +YI+ +     +   D   NIE ++      
Sbjct: 68  YKEGNLAKIRSYLVCKETICIVGTKLALKDYIIMTHGEEVAGGRDNPNNIENAT------ 121

Query: 569 WVLKTSFPWVLADIIESIAGAIYLDSGLR-TDIVFEKIRPVLEPMVTPESLRLNPVKELT 393
                          E++  AIYLDS +  T  + EK+    E M        +P   L 
Sbjct: 122 ---------------EALIAAIYLDSNIEITHNIIEKL--WAEFMKVQNLTDYDPKTALQ 164

Query: 392 ELCQKRKYRMKEPVVVHKDGEACTTI 315
           E  Q   + +    ++ ++G A ++I
Sbjct: 165 EWAQANSHHLPIYRLIKREGAAHSSI 190



>sp|Q9JVD3|RNC_NEIMA Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|C81935|C81935 probable ribonuclease III (EC
           3.1.26.3) NMA0888 [imported] - Neisseria meningitidis
           (strain Z2491 serogroup A)>gb:NMA3Z2491_153824 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 3/7.
          Length = 239

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 64/234 (27%), Positives = 105/234 (44%), Gaps = 9/234 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y FRD SLL +ALTH S   H  +  +R EF+GD++L+Y V R  +D +P L  G L+
Sbjct: 18  LGYAFRDISLLRQALTHRS---HHAKHNERFEFVGDSILNYTVARMLFDAFPKLTEGELS 74

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  VN    A  + +  + + +   +  L+S    F +                   
Sbjct: 75  RLRASLVNEGVLAEMAAEMNVGDGLYLGAGELKS--GGFRR------------------- 113

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKE----LTELCQ 381
           P +LAD +E++  A+  D+   T    + +R +    V     + N  K+    L E  Q
Sbjct: 114 PSILADAMEAMFAAVSFDADFNT--AEKVVRHLFAERVRRVDFQ-NQAKDGKTALQEALQ 170

Query: 380 KR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
            R     KYR++E +    D     + ++   G V  C +   +RK A++ A +
Sbjct: 171 ARRFALPKYRIEEQIGHANDSMFVISCDLGELGFV--CRAKGTSRKAAEQEAAK 222



>sp|P51837|RNC_COXBU Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE016964_368690 Coxiella burnetii strain RSA
           493, section 5 of 7 of the complete
           genome.>gb:AE016828_1009426 Coxiella burnetii strain RSA
           493, complete genome.
          Length = 233

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 50/143 (34%), Positives = 71/143 (49%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L + F +  LL  ALTH S    G  + +RLEFLGD+VL + +    Y + P    G L+
Sbjct: 11  LGHQFNNLELLKIALTHCS---SGADNNERLEFLGDSVLGFIIASELYQRRPQAREGDLS 67

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  VN    A  S K G++ Y       L+  +       EQ S     G   + S 
Sbjct: 68  RMRASMVNGDELAQMSTKLGINEY-------LQLGVG------EQKS-----GGKRRRS- 108

Query: 548 PWVLADIIESIAGAIYLDSGLRT 480
             +LAD +E+I GAIY+D+GL T
Sbjct: 109 --ILADALEAIVGAIYIDAGLET 129



>sp|O69161|RNC_BRAJA Ribonuclease III (EC 3.1.26.3) (RNase III).
          Length = 250

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 65/238 (27%), Positives = 103/238 (43%), Gaps = 8/238 (3%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQ---SYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           ++ + ++F DP+LL++ +TH S +  G +   SYQRLEFLGD VL   V+   Y  +P  
Sbjct: 26  EARIGHSFADPNLLMQGITHVSALKSGRKRGDSYQRLEFLGDHVLGLVVSDMLYHAFPNA 85

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G L++  +E V     A  +   GL                  + +I+  S   +   
Sbjct: 86  DEGELSKRLAELVRKESCADVAKSLGL------------------LDDIKLGSVGPSADA 127

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTEL 387
            L+ S   VL DI E++ GAI+LD G      F K R   E M  P     +P   L E 
Sbjct: 128 RLRKS---VLGDICEAVIGAIFLDGGHAAAAEFVK-RNWTERMHKPRRPLRDPKTVLQEW 183

Query: 386 CQKR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
            Q +      YR  E    H D +    +++    G+        +++ A+++A   M
Sbjct: 184 AQGKGLPTPVYREVERTGPHHDPQFRVAVDL---PGLAPAEGIGGSKRAAEKVAASVM 238



>gb:CP000010_864953 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 467

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 67/234 (28%), Positives = 101/234 (43%), Gaps = 14/234 (5%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           +S L Y FR+  LL +ALTH S   H     +RLEFLGD+VL+ AV    + ++  L  G
Sbjct: 7   ESRLRYEFRNAELLRQALTHRS---HSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEG 63

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L+ +R+  V     +L  +   L             +I+D ++  E    S  F     
Sbjct: 64  DLSRVRANLVKQ--QSLYEIAQAL-------------NISDGLRLGEGELRSGGF----- 103

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
              P +LAD  E+I GA++LD G      ++     P+L+  + P +L  +    L E  
Sbjct: 104 -RRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILD-HIDPRTLGKDAKTLLQEYL 161

Query: 383 QKRKYRMKEPVVVHKDGEA--------CTT----IEVMANGGVRSCSSSARNRK 258
           Q  K  +    VV   G A        CT     I+V  +G  R  +  A  +K
Sbjct: 162 QGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKK 215



>gb:BX571965_792220 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 467

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 67/234 (28%), Positives = 101/234 (43%), Gaps = 14/234 (5%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           +S L Y FR+  LL +ALTH S   H     +RLEFLGD+VL+ AV    + ++  L  G
Sbjct: 7   ESRLRYEFRNAELLRQALTHRS---HSATHNERLEFLGDSVLNCAVAALLFQRFGKLDEG 63

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L+ +R+  V     +L  +   L             +I+D ++  E    S  F     
Sbjct: 64  DLSRVRANLVKQ--QSLYEIAQAL-------------NISDGLRLGEGELRSGGF----- 103

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
              P +LAD  E+I GA++LD G      ++     P+L+  + P +L  +    L E  
Sbjct: 104 -RRPSILADAFEAIIGAVFLDGGFEAAQGVIKRLYVPILD-HIDPRTLGKDAKTLLQEYL 161

Query: 383 QKRKYRMKEPVVVHKDGEA--------CTT----IEVMANGGVRSCSSSARNRK 258
           Q  K  +    VV   G A        CT     I+V  +G  R  +  A  +K
Sbjct: 162 QGHKIALPTYTVVATHGAAHNQQFEVECTVPKLDIKVSGSGASRRAAEQAAAKK 215



>gb:AP006627_564618 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 260

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 46/167 (27%), Positives = 77/167 (46%), Gaps = 7/167 (4%)
 Frame = -3

Query: 947 QMVNVKRLESDSLL---NYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLD 789
           ++   ++ + D LL     TF +  LL++A TH SY+       +   +RLEFLGDAVL+
Sbjct: 24  ELTEEQKKQFDDLLVRTGLTFENRKLLIQAFTHSSYVNEQRIFSSSDNERLEFLGDAVLE 83

Query: 788 YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV 609
            AV+++ +  Y  +  G +T+LR+                  + +   S A  +    F 
Sbjct: 84  LAVSQYLFKTYKNMSEGDMTKLRA------------------SIVCEPSLARFAEELQFG 125

Query: 608 KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVF 468
           K +         G   +   P +LAD+ E+  GA+Y+D GL    +F
Sbjct: 126 KLVLLGKGEEVTGGRTR---PALLADVFEAFIGALYMDQGLEPVFMF 169



>sp|Q56056|RNC_SALTY Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:CP000026_75190 Salmonella enterica subsp.
           enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008817_244247 Salmonella typhimurium LT2,
           section 121 of 220 of the complete
           genome.>gb:AE016835_344468 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 2 of 16 of the
           complete genome.>gb:AE014613_981800 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1001329 Salmonella typhimurium LT2,
           complete genome.
          Length = 226

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 58/231 (25%), Positives = 103/231 (44%), Gaps = 5/231 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF    LL +ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 13  LGYTFNHQELLQQALTHRSA---SSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A  + +  L   +      L+S                  G   + S 
Sbjct: 70  RMRATLVRGNTLAELAREFDLGECLRLGPGELKS------------------GGFRRES- 110

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E++ G ++LDS ++T   ++    +  L+  ++P   + +P   L E  Q R
Sbjct: 111 --ILADTVEALIGGVFLDSNIQTVEQLILNWYKTRLDE-ISPGDKQKDPKTRLQEYLQGR 167

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACER 231
              +   +VV   GEA     TI    +G       +  +R+ A++ A E+
Sbjct: 168 HLPLPSYLVVQVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQ 218



>sp|Q8Y0I1|RNC_RALSO Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AL646062_545991 Ralstonia solanacearum GMI1000
           chromosome, complete sequence; segment 6/19.
          Length = 256

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 69/238 (28%), Positives = 104/238 (43%), Gaps = 13/238 (5%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F  P LL +ALTH S   H     +RLEFLGD++L+ AV    Y  +  L  G L+
Sbjct: 10  LGYRFSKPELLQQALTHRS---HNAMHNERLEFLGDSILNCAVADMLYGMFGKLDEGDLS 66

Query: 728 ELRSESVNN-ACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
            +R+  V   A Y ++ +                  + D ++  E    S  F       
Sbjct: 67  RVRANLVKQQALYEIAQMLL----------------LPDELRLGEGELKSGGF------R 104

Query: 551 FPWVLADIIESIAGAIYLDSGL--RTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQK 378
            P +LAD +E+I GA++LD G      ++ +   P+LE  V P +L  +    L E  Q 
Sbjct: 105 RPSILADALEAIFGAVFLDGGFDAARTLIRKLYIPILE-QVDPRTLGKDAKTLLQEYLQG 163

Query: 377 RKYRMKEPVVVHKDGEA--------CT--TIEVMANGGVRSCSSSARNRKTAKRLACE 234
            K  + +  VV   G A        CT   +E+  +G   S +S     ++A +LA E
Sbjct: 164 HKIALPQYAVVATHGAAHNQQFEVECTIPKLEIRVSG---SGASRRAAEQSAAKLALE 218



>sp|P51833|RNC_BACSU Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|B69693|B69693 ribonuclease III (EC 3.1.26.3) -
           Bacillus subtilis>gb:BSUB0009_753558 Bacillus subtilis
           complete genome (section 9 of 21): from 1602883 to
           1807145.
          Length = 249

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 51/162 (31%), Positives = 73/162 (45%), Gaps = 7/162 (4%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYI-PHGTQSYQ---RLEFLGDAVLDYAVTRHFYDQY 756
           E    ++  F++  LL +A TH SY+  H  + Y+   RLEFLGDAVL+  ++R  + +Y
Sbjct: 22  EFQERISVHFQNEKLLYQAFTHSSYVNEHRKKPYEDNERLEFLGDAVLELTISRFLFAKY 81

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV---KNIEQSSA 585
           P +  G LT+LR+  V                     S A   S  D V   K  E +  
Sbjct: 82  PAMSEGDLTKLRAAIVCEPSLV---------------SLAHELSFGDLVLLGKGEEMTGG 126

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI 459
                       P +LAD+ E+  GA+YLD GL     F K+
Sbjct: 127 RKR---------PALLADVFEAFIGALYLDQGLEPVESFLKV 159



>gb:AE013598_295556 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 226

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 56/200 (28%), Positives = 82/200 (41%), Gaps = 7/200 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           + + F DP LL +AL H S    GT   +RLEFLGD +++  V    Y ++P    G LT
Sbjct: 12  IGHAFADPDLLAQALRHRSA---GTPHNERLEFLGDGIVNLLVAEALYQRWPKADEGALT 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
             R+E V     A+      L   +      L+S                  G   + S 
Sbjct: 69  RARAELVREGALAVIGRTLNLGERLTLGPGELKS------------------GGHRRDS- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL-------NPVKELTE 390
             +LAD +E+I  AIYLD G      FE+ R V+ P        L       +P   L E
Sbjct: 110 --ILADAVEAIVAAIYLDCG------FERCRAVVLPWFEASLAALPVGKAEKDPKTRLQE 161

Query: 389 LCQKRKYRMKEPVVVHKDGE 330
             Q R+  +    ++ + G+
Sbjct: 162 WLQARQLPLPNYALISESGD 181



>sp|Q88WK0|RNC_LACPL Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AL935256_551415 Lactobacillus plantarum strain
           WCFS1 complete genome; segment 5/11.
          Length = 231

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 46/140 (32%), Positives = 61/140 (43%), Gaps = 4/140 (2%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSYI-PHGTQS---YQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           F DP LL EA T  SY+  H  Q    Y+R+EFLGDAVL+  V+ + Y +Y  +  G LT
Sbjct: 17  FNDPDLLAEAFTQASYVNEHQDQQLKYYERVEFLGDAVLELVVSEYLYKRYKDMPQGKLT 76

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            LR+  V    +A  + +     YI                            W   +  
Sbjct: 77  RLRAAMVCEESFASFARECDFPQYIRLG-----------------KGEQKAHAWERDS-- 117

Query: 548 PWVLADIIESIAGAIYLDSG 489
             +L DI ES  GA+YLD G
Sbjct: 118 --LLCDIFESFVGALYLDQG 135



>sp|P05797|RNC_ECOLI Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|F65034|NREC3 ribonuclease III (EC 3.1.26.3)
           rnc - Escherichia coli  (strain K-12)>pir|F85902|F85902
           RNase III, ds RNA [imported] - Escherichia coli (strain
           O157:H7, substrain EDL933)>pir|A91058|A91058 RNase III
           [imported] - Escherichia coli (strain O157:H7, substrain
           RIMD 0509952)>gb:AE005174_67681 Escherichia coli O157:H7
           EDL933, complete genome.>gb:AE005674_72211 Shigella
           flexneri 2a str. 301, complete
           genome.>gb:ECOK12RIII_129185 Escherichia coli genes for
           ribonuclease III and others, complete
           cds.>gb:ECRNCIII_132518 E. coli rnc gene for
           ribonuclease III.>gb:ECU36841_134043 Escherichia coli
           K-12 genome, approximately 55 minutes.>gb:U00096_201606
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE016764_327084 Escherichia coli CFT073
           section 10 of 18 of the complete
           genome.>gb:AE016987_372398 Shigella flexneri 2a str.
           2457T section 10 of 16 of the complete
           genome.>gb:BA000007_661445 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_957668 Escherichia coli
           CFT073 complete genome.>gb:AE014073_997148 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 226

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 57/234 (24%), Positives = 102/234 (43%), Gaps = 8/234 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF    LL +ALTH S     ++  +RLEFLGD++L Y +    Y ++P +  G ++
Sbjct: 13  LGYTFNHQELLQQALTHRSA---SSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS- 552
            +R+  V                          +++A+  +  E           LK+  
Sbjct: 70  RMRATLVRG------------------------NTLAELAREFELGECLRLGPGELKSGG 105

Query: 551 --FPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                +LAD +E++ G ++LDS ++T   ++    +  L+  ++P   + +P   L E  
Sbjct: 106 FRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTRLDE-ISPGDKQKDPKTRLQEYL 164

Query: 383 QKRKYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACER 231
           Q R   +   +VV   GEA     TI    +G       +  +R+ A++ A E+
Sbjct: 165 QGRHLPLPTYLVVQVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQ 218



>sp|Q97IA4|RNC_CLOAB Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|G97115|G97115 dsRNA-specific ribonuclease III
           [imported] - Clostridium
           acetobutylicum>gb:AE007684_229075 Clostridium
           acetobutylicum ATCC 824 section 172 of 356 of the
           complete genome.>gb:AE001437_1092030 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 230

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 51/150 (34%), Positives = 72/150 (48%), Gaps = 2/150 (1%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY--QRLEFLGDAVLDYAVTRHFYDQYPG 750
           E +S L   F++ +LLV ALTH SY      +   +RLEFLGDAVL  +++ +F+ +YP 
Sbjct: 9   ELESKLGIEFQNINLLVTALTHSSYANENKNAEYNERLEFLGDAVLQLSISEYFFKKYPT 68

Query: 749 LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFG 570
           +  G LT+ R         AL      LH      S   R  +    K I  S      G
Sbjct: 69  ISEGELTKKR---------ALVVCGMSLH------SIGERWQLG---KYIRMSHGEELTG 110

Query: 569 WVLKTSFPWVLADIIESIAGAIYLDSGLRT 480
              + S   ++AD +E++  AIYLD G  T
Sbjct: 111 GRTRVS---IIADCVEAVIAAIYLDKGFDT 137



>gb:AE014295_311682 Bifidobacterium longum NCC2705, complete genome.
          Length = 277

 Score = 63.5 bits (153), Expect = 8e-09
 Identities = 46/141 (32%), Positives = 70/141 (49%), Gaps = 3/141 (2%)
 Frame = -3

Query: 899 TFRDPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTE 726
           T   P LLV+ALTH S+     G  +Y+RLEFLGDAVL+   T   +  +P +  G L +
Sbjct: 56  TTLSPDLLVQALTHRSFSHEHPGVANYERLEFLGDAVLELVSTETLFTIHPDMTEGQLAK 115

Query: 725 LRSESVN-NACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
           +R+++V+ +A  A++  K  +  YIL                 EQ  A            
Sbjct: 116 MRAKAVSEDALSAIAKTKLKVGPYILLGH-----------GEAEQGGAEKNS-------- 156

Query: 548 PWVLADIIESIAGAIYLDSGL 486
             +L DI+ES+ GA +L+ G+
Sbjct: 157 --ILCDIVESLIGATFLEHGI 175



>sp|P59476|RNC_BUCBP Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE014016_302650 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), section 1 of 2 of the complete
           genome.>gb:AE016826_981251 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 226

 Score = 63.5 bits (153), Expect = 8e-09
 Identities = 56/221 (25%), Positives = 99/221 (44%), Gaps = 2/221 (0%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           +L YTF    LL++ALTH S     ++  +RLEFLGD++L + +    Y  +P +  G +
Sbjct: 12  ILGYTFIKKDLLIQALTHRSA---NSKHNERLEFLGDSILSFVIANALYHCFPHVNEGDM 68

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           + +R+  V     A  + +  L +Y+      L+S                  G   + S
Sbjct: 69  SRMRATLVRGHTLAKIAYEFDLGDYLQLGQGELKS------------------GGFRRES 110

Query: 551 FPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQK 378
              +LA+ +E++ G+I+LDS L+T   ++ +  +  L+  + P   + +P   L E  Q 
Sbjct: 111 ---ILANTVEALIGSIFLDSNLKTIEKLILKWYKNRLK-AINPSDTQKDPKTRLQEYLQS 166

Query: 377 RKYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKT 255
           +   +   +V    GEA   +  +       C  S  N KT
Sbjct: 167 KHLPLPSYLVEQVYGEAHNQLFTI------YCEISGINEKT 201



>gb:AE017197_402012 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 227

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 55/206 (26%), Positives = 91/206 (44%), Gaps = 5/206 (2%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGT----QSYQRLEFLGDAVLDYAVTRHFYDQYPG 750
           ++LL Y+F++  LL+EAL+H S   +      + Y+RLEFLGDAVL+  +T   +  +  
Sbjct: 8   ETLLGYSFKNKELLIEALSHPSLRQYHEYKYDKDYERLEFLGDAVLNLLITEILFKNFEN 67

Query: 749 LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFG 570
              G L ++RS  V      +   K  L +YI+ +     +   D   NIE         
Sbjct: 68  YKEGNLAKIRSYLVCKETICIVGTKLALKDYIIMTHGEEVAGGRDNPNNIE--------- 118

Query: 569 WVLKTSFPWVLADIIESIAGAIYLDSGLR-TDIVFEKIRPVLEPMVTPESLRLNPVKELT 393
                       ++ E++  AIYLDS +  T  + EK+    E M        +P   L 
Sbjct: 119 ------------NVTEALIAAIYLDSNIEITHNIIEKL--WAEFMKVQNLTDYDPKTALQ 164

Query: 392 ELCQKRKYRMKEPVVVHKDGEACTTI 315
           E  Q     +    ++ ++G A ++I
Sbjct: 165 EWAQASSNHLPIYRLIKREGAAHSSI 190



>sp|Q8PMV0|RNC_XANAC Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE011764_276267 Xanthomonas axonopodis pv.
           citri str. 306, section 142 of 469 of the complete
           genome.>gb:AE008923_918042 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 226

 Score = 63.2 bits (152), Expect = 1e-08
 Identities = 55/200 (27%), Positives = 83/200 (41%), Gaps = 7/200 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           + + F DP+LL +AL H S    GT   +RLEFLGD +++  +    Y ++P    G LT
Sbjct: 12  IGHAFADPALLAQALRHRSA---GTPHNERLEFLGDGIVNLLIAEALYHRWPKADEGALT 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
             R+E V     A+      L   +      L+S                  G   + S 
Sbjct: 69  RARAELVREGALAVIGRTLNLGERLTLGPGELKS------------------GGHRRDS- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL-------NPVKELTE 390
             +LAD +E+I  AIYLD G      FE+ R V+ P        L       +P   L E
Sbjct: 110 --ILADAVEAIVAAIYLDCG------FERCRAVVLPWFEASLAALPVGKAEKDPKTRLQE 161

Query: 389 LCQKRKYRMKEPVVVHKDGE 330
             Q R+  +    ++ + G+
Sbjct: 162 WLQARQLPLPTYALISESGD 181



>gb:AE016956_367039 Enterococcus faecalis V583, section 10 of 11 of
           the complete genome.>gb:AE016830_993527 Enterococcus
           faecalis V583, complete genome.
          Length = 230

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 65/235 (27%), Positives = 107/235 (45%), Gaps = 13/235 (5%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSYIPHGT----QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           F D +LL +A TH SY+           +RLEFLGDAVL+  V+++ Y ++P L  G LT
Sbjct: 17  FHDVNLLEQAFTHSSYVNEHRYLKLSDNERLEFLGDAVLELIVSQYLYLKFPELPEGKLT 76

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
           ++R+  V     A  + +    NYIL             +   E++S   T     + S 
Sbjct: 77  KMRAAIVREDSLAKFAKECHFDNYIL-------------LGKGEEASGGRT-----RAS- 117

Query: 548 PWVLADIIESIAGAIYLDSGLRT------DIVFEKIRPVLEPMVTPESLRLNPVKELTEL 387
             +L D+ E+  GA+YLD  +        D++F KI           S  ++   +L E+
Sbjct: 118 --LLCDLFEAFLGALYLDQKVGAAKKFIEDVIFPKID------AGAFSHEMDHKTQLQEV 169

Query: 386 CQKRKYRMKEPVVVHKDGEA---CTTIEVMANGGVRSCSSSARNRKTAKRLACER 231
            Q++     E  ++ ++G A       EV  NG +       +++K A++ A ER
Sbjct: 170 LQRKGDVSIEYRLIKEEGPAHDRTFFTEVYMNGELIGL-GQGKSKKLAEQDAAER 223



>gb:AY714854_1189855 Uncultured archaeon GZfos32E4 clone GZfos32E4,
           *** SEQUENCING IN PROGRESS ***.
          Length = 264

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 54/186 (29%), Positives = 81/186 (43%), Gaps = 4/186 (2%)
 Frame = -3

Query: 941 VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHF 768
           +  + +E ++ + + F++ +LL EA+T GSY     G+ +YQ LEFLGD VL   +    
Sbjct: 12  IKFELMELEASIGHQFKNIALLEEAITTGSYSNEHPGSSNYQTLEFLGDRVLSLILAEEL 71

Query: 767 Y--DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
           +   +   L  G +T L++E  NN   A      GL NYI   +   R  I         
Sbjct: 72  FKLSKSASLDEGKMTFLKAELENNLRLAEYGENIGLRNYI--RANEKREDIR-------- 121

Query: 593 SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
                          P V+AD+ E+I GAIYLD                    T ES+R+
Sbjct: 122 ---------------PKVIADVFEAICGAIYLD--------------------TEESIRI 146

Query: 413 NPVKEL 396
             VK++
Sbjct: 147 KEVKKI 152



>sp|Q8Z4K4|RNC_SALTI Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|AC0829|AC0829 ribonuclease III (EC 3.1.26.3)
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)>gb:AL627275_542947 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 11/20.
          Length = 226

 Score = 62.4 bits (150), Expect = 2e-08
 Identities = 57/231 (24%), Positives = 102/231 (44%), Gaps = 5/231 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF    LL +ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 13  LGYTFNHQELLQQALTHRSA---SSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A  + +  L   +      L+S                  G   + S 
Sbjct: 70  RMRATLVRGNTLAELAREFDLGECLRLGPGELKS------------------GGFRRES- 110

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E++ G ++LDS ++T   ++    +  L+  ++P   + +P   L E  Q  
Sbjct: 111 --ILADTVEALIGGVFLDSNIQTVEQLILNWYKTRLDE-ISPGDKQKDPKTRLQEYLQGH 167

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACER 231
              +   +VV   GEA     TI    +G       +  +R+ A++ A E+
Sbjct: 168 HLPLPSYLVVQVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAAAEQ 218



>gb:AY714866_1190303 Uncultured archaeon GZfos36D8 clone GZfos36D8,
           *** SEQUENCING IN PROGRESS ***.
          Length = 262

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 48/154 (31%), Positives = 72/154 (46%), Gaps = 4/154 (2%)
 Frame = -3

Query: 941 VNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHF 768
           +  + +E ++ + + F++ +LL EA+T GSY     G+ +YQ LEFLGD VL   +    
Sbjct: 12  IKFELMELEASIGHQFKNIALLEEAITTGSYSNEHPGSSNYQTLEFLGDRVLSLILAEEL 71

Query: 767 Y--DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
           +   +   L  G +T L++E  NN   A      GL NYI   +   R  I         
Sbjct: 72  FKLSKSASLDEGKMTFLKAELENNLRLAEYGENIGLRNYI--RANEKREDIR-------- 121

Query: 593 SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDS 492
                          P V+AD+ E+I GAIYLD+
Sbjct: 122 ---------------PKVIADVFEAICGAIYLDT 140



>gb:CP000013_869934 Borrelia garinii PBi, complete genome.
          Length = 245

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 47/143 (32%), Positives = 68/143 (47%), Gaps = 3/143 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSY---IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           L+  F +  LL  AL+H SY   +     + +RLEFLGD+VL+  +T H Y  YP    G
Sbjct: 25  LSIDFNNFDLLNTALSHSSYSNELDQKADNNERLEFLGDSVLNLIITDHLYKTYPNKSEG 84

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L++ RS  V+    +  + +  L +YIL              +  E +   +  G    
Sbjct: 85  ELSKARSYIVSEDSLSSIAREIDLGSYIL------------LGRGEESNDGRNKKG---- 128

Query: 557 TSFPWVLADIIESIAGAIYLDSG 489
                +LAD IE+  GAIYLDSG
Sbjct: 129 -----ILADAIEAFVGAIYLDSG 146



>gb:CP000029_81410 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 245

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 49/167 (29%), Positives = 80/167 (47%), Gaps = 4/167 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIP----HGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           L   F++  L  +A +H S+I     +  +  +RLEFLGDAVL+  V+R+ +D++P L  
Sbjct: 24  LGLHFKNIDLYQQAFSHSSFINDFNMNRLEHNERLEFLGDAVLELTVSRYLFDRHPHLPE 83

Query: 740 GCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL 561
           G LT++R+  V      + + K  L+  IL              K  E++   +      
Sbjct: 84  GNLTKMRATIVCEPSLVIFANKIKLNELIL------------LGKGEEKTGGRTR----- 126

Query: 560 KTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL 420
               P +++D  E+  GA+YLD GL  D V+     V+ P V  + L
Sbjct: 127 ----PSLISDAFEAFVGALYLDQGL--DTVWTFAEKVIFPYVEDDEL 167



>pir|F82581|F82581 ribonuclease III XF2246 [imported] - Xylella
           fastidiosa  (strain 9a5c)>gb:AE004037_49874 Xylella
           fastidiosa 9a5c, section 183 of 229 of the complete
           genome.>gb:AE003849_1117084 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 212

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 59/197 (29%), Positives = 90/197 (45%), Gaps = 5/197 (2%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           F DPSLL++AL H S    GT   +RLEFLGD+V++  +    + ++P    G LT  RS
Sbjct: 2   FTDPSLLLQALRHCSA---GTPHNERLEFLGDSVVNLLIAEALFQRWPRADEGALTRARS 58

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
           E V     A  +    L   ++     L+S                  G   + S   +L
Sbjct: 59  ELVRETSLASIARTMQLGEQLILGPGELKS------------------GGHRRDS---IL 97

Query: 536 ADIIESIAGAIYLDSGL---RTDIV--FEKIRPVLEPMVTPESLRLNPVKELTELCQKRK 372
           AD +E++  AIYLD+ L   RT ++  FE     L P+  PE    +P   L E  Q R+
Sbjct: 98  ADAVEAVIAAIYLDADLATCRTVVLPWFETALTAL-PVGKPEK---DPKTRLQEWLQARQ 153

Query: 371 YRMKEPVVVHKDGEACT 321
           + +    ++ + G+  T
Sbjct: 154 WSLPVYELIFESGDPHT 170



>sp|Q8CPI1|RNC_STAEP Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE016747_322558 Staphylococcus epidermidis ATCC
           12228, section 4 of 9 of the complete
           genome.>gb:AE015929_1147227 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 245

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 52/183 (28%), Positives = 88/183 (48%), Gaps = 6/183 (3%)
 Frame = -3

Query: 950 EQMVNVKRLESDSL--LNYTFRDPSLLVEALTHGSYIP----HGTQSYQRLEFLGDAVLD 789
           E + N ++  +D +  L   F++  L  +A +H S+I     +  +  +RLEFLGDAVL+
Sbjct: 8   EMVHNFQQKFTDKMKSLGLHFKNIDLYQQAFSHSSFINDFNMNRLEHNERLEFLGDAVLE 67

Query: 788 YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV 609
             V+R+ +D++P L  G LT++R+  V      + + K  L+  IL              
Sbjct: 68  LTVSRYLFDRHPHLPEGNLTKMRATIVCEPSLVIFANKIKLNELIL------------LG 115

Query: 608 KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP 429
           K  E++   +          P +++D  E+  GA+YLD GL  D V+     V+ P V  
Sbjct: 116 KGEEKTGGRTR---------PSLISDAFEAFVGALYLDQGL--DSVWTFAEKVIFPYVED 164

Query: 428 ESL 420
           + L
Sbjct: 165 DEL 167



>gb:NCB14D6_1689355 Neurospora crassa DNA linkage group II BAC contig
            B14D6.
          Length = 1540

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 44/128 (34%), Positives = 64/128 (50%), Gaps = 15/128 (11%)
 Frame = -3

Query: 1112 RKMDNETIADVTEALIGAFLSTAGEIAAL------------SFLRWLGLDIDFIDAPIVG 969
            R+M ++ +ADV E+LIGA     G   AL            S  +W  +++         
Sbjct: 1090 RQMSSKMVADVVESLIGAAYMCGGMSKALECVALLLPTPKSSQFKWQEIELSRTQL---- 1145

Query: 968  NFPLNAEQMVNVKRLES-DSLLNYTFRDPSLLVEALTHGSYIPHGTQS--YQRLEFLGDA 798
             F    +  +  K+LE  +  ++YTF   SLL+EA+TH S    GT    Y+RLEFLGDA
Sbjct: 1146 -FEFAPKDAILSKQLEPLEKAMDYTFNKKSLLIEAMTHPSCAGLGTNESCYERLEFLGDA 1204

Query: 797  VLDYAVTR 774
            +LD  V +
Sbjct: 1205 ILDVIVVK 1212



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 10/144 (6%)
 Frame = -3

Query: 887  PSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDY-------AVTRHFYDQYPGLFPGCLT 729
            P +    ++ GS    G  +Y+RLEF+GD +L +       A++ H +   P      L+
Sbjct: 980  PLITTALISSGS---RGPTNYERLEFIGDTILKFCACLTASALSAH-HSIVPNHHERLLS 1035

Query: 728  ELRSESVNNACYALSSVKAGLHNYILHSSTALR---SSIADFVKNIEQSSASSTFGWVLK 558
            + + + VNN     +S   GL  YI++S+ + +     + D++  ++   ++ T     K
Sbjct: 1036 QWKDKLVNNVRLCRASRDFGLDEYIINSAASKKWRPKFVEDYMDEMKSPISAETRQMSSK 1095

Query: 557  TSFPWVLADIIESIAGAIYLDSGL 486
                 ++AD++ES+ GA Y+  G+
Sbjct: 1096 -----MVADVVESLIGAAYMCGGM 1114



>gb:BX571870_788197 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 12/17.
          Length = 226

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 57/234 (24%), Positives = 102/234 (43%), Gaps = 8/234 (3%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF    LL++ALTH S     ++  +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 13  LGYTFDQYDLLIQALTHRSA---SSKHNERLEFLGDSILSFVIANALYHRFPRVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS- 552
            +R+  V                          +++A+  +  E           LK+  
Sbjct: 70  RMRATLVRG------------------------NTLAELAREFELGECLRLGPGELKSGG 105

Query: 551 --FPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                +LAD +E++ GAI+LDS +++   I+       L   ++P   + +P   L E  
Sbjct: 106 YRRESILADTVEALIGAIFLDSDIQSIERIILSWYETRLNE-ISPGDKQKDPKTRLQEYL 164

Query: 383 QKRKYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACER 231
           Q     +   +VV   GEA     TI    +G  +    +  +R+ A++ A E+
Sbjct: 165 QGHHLPLPSYLVVMVRGEAHDQEFTIHCQVSGIEQPVKGTGSSRRKAEQAAAEQ 218



>gb:CR925677_118105 Ehrlichia ruminantium str. Gardel, complete
           genome.
          Length = 227

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 60/235 (25%), Positives = 100/235 (42%), Gaps = 7/235 (2%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQS--YQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           ++ Y F++  LL EALTH S +     +  Y+RLEFLGDAVL+  V+   ++ +P    G
Sbjct: 9   IIKYDFKNTQLLNEALTHPSVLSKDNNNFNYERLEFLGDAVLNLVVSEMLFNIFPYDTEG 68

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L + ++  V        +    L  +I+ S        A+   N+E +           
Sbjct: 69  NLAKKKTALVCGTKLVEIAQSINLGIFIIMSDGERSCGGANNSNNLENA----------- 117

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                     +E++ GAIYLD GL+   D +F   +     M  P     +    L E  
Sbjct: 118 ----------LEALIGAIYLDGGLKAAKDFIFLFWKNSATHMKVPPQ---DAKTILQEWA 164

Query: 383 QKRKYRMKEPVVVHKDG---EACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
           Q + +      +++K G     C T+EV  N    +  ++  N+K A++ A   M
Sbjct: 165 QSKGFPAPSYHIINKSGPDHNPCFTVEVRINSH-ETLHATGHNKKLAEQKAASLM 218



>sp|Q9X0I6|RNC_THEMA Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|H72294|H72294 ribonuclease III - Thermotoga
           maritima (strain MSB8)>gb:AE001769_39006 Thermotoga
           maritima MSB8 section 81 of 136 of the complete
           genome.>gb:AE000512_1113479 Thermotoga maritima MSB8,
           complete genome.
          Length = 240

 Score = 61.6 bits (148), Expect = 3e-08
 Identities = 65/264 (24%), Positives = 107/264 (40%), Gaps = 20/264 (7%)
 Frame = -3

Query: 959 LNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQ-------SYQRLEFLGD 801
           +N  +   V+  + ++ +N  F++  LL  AL H SY     Q       S ++LEFLGD
Sbjct: 1   MNESERKIVEEFQKETGIN--FKNEELLFRALCHSSYANEQNQAGRKDVESNEKLEFLGD 58

Query: 800 AVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSI 621
           AVL+  V    Y +YP    G L  ++S + +    A+ S K  L  ++           
Sbjct: 59  AVLELFVCEILYKKYPEAEVGDLARVKSAAASEEVLAMVSRKMNLGKFL----------- 107

Query: 620 ADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE- 444
             F+   E+ +               +LAD  E++  AIYLD G      +EKI+ + E 
Sbjct: 108 --FLGKGEEKTGG--------RDRDSILADAFEALLAAIYLDQG------YEKIKELFEQ 151

Query: 443 ------PMVTPESLRLNPVKELTELCQKRKYRMKEPVVVH---KDGEACTTIEVMANGGV 291
                   +    +  +    L E+ Q       E ++V     DG+    +EV  NG  
Sbjct: 152 EFEFYIEKIMKGEMLFDYKTALQEIVQSEHKVPPEYILVRTEKNDGDRIFVVEVRVNGKT 211

Query: 290 RSCSSSARNR---KTAKRLACERM 228
            +       +   K A R+A E++
Sbjct: 212 IATGKGRTKKEAEKEAARIAYEKL 235



>gb:CR767821_117173 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925678_119064 Ehrlichia
           ruminantium str. Welgevonden, complete genome.
          Length = 227

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 59/235 (25%), Positives = 100/235 (42%), Gaps = 7/235 (2%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQS--YQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           ++ Y F++  LL EALTH S +     +  Y+RLEFLGDAVL+  ++   ++ +P    G
Sbjct: 9   IIKYDFKNTQLLNEALTHPSVLSKDNNNFNYERLEFLGDAVLNLVISEMLFNIFPYDTEG 68

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L + ++  V        +    L  +I+ S        A+   N+E +           
Sbjct: 69  NLAKKKTALVCGTKLVEIAQSINLGIFIIMSDGERSCGGANNSNNLENA----------- 117

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                     +E++ GAIYLD GL+   D +F   +     M  P     +    L E  
Sbjct: 118 ----------LEALIGAIYLDGGLKAAKDFIFLFWKNSATHMKVPPQ---DAKTILQEWA 164

Query: 383 QKRKYRMKEPVVVHKDG---EACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
           Q + +      +++K G     C T+EV  N    +  ++  N+K A++ A   M
Sbjct: 165 QSKGFPAPSYHIINKSGPDHNPCFTVEVRINSH-ETLHATGHNKKLAEQKAASLM 218



>gb:CR378673_96382 Photobacterium profundum SS9; segment 11/12.
          Length = 224

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 60/230 (26%), Positives = 99/230 (43%), Gaps = 5/230 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F    L+  +LTH S   +G  + +RLEFLGD++L + +    Y ++P +  G ++
Sbjct: 12  LGYQFNSSELMTLSLTHRS--ANGKHN-ERLEFLGDSILSFVIADDLYHRFPHVDEGDMS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R+  V     A    +  L +Y+L     L+S                  G   + S 
Sbjct: 69  RMRATLVRGKTLAELGREFELGDYLLLGPGELKS------------------GGFRRDS- 109

Query: 548 PWVLADIIESIAGAIYLDSGLR--TDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E+I GAIYLDS       ++    +  LE  + P   + +P   L E  Q R
Sbjct: 110 --ILADCVEAIIGAIYLDSDTEQVRKVILSWYQSRLE-TIQPGINQKDPKTRLQECLQGR 166

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLACE 234
           +  +    V    GEA     T++    G  +       +R+ A++ A E
Sbjct: 167 RLALPAYTVTKVHGEAHNQEFTVQCEVTGLDKPVIGKGSSRRKAEQAAAE 216



>sp|O51648|RNC_BORBU Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|H70187|H70187 ribonuclease III (rnc) homolog -
           Lyme disease spirochete>gb:AE001170_32685 Borrelia
           burgdorferi B31 (section 56 of 70) of the complete
           genome.>gb:AE000783_1120336 Borrelia burgdorferi B31
           complete genome.
          Length = 246

 Score = 61.2 bits (147), Expect = 4e-08
 Identities = 47/143 (32%), Positives = 68/143 (47%), Gaps = 3/143 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSY---IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           L+  F +  LL  AL H SY   +   + + +RLEFLGD+VL+  +T H Y  YP    G
Sbjct: 26  LSIDFSNFDLLNTALCHSSYSNELDQKSSNNERLEFLGDSVLNLIITDHLYKTYPNKSEG 85

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L++ RS  V+    +  + +  L +YIL              +  E +   +  G    
Sbjct: 86  ELSKARSYIVSEDSLSNIAREINLGSYIL------------LGRGEESNDGRNKKG---- 129

Query: 557 TSFPWVLADIIESIAGAIYLDSG 489
                +LAD IE+  GAIYLDSG
Sbjct: 130 -----ILADAIEAFVGAIYLDSG 147



>sp|O67082|RNC_AQUAE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|G70381|G70381 RNase III - Aquifex
           aeolicus>gb:AE000715_26434 Aquifex aeolicus VF5 section
           47 of 109 of the complete genome.>gb:AE000657_976965
           Aquifex aeolicus VF5 complete genome.
          Length = 221

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/207 (25%), Positives = 94/207 (45%), Gaps = 6/207 (2%)
 Frame = -3

Query: 935 VKRLES-DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQ 759
           +K LE  +  L YTF+D SLL +ALTH SY     + Y+ LEFLGDA++++ +       
Sbjct: 1   MKMLEQLEKKLGYTFKDKSLLEKALTHVSYSKK--EHYETLEFLGDALVNFFIVDLLVQY 58

Query: 758 YPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS 579
            P    G L+ L++  ++   + L + K  LH +I                 I++   + 
Sbjct: 59  SPNKREGFLSPLKAYLISEEFFNLLAQKLELHKFI----------------RIKRGKINE 102

Query: 578 TFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKE 399
           T           ++ D+ E++  A+Y+DSG   +   E    + +  +   +++   VK+
Sbjct: 103 T-----------IIGDVFEALWAAVYIDSGRDANFTRELFYKLFKEDIL-SAIKEGRVKK 150

Query: 398 -----LTELCQKRKYRMKEPVVVHKDG 333
                L E+ QKR     E  ++  +G
Sbjct: 151 DYKTILQEITQKRWKERPEYRLISVEG 177



>gb:AJ720721_2502908 Gallus gallus mRNA for hypothetical protein,
            clone 24a21.
          Length = 1336

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  D  +  N
Sbjct: 985  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDKDLRDVWL--N 1042

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 1043 YPLHPLQLQESNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 1102

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  + 
Sbjct: 1103 GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEFA 1162

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 1163 ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 1200

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 1201 TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 1241



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 928  ERLEFLGDAVVEFLTSVHLYYLFPTLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 987

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                     D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 988  HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 1019



>gb:BC088999_2110660 Mus musculus ethanol induced 2, mRNA (cDNA clone
            MGC:115770 IMAGE:6417566), complete cds.
          Length = 1373

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 1022 LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 1079

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 1080 YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 1139

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 1140 GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 1199

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 1200 ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 1237

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 1238 TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 1278



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 965  ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 1024

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                     D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 1025 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 1056



>gb:BC060265_2103961 Mus musculus ethanol induced 2, mRNA (cDNA clone
            IMAGE:5698108), partial cds.
          Length = 1231

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 880  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 937

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 938  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 997

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 998  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 1057

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 1058 ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 1095

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 1096 TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 1136



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 823  ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 882

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                     D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 883  HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 914



>gb:BC057687_2102885 Mus musculus ethanol induced 2, mRNA (cDNA clone
            IMAGE:3995734), partial cds.
          Length = 942

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 591  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 648

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 649  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 708

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 709  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 768

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 769  ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 806

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 807  TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 847



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 534 ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 593

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                    D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 594 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 625



>gb:BC055696_2102097 Mus musculus ethanol induced 2, mRNA (cDNA clone
            IMAGE:6401619), partial cds.
          Length = 780

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 429  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 486

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 487  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 546

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 547  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 606

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 607  ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 644

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 645  TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 685



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 372 ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 431

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                    D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 432 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 463



>gb:BC041162_1983005 Homo sapiens nuclear RNase III Drosha, mRNA (cDNA
            clone IMAGE:5114643), partial cds.
          Length = 722

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 371  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 428

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 429  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 488

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 489  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 548

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 549  ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 586

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 587  TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 627



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 314 ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 373

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                    D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 374 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 405



>gb:AF116910_1884601 Homo sapiens clone HAW100 putative ribonuclease
            III mRNA, complete cds.
          Length = 541

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 190  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 247

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 248  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 307

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 308  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 367

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 368  ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 405

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 406  TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 446



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 133 ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 192

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                    D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 193 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 224



>gb:AX876043_1476348 Sequence 10948 from Patent
            EP1074617.>gb:AK001121_1908257 Homo sapiens cDNA FLJ10259
            fis, clone HEMBB1000947, highly similar to Homo sapiens
            clone HAW100 putative ribonuclease III mRNA.
          Length = 769

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 418  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 475

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 476  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 535

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 536  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 595

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 596  ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 633

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 634  TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 674



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 361 ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 420

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                    D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 421 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 452



>gb:AY714822_1188647 Uncultured archaeon GZfos17C7 clone GZfos17C7,
           *** SEQUENCING IN PROGRESS ***.
          Length = 248

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 48/149 (32%), Positives = 68/149 (45%), Gaps = 4/149 (2%)
 Frame = -3

Query: 926 LESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS--YQRLEFLGDAVLDYAVTRHFY--DQ 759
           +E + L+ + F++ +LL EA+T GSY      S  YQRLEFLGD VL   +    +   +
Sbjct: 1   MELEKLIGHKFKNIALLEEAITTGSYSNEHPDSSDYQRLEFLGDRVLSLILAEELFKLSK 60

Query: 758 YPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS 579
              L  G +T L++E  NN   A      GL NYI   +   R  I              
Sbjct: 61  SASLDEGKMTFLKAELENNLRLAEYGENMGLRNYI--RANEKREDIR------------- 105

Query: 578 TFGWVLKTSFPWVLADIIESIAGAIYLDS 492
                     P V+AD+ E+I GA+Y D+
Sbjct: 106 ----------PKVIADVFEAICGAVYQDT 124



>gb:CR522870_100090 Desulfotalea psychrophila LSv54 chromosome.
          Length = 241

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 59/192 (30%), Positives = 84/192 (43%), Gaps = 6/192 (3%)
 Frame = -3

Query: 932 KRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQS---YQRLEFLGDAVLDYAVTRHFYD 762
           K  E +  +NY F D  LL +AL H SY     Q+    +RLEF+GDAVLD  V    Y 
Sbjct: 15  KHAEFEKKINYKFIDLRLLQKALIHSSYAFEQAQAGKNNERLEFVGDAVLDLVVGNALYR 74

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           ++P +  G LT LR+  VN    A  + K  L  ++            D  K  E+SS  
Sbjct: 75  RFPEMREGELTRLRAALVNEGHLATMARKINLGYFLCLGKG------EDNSKGREKSS-- 126

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV--TPESLRLNP 408
                        +L+   E++ GAI+ D G   D V   +     P++    E L L  
Sbjct: 127 -------------ILSCAYEAVIGAIFQDGGY--DAVAALVERFFLPVIDRRKEDLLLAD 171

Query: 407 VK-ELTELCQKR 375
            K  L E+ Q++
Sbjct: 172 AKSRLQEILQEK 183



>sp|Q9NRR4|RNC_HUMAN Ribonuclease III (EC 3.1.26.3) (RNase III)
            (p241).
          Length = 1374

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 76/282 (26%), Positives = 116/282 (41%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 1023 LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 1080

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 1081 YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 1140

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 1141 GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 1200

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 1201 ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 1238

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 1239 TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 1279



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 966  ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 1025

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                     D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 1026 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 1057



>gb:BX248586_764140 Blochmannia floridanus complete genome; segment
           3/3.
          Length = 232

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 58/224 (25%), Positives = 98/224 (43%), Gaps = 1/224 (0%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F    LL+ ALTH S+     +  +RLEFLGD++L+Y++T   Y +Y  +  G ++
Sbjct: 16  LGYFFHTVDLLLRALTHRSF---SNKHNERLEFLGDSILNYSITNILYHRYNHMDEGDMS 72

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +RS  V +      + +  L N +      L++      K   + S             
Sbjct: 73  RIRSSLVCSRTLVELAKEFKLGNCLKLGQGELKN------KGYNRES------------- 113

Query: 548 PWVLADIIESIAGAIYLDSGLRT-DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKRK 372
             +LAD +E+I G I+LDS ++T +++           +  E  + +P   L E  Q   
Sbjct: 114 --ILADTVEAIIGGIFLDSNIKTIEMLIAFWYQFRLNKIDLEDKQKDPKTRLQEYLQHHH 171

Query: 371 YRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLA 240
             +    +    G+A   I +M N  V S   S   R +++R A
Sbjct: 172 LPLPIYCINQVQGQAHDQIFIM-NCQVSSLKYSVMGRGSSRRKA 214



>sp|Q8ER05|RNC_OCEIH Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:BA000028_695913 Oceanobacillus iheyensis HTE831
           DNA, complete genome.
          Length = 228

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 55/196 (28%), Positives = 86/196 (43%), Gaps = 4/196 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYI-PHGTQSY---QRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           L  +F+  +LL EA TH SY+  H  Q     +RLEFLGDAVL+ AV+++ Y     +  
Sbjct: 10  LGISFQQKALLKEAFTHSSYVNEHRKQRLSDNERLEFLGDAVLELAVSQYLYRNNKDMPE 69

Query: 740 GCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVL 561
           G +T+LR+  V          +  L N+         +   +F K +         G   
Sbjct: 70  GEMTKLRAAIV---------CEPSLKNF---------AEELEFGKFLRLGKGEQQTG--- 108

Query: 560 KTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQ 381
               P +LAD  E+  GA+YLD G    + F  I    +      S  ++   +L E  Q
Sbjct: 109 GRERPAILADAFEAFLGALYLDQGFDNVLDFLNIHVFPKLTTGAFSHAMDYKSQLQEFVQ 168

Query: 380 KRKYRMKEPVVVHKDG 333
           + K +  E  ++ + G
Sbjct: 169 QHKDQKIEYRIIEEKG 184



>gb:AF189011_1888744 Homo sapiens ribonuclease III (RN3) mRNA,
            complete cds.
          Length = 1374

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 76/282 (26%), Positives = 115/282 (40%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 1023 LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 1080

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 1081 YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 1140

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 1141 GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 1200

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y D  L    
Sbjct: 1201 ITNDKTKRPV-------------------ALRTK---TLADLLESFIAALYTDKDLEYVH 1238

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 1239 TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 1279



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 966  ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDPFMLYA 1025

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                     D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 1026 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 1057



>gb:AF440766_2065825 Mus musculus ribonuclease III (Rn3) mRNA,
            complete cds.
          Length = 541

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 76/282 (26%), Positives = 115/282 (40%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 190  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 247

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 248  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 307

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 308  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 367

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD+ ES   A+Y+D  L    
Sbjct: 368  ITNDKTKRPV-------------------ALRTK---TLADLWESFIAALYIDKDLEYVH 405

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 406  TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 446



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 133 ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAMVQNQHLAMLAKKLELDRFMLYA 192

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                    D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 193 HG------PDLCRESDLRHA---------------MANCFEALIGAVYLEGSL 224



>sp|Q8Z023|RNC_ANASP Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|AH1841|AH1841 ribonuclease III [imported] -
           Nostoc sp. (strain PCC 7120)>gb:BA000019_681272 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 228

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 46/156 (29%), Positives = 70/156 (44%), Gaps = 3/156 (1%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSYI---PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTE 726
           FRD  LL  ALTH SY+   P   +  +RLEFLGDA+L++    + Y  +P      LT 
Sbjct: 7   FRDDKLLRRALTHRSYVNENPEEGEHNERLEFLGDAILNFLSGEYLYRSHPDRGEDELTR 66

Query: 725 LRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFP 546
            RS  V+    A  +++ GL   +     A+R                   G+      P
Sbjct: 67  RRSALVDEKQLAKFAIEVGLDFKMRLGKGAIRDG-----------------GY----QNP 105

Query: 545 WVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPM 438
            +L+   E++ GA YLD+        E +R ++EP+
Sbjct: 106 NLLSSTFEAVIGAYYLDNNSN----IEAVRAIIEPL 137



>gb:AE014983_313838 Streptococcus mutans UA159 section 131 of 185 of
           the complete genome.>gb:AE014133_940839 Streptococcus
           mutans UA159 complete genome.
          Length = 231

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 57/217 (26%), Positives = 86/217 (39%), Gaps = 4/217 (1%)
 Frame = -3

Query: 932 KRLESDSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFY 765
           K+L  D      F D  LL  A TH SY            +RLEFLGDAVL   ++ + +
Sbjct: 6   KKLAED--FKIVFSDKELLETAFTHTSYANEHRLLNISHNERLEFLGDAVLQLTISHYLF 63

Query: 764 DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA 585
           D+YP    G L+++RS  V     A  S       YI               K  E+S  
Sbjct: 64  DKYPQKAEGDLSKMRSMIVREESLAGFSRNCHFDRYI------------KLGKGEEKSGG 111

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV 405
                         +L D+ E+  GA+ LD+GL+       +   L  +V P+ +  N  
Sbjct: 112 RQR---------DTILGDLFEAFLGALLLDAGLKA------VEAFLNQVVIPK-VENNNY 155

Query: 404 KELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGG 294
           + +T+      Y+     ++  DG+     EV+   G
Sbjct: 156 ERVTD------YKTALQELLQVDGDVLIDYEVLKESG 186



>sp|Q8D305|RNC_WIGBR Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:BA000021_686942 Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis DNA, complete
           genome.
          Length = 226

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 48/196 (24%), Positives = 97/196 (49%), Gaps = 2/196 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           + Y F +  +L +ALTH S+    +++ +RLEFLGD++L+Y ++   Y+ +  +  G L+
Sbjct: 13  MGYLFHNNIILKQALTHRSF---SSKNNERLEFLGDSILNYIISDALYNNFTNIPEGKLS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
           ++RS  V     A  + +  L +Y++     +++      KN +                
Sbjct: 70  QMRSYLVRGNTLAEIAREFCLGDYLILGIGEVKTG----GKNRDS--------------- 110

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +L++ +E+I G I+LDS +    +IV    +  L  M + ++L+ +P   L E  Q  
Sbjct: 111 --ILSNAMEAIIGGIFLDSNINKTHEIVISWYKNRLYSM-SLKNLKKDPKTRLQEYLQGN 167

Query: 374 KYRMKEPVVVHKDGEA 327
           K+ + +  + +  GE+
Sbjct: 168 KFSLPQYYIKNITGES 183



>gb:AF533013_2067662 Mus musculus ribonuclease III mRNA, complete cds.
          Length = 1021

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 75/282 (26%), Positives = 115/282 (40%), Gaps = 23/282 (8%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D    +  +  N
Sbjct: 670  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPGLREVWL--N 727

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 728  YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 787

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  Y 
Sbjct: 788  GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYA 847

Query: 653  LHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDI 474
            + +    R                      L+T     LAD++ES   A+Y+D  L    
Sbjct: 848  VTNDKTKRPV-------------------ALRTK---TLADLLESFIAALYIDKDLEYVH 885

Query: 473  VFEKI--RPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEP 354
             F  +   P L+  +  +    +P  +L + C   +   KEP
Sbjct: 886  TFMNVCFFPRLKEFILNQDWN-DPKSQLQQCCLTLRTEGKEP 926



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 34/131 (25%), Positives = 56/131 (42%)
 Frame = -3

Query: 878 LVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNA 699
           +V  L      P      +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N 
Sbjct: 595 IVSRLGQDDPTPSRINHNERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQ 654

Query: 698 CYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIES 519
             A+ + K  L  ++L++         D  +  +   A               +A+  E+
Sbjct: 655 HLAMLAKKLELDRFMLYAHG------PDLCRESDLRHA---------------MANCFEA 693

Query: 518 IAGAIYLDSGL 486
           + GA+YL+  L
Sbjct: 694 LIGAVYLEGSL 704



>gb:AP006618_560582 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 240

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 47/136 (34%), Positives = 66/136 (48%), Gaps = 2/136 (1%)
 Frame = -3

Query: 887 PSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSE 714
           P LL  ALTH SY     G  + +RLEFLGD+VL  ++T   Y ++P    G L +LR+ 
Sbjct: 27  PDLLRLALTHRSYAYENGGLPTNERLEFLGDSVLGLSITERLYHEHPDKSEGELAKLRAS 86

Query: 713 SVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLA 534
            VN   +AL+ V  GL    L +   L        K  E +              P +LA
Sbjct: 87  VVN--MHALAEVARGLGEGGLGAHLLLG-------KGEELTGGRDK---------PSILA 128

Query: 533 DIIESIAGAIYLDSGL 486
           D +ES+ GA++L  G+
Sbjct: 129 DGMESLLGAVHLQHGI 144



>sp|O83787|RNC_TREPA Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|G71277|G71277 probable ribonuclease III (rnc)
           - syphilis spirochete>gb:AE001252_33632 Treponema
           pallidum subsp. pallidum str. Nichols section 68 of 87
           of the complete genome.>gb:AE000520_1049860 Treponema
           pallidum subsp. pallidum str. Nichols complete genome.
          Length = 254

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 59/218 (27%), Positives = 94/218 (43%), Gaps = 8/218 (3%)
 Frame = -3

Query: 962 PLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPH-----GTQSYQRLEFLGDA 798
           PL  E+  +++RL+    L   FRDP+ L +AL+H S         G +  +R+EFLGDA
Sbjct: 15  PLTPERRESLRRLQET--LGVKFRDPTALDQALSHRSLFSSKEDHCGVRHNERMEFLGDA 72

Query: 797 VLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIA 618
           VL        Y   P    G L + ++  V+    +  ++   + +Y+L           
Sbjct: 73  VLGAVAAACLYRALPDSHEGDLAKTKAVLVSTDTLSDIALSLRIDHYLL----------- 121

Query: 617 DFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPM 438
              K  E S                +LAD  E++ GA++LDSG +    F  +  +L P 
Sbjct: 122 -LGKGEELSGGRHKKA---------ILADATEAVIGALFLDSGFKAAERF--VLRLLLPR 169

Query: 437 VTP--ESLRLNPVKELTELCQKRKYRMK-EPVVVHKDG 333
           V P  E    +  K   ++   ++YR K E  VV + G
Sbjct: 170 VRPIREKNLHHDYKSTLQVLAHQRYRSKPEYTVVKRTG 207



>gb:BC050057_2100335 Mus musculus ethanol induced 2, mRNA (cDNA clone
            IMAGE:30006304), partial cds.
          Length = 705

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 70/265 (26%), Positives = 108/265 (40%), Gaps = 19/265 (7%)
 Frame = -3

Query: 1091 IADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGNFPLNAEQM--------- 942
            +A+  EALIGA +L  + E A   F R L  D D  +  +  N+PL+  Q+         
Sbjct: 371  MANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--NYPLHPLQLQEPNTDRQL 428

Query: 941  -----VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSY-QRLEFLGDAVLDYA 783
                 V  K  E +  +   F    LL  A T  +    H T  + QR+EFLGD+++   
Sbjct: 429  IETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLV 488

Query: 782  VTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKN 603
             T + +  +P      LT LRS  VNN   A  + + G+  Y + +    R         
Sbjct: 489  ATEYLFIHFPDHHERHLTLLRSSLVNNRTQAKVAEELGMQEYAITNDKTKRPV------- 541

Query: 602  IEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI--RPVLEPMVTP 429
                         L+T     LAD++ES   A+Y+D  L     F  +   P L+  +  
Sbjct: 542  ------------ALRTK---TLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILN 586

Query: 428  ESLRLNPVKELTELCQKRKYRMKEP 354
            +    +P  +L + C   +   KEP
Sbjct: 587  QDWN-DPKSQLQQCCLTLRTEGKEP 610



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 31/113 (27%), Positives = 51/113 (45%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 297 ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 356

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                 S +D                         +A+  E++ GA+YL+  L
Sbjct: 357 HGPDLCSESD---------------------LRHAMANCFEALIGAVYLEGSL 388



>gb:BX957223_844779 Methanococcus maripaludis S2 complete genome;
           segment 5/5.
          Length = 230

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 44/163 (26%), Positives = 77/163 (47%), Gaps = 6/163 (3%)
 Frame = -3

Query: 914 SLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           S L+  F D ++   A  H SY+        +  +RLE+LGDAVLD  ++ + + +   L
Sbjct: 10  SKLDIQFNDLNIFKRAFMHSSYVNEQKNTNLEDNERLEYLGDAVLDLIISEYLFKK-ENL 68

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G +++LR++ V  +     + K   +NY+L     + S                  G+
Sbjct: 69  SEGEMSKLRAKYVCESALFTYAKKLKFNNYVLLGKGEINSK-----------------GY 111

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLE 444
               + P +++D+ E+   AIYLD GL +    V+E I P++E
Sbjct: 112 ----NKPAIVSDVFEAFIAAIYLDQGLDSVKKFVYEFIIPIIE 150



>gb:AE017146_390452 Helicobacter hepaticus ATCC 51449 section 3 of 6
           of the complete genome.>gb:AE017125_1024714 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 240

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 47/143 (32%), Positives = 69/143 (48%), Gaps = 2/143 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L Y F++  LL+EALTH S       + +RLEFLGDAVLD  V  + + ++P    G L+
Sbjct: 17  LGYVFQNQQLLLEALTHKSCKKQ--YNNERLEFLGDAVLDLLVGEYLFKKFPLAKEGELS 74

Query: 728 ELRSESVNNACY--ALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKT 555
           +LR+  VN   +     S+  G + YI  S             N  +  AS         
Sbjct: 75  KLRACIVNEKGFMKLAQSLDLGAYLYISQSEE----------NNNGRQKAS--------- 115

Query: 554 SFPWVLADIIESIAGAIYLDSGL 486
               +L++  E++ GAIYL+S L
Sbjct: 116 ----ILSNAFEALIGAIYLESSL 134



>sp|Q53844|RNC_SPICI Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:SCU28972_181693 Spiroplasma citri orfa and orff
           genes, partial cds, orfb, orfc, and orfe genes and
           Spiroplasma virus SpV1-derived ORF1 and ORF3 genes,
           complete cds, and SpV1-derived ORF14 gene, partial cds.
          Length = 248

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 62/221 (28%), Positives = 94/221 (42%), Gaps = 9/221 (4%)
 Frame = -3

Query: 875 VEALTHGSYIPHGTQSY--QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNN 702
           +EALTH SY      SY  QR+EFLGDA+L   ++ + +  +P    G +T LRS+ V  
Sbjct: 33  LEALTHNSYANEHNLSYTYQRMEFLGDAILAKEISLYLFLSFPDKNEGEITNLRSKIVRE 92

Query: 701 ACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIE 522
              A    +     ++L     +++      K  E++                +LADI E
Sbjct: 93  GTLAELVRRMNWAPFLLLGKGEIKT------KGYEKNR---------------ILADIYE 131

Query: 521 SIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL--RLNPVK-ELTELCQKRKYRMKEPV 351
           S+  A+YLD G   D+V   I   L  MV+      ++   K EL E  Q    R  E  
Sbjct: 132 SMIAALYLDLG--EDVVRTFINNTLIRMVSNPGFFDKIRDYKTELQEFLQAGDARTLEYK 189

Query: 350 VVHK----DGEACTTIEVMANGGVRSCSSSARNRKTAKRLA 240
           ++ +    +G       V   GG+R         K A++LA
Sbjct: 190 LIKESQPLEGNRVLYTVVAEIGGIRYGEGCGYTHKEAEQLA 230



>gb:AE017283_431232 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 366

 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 48/154 (31%), Positives = 69/154 (44%), Gaps = 2/154 (1%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           DP LL  ALTH SY     G  + +RLEFLGDA+L+  VT + Y  +P    G L +LRS
Sbjct: 151 DPQLLDLALTHRSYAFENGGIPTNERLEFLGDAILEVGVTDYLYRAFPDKPEGQLAKLRS 210

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
             V+       + + G+                     I+        G   KTS   +L
Sbjct: 211 AVVSTVSLGRLARQLGIG------------------PRIKLGKGEERTGGHDKTS---IL 249

Query: 536 ADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV 435
           AD  E++ GA+ L +GL    V   +  + +P+V
Sbjct: 250 ADTTEALLGAVELSAGLPN--VLRLVHHLFDPLV 281



>gb:BX842643_822491 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 2/4.
          Length = 232

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 67/228 (29%), Positives = 90/228 (39%), Gaps = 25/228 (10%)
 Frame = -3

Query: 905 NYTFRDPSLLVEALTHGSYIPHGT--QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           N    +  L  EALTH SY        SYQRLEFLGDA+L   V+R  +  Y  L  G L
Sbjct: 11  NIKINNEKLFNEALTHNSYANEHKLKYSYQRLEFLGDAILQMYVSRFLFFNYSKLSEGEL 70

Query: 731 TELRSESVNNACYAL--------SSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
           T LR+ +V               + VK G   YI               K  E+      
Sbjct: 71  TRLRASTVREETLFRVAKDINLGALVKLGHGEYI--------------TKGYEK------ 110

Query: 575 FGWVLKTSFPWVLADIIESIAGAIYLD---SGLRT---DIVFEKIRPVLEPMVTPESLRL 414
                    P +LAD+ E++  AIYLD    GL T     +F+ I+         +S  +
Sbjct: 111 ---------PSILADVFEALTAAIYLDQKEDGLVTWLGQTLFKYIK---------DSNFI 152

Query: 413 NPVK----ELTELCQKR-----KYRMKEPVVVHKDGEACTTIEVMANG 297
           N  K    EL EL Q       KY +++      + +   T+ V  NG
Sbjct: 153 NDTKDFKSELQELLQSEKRSDLKYIIEKEDFFANENKILYTVSVNLNG 200



>gb:AE017263_420784 Mesoplasma florum L1 complete genome.
          Length = 231

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 54/208 (25%), Positives = 88/208 (42%), Gaps = 10/208 (4%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPHGT--QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           D  +   ALTH SY       ++YQRLEFLGDAVL   V++  Y  +     G LT+ RS
Sbjct: 16  DSKIFSTALTHNSYANETKTKETYQRLEFLGDAVLQMYVSKFLYLNFTNAPEGKLTKTRS 75

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
           + V     +  +    L   I      ++S      K  E+               P +L
Sbjct: 76  DIVRQETLSEIAKMIDLGKIIRLGQGEIKS------KGYEK---------------PSIL 114

Query: 536 ADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP---ESLRLNPVKELTELCQKR--- 375
           +D+ E++  AIYLD     +++   I+  +   +     + L  +   EL E+ Q     
Sbjct: 115 SDVYEAVTAAIYLDQ--TEEVLISWIKSTIFKYIEKNDYKELNHDYKSELQEIIQAEIRS 172

Query: 374 --KYRMKEPVVVHKDGEACTTIEVMANG 297
             +YR++    + KD +   T+ V  +G
Sbjct: 173 DLEYRVESQKHIEKDNKIEYTVSVNLDG 200



>gb:ECRNC1_132516 E. coli K12 (strain SB221) gene rnc for
           ribonuclease III.
          Length = 227

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 45/183 (24%), Positives = 81/183 (44%), Gaps = 5/183 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF    LL +ALTH S     ++  +RLEFLGD++L Y +    Y ++P +  G ++
Sbjct: 13  LGYTFNHQELLQQALTHRSA---SSKHNERLEFLGDSILSYVIANALYHRFPRVDEGDMS 69

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS- 552
            +R+  V                          +++A+  +  E           LK+  
Sbjct: 70  RMRATLVRG------------------------NTLAELAREFELGECLRLGPGELKSGG 105

Query: 551 --FPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                +LAD +E++ G ++LDS ++T   ++    +  L+  ++P   + +P   L E  
Sbjct: 106 FRRESILADTVEALIGGVFLDSDIQTVEKLILNWYQTRLDE-ISPGDKQKDPKTRLQEYL 164

Query: 383 QKR 375
           Q R
Sbjct: 165 QGR 167



>gb:AE017237_413700 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 11 of 16 of the complete
           genome.>gb:AE016958_1057104 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 237

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 49/139 (35%), Positives = 65/139 (46%), Gaps = 5/139 (3%)
 Frame = -3

Query: 881 LLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
           LL  ALTH SY     G  + +RLEFLGDAVL   +T   Y ++P    G L +LR+  V
Sbjct: 19  LLSLALTHRSYAYEHGGLPTNERLEFLGDAVLGLTITDALYHRHPDRTEGDLAKLRASVV 78

Query: 707 NNACYALSSVK---AGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
           N    A  + K    GL  ++L       +  AD                  K+S   +L
Sbjct: 79  NTQALADVARKLCDGGLGAHLLLGRGEANTGGAD------------------KSS---IL 117

Query: 536 ADIIESIAGAIYLDSGLRT 480
           AD +ES+ GAIYL  G+ T
Sbjct: 118 ADGMESLLGAIYLQHGIDT 136



>gb:AE017314_439691 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 6 of 12 of the complete
           genome.>gb:AE017285_1072852 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 253

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 55/194 (28%), Positives = 89/194 (45%), Gaps = 7/194 (3%)
 Frame = -3

Query: 938 NVKRL-ESDSLLNYTFRDPSLLVEALTHGSYIPHGT---QSYQRLEFLGDAVLDYAVTRH 771
           NVK + E    + + F D  LL+ A+TH S+        +  +RLEFLGDAVL+  V+  
Sbjct: 25  NVKPVDELQKTIGHRFGDMELLLTAMTHSSWANEQAVPVEHNERLEFLGDAVLELCVSEE 84

Query: 770 FYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQS 591
            + ++P    G LT +RS  V+    +L  V           +  LR  ++  +   E+S
Sbjct: 85  LFRRFPSAREGDLTRMRSRLVSKP--SLEGV-----------ARELRLDMSLRLGKGEES 131

Query: 590 SASSTFGWVLKTSFPWVLADIIESIAGAIYLDSG--LRTDIVFEKIRPVLEPMVTPESLR 417
                 G         +L+D +E++ GA++LD+G      +V   + P     + P  +R
Sbjct: 132 QGGRERG--------SLLSDALEAMLGAVFLDAGYIAAKGVVMRILGPHFPEALVP--VR 181

Query: 416 LNPVK-ELTELCQK 378
               K +L EL QK
Sbjct: 182 TKDYKSQLQELTQK 195



>gb:STU48415_193814 Salmonella typhimurium RNase III (rnc),
           G-protein (era) and RecO (recO) genes, complete cds, and
           PdxJ (pdxJ) gene, partial cds.
          Length = 224

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 56/228 (24%), Positives = 100/228 (43%), Gaps = 5/228 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLT 729
           L YTF    LL +ALTH S     ++  +RLEFLGD++L + +  +   ++P +  G ++
Sbjct: 13  LGYTFNHQELLQQALTHRSA---SSKHNERLEFLGDSILSFVIA-NALSRFPRVDEGDMS 68

Query: 728 ELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSF 549
            +R   V     A  + +  L   +      L+S                  G   + S 
Sbjct: 69  RMRDPLVRGNTLAELAREFDLGECLRLGPGELKS------------------GGFRRES- 109

Query: 548 PWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQKR 375
             +LAD +E++ G ++LDS ++T   ++    +  L+  ++P   + +P   L E  Q R
Sbjct: 110 --ILADTVEALIGGVFLDSNIQTVEQLILNWYKTRLDE-ISPGDKQKDPKTRLQEYLQGR 166

Query: 374 KYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKTAKRLA 240
              +   +VV   GEA     TI    +G       +  +R+ A++ A
Sbjct: 167 HLPLPSYLVVQVRGEAHDQEFTIHCQVSGLSEPVVGTGSSRRKAEQAA 214



>sp|O69469|RNC_MYCLE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|T44706|T44706 ribonuclease III (EC 3.1.26.3)
           [imported] - Mycobacterium leprae>gb:MLCB1243_144410
           Mycobacterium leprae cosmid B1243.>gb:MLEPRTN7_147461
           Mycobacterium leprae strain TN complete genome; segment
           7/10.
          Length = 238

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 48/137 (35%), Positives = 64/137 (46%), Gaps = 5/137 (3%)
 Frame = -3

Query: 881 LLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
           LL  ALTH SY     G  + +RLEFLGDAVL   +T   + ++P    G L +LR+  V
Sbjct: 20  LLSLALTHRSYAYEHGGLPTNERLEFLGDAVLSLTITDELFHRHPDRSEGDLAKLRASVV 79

Query: 707 NN---ACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
           N    A  A +    GL  Y+L       +  AD                  K+S   +L
Sbjct: 80  NTQALAYVARNLSDGGLGVYLLLGRGETNTGGAD------------------KSS---IL 118

Query: 536 ADIIESIAGAIYLDSGL 486
           AD +ES+ GAIYL  G+
Sbjct: 119 ADGMESLLGAIYLHHGI 135



>gb:AY373464_2084294 Rattus norvegicus ribonuclease III-like protein
           mRNA, partial cds.
          Length = 288

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 51/197 (25%), Positives = 80/197 (40%), Gaps = 4/197 (2%)
 Frame = -3

Query: 932 KRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQSY-QRLEFLGDAVLDYAVTRHFYDQ 759
           K  E +  +   F    LL  A T  +    H T  + QR+EFLGD+++    T + +  
Sbjct: 20  KLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIH 79

Query: 758 YPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASS 579
           +P    G LT LRS  VNN   A  + + G+  Y + +    R                 
Sbjct: 80  FPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQEYAITNDKTKRPV--------------- 124

Query: 578 TFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI--RPVLEPMVTPESLRLNPV 405
                L+T     LAD++ES   A+Y+D  L     F  +   P L+  +  +    +P 
Sbjct: 125 ----ALRTK---TLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQDWN-DPK 176

Query: 404 KELTELCQKRKYRMKEP 354
            +L + C   +   KEP
Sbjct: 177 SQLQQCCLTLRTEGKEP 193



>sp|Q92R47|RNC_RHIME Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:SME591786_185090 Sinorhizobium meliloti 1021
           complete chromosome; segment 5/12.
          Length = 238

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 60/239 (25%), Positives = 95/239 (39%), Gaps = 5/239 (2%)
 Frame = -3

Query: 929 RLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPG 750
           R   ++ + Y F +   L  ALTH S       +YQRLEFLGD VL   V    +  +  
Sbjct: 11  RARLEAAIGYRFAEKERLDRALTHSSARSGRAINYQRLEFLGDRVLGLCVAELLFQTFTD 70

Query: 749 LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFG 570
              G L+   ++ V+    A  + +  LH +I   S          VK I      +   
Sbjct: 71  ANEGELSVRLNQLVSAESCAKVADELSLHEFIRTGSD---------VKKITGKHMMN--- 118

Query: 569 WVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPVKELTE 390
                    V AD++ES+  AIYLD GL     F  +        + +  R +   EL E
Sbjct: 119 ---------VRADVVESLIAAIYLDGGLDAARRF-VLEHWTHRAASADGARRDAKTELQE 168

Query: 389 LCQKR-----KYRMKEPVVVHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACERM 228
               +     KYR  +      D     T+EV    G+   +   R+++ A+++A  ++
Sbjct: 169 WAHAKFGVAPKYRTDDRSGPDHDPRFTVTVEV---DGIAPETGVDRSKRGAEQVAAMKL 224



>sp|Q10962|RNC_MYCTU Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|E70748|E70748 probable rnc protein -
           Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_23091 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248344_760307
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 11/14.>gb:BX842581_821017 Mycobacterium
           tuberculosis H37Rv complete genome; segment 10/13.
          Length = 240

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 47/154 (30%), Positives = 68/154 (44%), Gaps = 4/154 (2%)
 Frame = -3

Query: 881 LLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
           LL  ALTH SY     G  + +RLEFLGDAVL   +T   + ++P    G L +LR+  V
Sbjct: 20  LLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVV 79

Query: 707 NNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADI 528
           N    A                 A R        ++      +  G   K+S   +LAD 
Sbjct: 80  NTQALA---------------DVARRLCAEGLGVHVLLGRGEANTGGADKSS---ILADG 121

Query: 527 IESIAGAIYLDSGLR--TDIVFEKIRPVLEPMVT 432
           +ES+ GAIYL  G+    +++     P+L+   T
Sbjct: 122 MESLLGAIYLQHGMEKAREVILRLFGPLLDAAPT 155



>gb:CP000003_860397 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 230

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 64/247 (25%), Positives = 104/247 (42%), Gaps = 13/247 (5%)
 Frame = -3

Query: 935 VKRLES--DSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTR 774
           +K+LE    +  +  F D +LL  A TH SY            +RLEFLGDAVL   ++ 
Sbjct: 1   MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNERLEFLGDAVLQLIISE 60

Query: 773 HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
           + + +YP    G +++LRS  V                     S A  S    F   I+ 
Sbjct: 61  YLFAKYPKKTEGDMSKLRSMIVR------------------EESLAGFSRFCSFDAYIKL 102

Query: 593 SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
                  G   + +   +L D+ E+  GA+ LD G+  D V   ++ V+ P V  E    
Sbjct: 103 GKGEEKSGGRRRDT---ILGDLFEAFLGALLLDKGI--DAVRRFLKQVMIPQV--EKGNF 155

Query: 413 NPVKE----LTELCQKRKYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKT 255
             VK+    L E  Q +   + +  V+ + G A      + ++ NG V S     +++K 
Sbjct: 156 ERVKDYKTCLQEFLQTKGDVVIDYQVISEKGPAHAKQFEVSIVVNGAVLS-KGLGKSKKL 214

Query: 254 AKRLACE 234
           A++ A +
Sbjct: 215 AEQDAAK 221



>gb:AE014224_306044 Streptococcus agalactiae 2603V/R section 34 of
           100 of the complete genome.>gb:AE009948_936157
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 236

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 49/169 (28%), Positives = 72/169 (42%), Gaps = 4/169 (2%)
 Frame = -3

Query: 929 RLESDSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYD 762
           +LE D      F +  LL  A TH SY            +RLEFLGDAVL   ++++ + 
Sbjct: 15  KLEKD--YGIVFANQELLDTAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLISQYLFT 72

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           +YP    G L++LRS  V     A  S   G  +YI               K  E+S   
Sbjct: 73  KYPQKAEGDLSKLRSMIVREESLAGFSRLCGFDHYI------------KLGKGEEKSGGR 120

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV 435
           +            +L D+ E+  GA+ LD G+  ++V   +  V+ P V
Sbjct: 121 NR---------DTILGDLFEAFLGALLLDKGV--EVVHAFVNKVMIPHV 158



>gb:SAG766846_170272 Streptococcus agalactiae NEM316 complete
           genome, segment 4.
          Length = 228

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 49/169 (28%), Positives = 72/169 (42%), Gaps = 4/169 (2%)
 Frame = -3

Query: 929 RLESDSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYD 762
           +LE D      F +  LL  A TH SY            +RLEFLGDAVL   ++++ + 
Sbjct: 7   KLEKD--YGIVFANQELLDTAFTHTSYANEHRLLNISHNERLEFLGDAVLQLLISQYLFT 64

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           +YP    G L++LRS  V     A  S   G  +YI               K  E+S   
Sbjct: 65  KYPQKAEGDLSKLRSMIVREESLAGFSRLCGFDHYI------------KLGKGEEKSGGR 112

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMV 435
           +            +L D+ E+  GA+ LD G+  ++V   +  V+ P V
Sbjct: 113 NR---------DTILGDLFEAFLGALLLDKGV--EVVHAFVNKVMIPHV 150



>gb:CR382134_1667178 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 540

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 44/182 (24%), Positives = 81/182 (44%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGD+VL+  VT   ++++P    G L+++RS  VNN   A  S+  G        
Sbjct: 220 ERLEFLGDSVLNNLVTVIIFNKFPEASEGELSKIRSLLVNNVTLAEFSILYGF------- 272

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFE 465
              LRS+I D                +LK S   + ADI E+  GA+ ++       + +
Sbjct: 273 DKKLRSNIND---------------QILKDSTQKIYADIFEAYIGALAIERKFDYTEIQQ 317

Query: 464 KIRPVLEPMVTPESLRLNPVKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMANGGVRS 285
            +  +++  +   + +++  +E+ +  +   Y +      H   E   T +  +N  V  
Sbjct: 318 WLTTLMDSRLNKHARQISSTEEINKDAKSELYSLIGTAAFHPQYEVVKTGDGSSNPFVIR 377

Query: 284 CS 279
           C+
Sbjct: 378 CT 379



>gb:BX897699_827136 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 235

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 42/158 (26%), Positives = 67/158 (42%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           + L  + F+D   L +ALTH S       +Y+RLEFLGD VL   +    Y  +P    G
Sbjct: 10  EKLTGHYFKDKKKLKKALTHSSVQGSEQGNYERLEFLGDRVLGLLIAEMLYQLFPQASEG 69

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L+   +  VN    A         +  L     +   +   +KN++    ++ +     
Sbjct: 70  ELSVRLNSLVNAQTCA---------DIALEMELPVMIHVGFEMKNLKGRRLTNMY----- 115

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLE 444
                  AD+IE++   IYLD GL      E +RP ++
Sbjct: 116 -------ADVIEALIAVIYLDGGL------ESVRPFIQ 140



>gb:CP000027_80002 Dehalococcoides ethenogenes 195, complete genome.
          Length = 237

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 64/229 (27%), Positives = 97/229 (42%), Gaps = 16/229 (6%)
 Frame = -3

Query: 923 ESDSLLNYTFRDPSLLVEALTHGSYIP----HGTQSYQRLEFLGDAVLDYAVTRHFYDQY 756
           E +  L   F + SLL +AL H S++     H + S +R+EFLGDAVL        Y  +
Sbjct: 6   ELEKSLGVKFENLSLLEQALIHTSWVNENPNHLSGSNERMEFLGDAVLGVIFADRLYHDF 65

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
           P +  G LT  RS  V        ++   L  Y+             ++   E +S    
Sbjct: 66  PDIQEGDLTRFRSLLVRRESLVRVALGINLGKYL-------------YLGRGEDAS---- 108

Query: 575 FGWVLKTSF-PWVLADIIESIAGAIYLDSGL--RTDIVFEKIRPVLEPMVTPESLRLNPV 405
                K  F P  LA   E++  AIYLD G+    +++F   +  +E + T  S  ++  
Sbjct: 109 -----KGRFKPANLAGAFEAVLAAIYLDKGIDATREVIFRLFKTEMERVQTLSS-NIDYK 162

Query: 404 KELTELCQKR-----KYRMKE---PVVVHK-DGEACTTIEVMANGGVRS 285
             L EL Q +     +YR+ +   P   H    E  T  +V+A G  RS
Sbjct: 163 SRLQELVQAQFQLTPRYRIIDFSGPEHNHLFIAEVYTEDKVLAEGSGRS 211



>sp|P47607|RNC_MYCGE Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|F64240|F64240 ribonuclease III - Mycoplasma
           genitalium>gb:U39718_205786 Mycoplasma genitalium G-37
           section 40 of 51 of the complete
           genome.>gb:L43967_1100938 Mycoplasma genitalium G-37,
           complete genome.
          Length = 262

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 3/133 (2%)
 Frame = -3

Query: 872 EALTHGSYIPHG---TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNN 702
           +A  H SYI      ++SY RLEFLGDA++D+ V +  ++ YP    G LT  + E V  
Sbjct: 37  KAFIHASYINEHEDVSESYDRLEFLGDALIDFVVAKKLFELYPKYNEGLLTRTKIEIVKG 96

Query: 701 ACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIE 522
                             +   +   + DFVK    +  +              + D++E
Sbjct: 97  ENL---------------NRIGMELKLGDFVKLSNGAELTEN-----------TVGDVLE 130

Query: 521 SIAGAIYLDSGLR 483
           ++ GAIY D G++
Sbjct: 131 ALVGAIYEDMGMK 143



>gb:BX897700_828667 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 235

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 40/146 (27%), Positives = 66/146 (45%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           + L  + F+D   L +ALTH S       +Y+RLEFLGD VL   +    Y  +P    G
Sbjct: 10  ERLTEHHFKDEERLKKALTHSSVQDSEQGNYERLEFLGDRVLGLLIAEMLYKLFPQASEG 69

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L+   +  VN    A  +++ GL + ++H    +R+     + N+              
Sbjct: 70  ELSVRLNGLVNAQTCADIALEMGLPD-MIHVGFEMRNLKGRRLTNMH------------- 115

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRT 480
                  AD+IE++   +YLD GL++
Sbjct: 116 -------ADVIEALIAVMYLDGGLKS 134



>sp|Q9A105|RNC_STRPY Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:AE006510_219651 Streptococcus pyogenes M1 GAS,
           section 39 of 167 of the complete
           genome.>gb:AE009995_258174 Streptococcus pyogenes strain
           MGAS8232, section 43 of 173 of the complete
           genome.>gb:AE014144_303852 Streptococcus pyogenes
           MGAS315, section 9 of 37 of the complete
           genome.>gb:BA000034_714402 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:AE009949_904556 Streptococcus
           pyogenes strain MGAS8232, complete
           genome.>gb:AE014074_927031 Streptococcus pyogenes
           MGAS315, complete genome.>gb:AE004092_1105497
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 230

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 64/247 (25%), Positives = 103/247 (41%), Gaps = 13/247 (5%)
 Frame = -3

Query: 935 VKRLES--DSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTR 774
           +K+LE    +  +  F D +LL  A TH SY            +RLEFLGDAVL   ++ 
Sbjct: 1   MKQLEELLSTSFDIQFNDLTLLETAFTHTSYANEHRLLNVSHNERLEFLGDAVLQLIISE 60

Query: 773 HFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQ 594
           + + +YP    G +++LRS  V                     S A  S    F   I+ 
Sbjct: 61  YLFAKYPKKTEGDMSKLRSMIVR------------------EESLAGFSRFCSFDAYIKL 102

Query: 593 SSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRL 414
                  G   + +   +L D+ E+  GA+ LD G+  D V   ++ V+ P V  E    
Sbjct: 103 GKGEEKSGGRRRDT---ILGDLFEAFLGALLLDKGI--DAVRRFLKQVMIPQV--EKGNF 155

Query: 413 NPVKE----LTELCQKRKYRMKEPVVVHKDGEACT---TIEVMANGGVRSCSSSARNRKT 255
             VK+    L E  Q +     +  V+ + G A      + ++ NG V S     +++K 
Sbjct: 156 ERVKDYKTCLQEFLQTKGDVAIDYQVISEKGPAHAKQFEVSIVVNGAVLS-KGLGKSKKL 214

Query: 254 AKRLACE 234
           A++ A +
Sbjct: 215 AEQDAAK 221



>sp|Q8YG74|RNC_BRUME Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|AI3412|AI3412 ribonuclease III (EC 3.1.26.3)
           [imported] - Brucella melitensis (strain
           16M)>gb:AE009567_253205 Brucella melitensis 16M
           chromosome I, section 124 of 195 of the complete
           sequence.>gb:AE014291_308102 Brucella suis 1330
           chromosome I, complete sequence.>gb:AE008917_979117
           Brucella melitensis 16M chromosome I, complete sequence.
          Length = 245

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 43/161 (26%), Positives = 71/161 (44%), Gaps = 2/161 (1%)
 Frame = -3

Query: 962 PLNAEQMVNVKRLES--DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLD 789
           PL   +MV+  +  S  +    + F +   L  ALTH S       +Y+RLEFLGD VL 
Sbjct: 6   PLPEIKMVSANKTASILEERTGHRFLNLKRLERALTHSSVQAPARANYERLEFLGDRVLG 65

Query: 788 YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV 609
             V    ++ +P    G L+   +  VN    A  + + GL + ++H+ + ++S     +
Sbjct: 66  LTVAEMLFEAFPEASEGELSVRLNALVNAETCAAIADEIGLAD-LIHTGSDIKSLNDKRL 124

Query: 608 KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
            N+                     AD++E++   IYLD GL
Sbjct: 125 LNVR--------------------ADVVEALIATIYLDGGL 145



>gb:CP000023_875175 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_877087 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 237

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 44/153 (28%), Positives = 62/153 (40%), Gaps = 4/153 (2%)
 Frame = -3

Query: 932 KRLESDSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFY 765
           ++LE D      F    LL  A TH SY            +RLEFLGDA L   ++ + Y
Sbjct: 14  QKLEQD--FGIVFSQKDLLETAFTHTSYANEHRLLNISHNERLEFLGDAALQLVISVYLY 71

Query: 764 DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA 585
           ++YP    G ++++RS  V     A  +   G   YI               K  E+S  
Sbjct: 72  NRYPNKPEGEMSKMRSTIVREESLAGFTKACGFEQYI------------RLGKGEEKSGG 119

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                         +L D+ E+  GA+YLD GL
Sbjct: 120 RER---------ATILGDLWEAFLGALYLDQGL 143



>gb:BA000026_693716 Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 244

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 42/133 (31%), Positives = 60/133 (45%), Gaps = 2/133 (1%)
 Frame = -3

Query: 881 LLVEALTHGSYIPHGT--QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
           L VEALTH SY        +YQRLEFLGDAV+   ++  F  +   L    +TE+R   V
Sbjct: 31  LYVEALTHNSYNNEKKVGYTYQRLEFLGDAVISKLIS-EFLFKNKSLDEQKMTEIRKNLV 89

Query: 707 NNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADI 528
           N+  +  +S + GL +Y                            G  L+     + AD+
Sbjct: 90  NSEIFKKASEELGLLDYAFIGK-----------------------GINLENDTKKIKADL 126

Query: 527 IESIAGAIYLDSG 489
            E+ AGAI++D G
Sbjct: 127 FEAFAGAIFIDKG 139



>pir|S77771|S77771 probable ribonuclease III (EC 3.1.26.3) -
           Mycoplasma capricolum>gb:MC235_143053 M.capricolum DNA
           for CONTIG MC235.
          Length = 84

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 31/68 (45%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
 Frame = -3

Query: 905 NYTFRDPSLLVEALTHGSYIPHGT--QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCL 732
           N    D  +  EALTH SY        SYQRLEFLGDA+L   V++  +  Y  L  G L
Sbjct: 11  NIKINDQQIYKEALTHNSYANERKLKYSYQRLEFLGDAILQMYVSKFLFFHYSKLGEGEL 70

Query: 731 TELRSESV 708
           T LRS +V
Sbjct: 71  TRLRSSTV 78



>gb:AY653733_2371193 Mimivirus, complete genome.
          Length = 538

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 53/228 (23%), Positives = 94/228 (41%), Gaps = 11/228 (4%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYI-PHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSE 714
           D  +  EA+ H S I     ++Y+RLE+LGDA+    +T +FY +Y     G LT LR  
Sbjct: 42  DMHIFEEAMLHVSTIYEESDKTYERLEYLGDAIFHMIITEYFYHRYNEENEGFLTRLRIR 101

Query: 713 SVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLA 534
                     S   GL+N++     +L   I                           L 
Sbjct: 102 IERGDSMVELSKNLGLNNFVQIYGISLNDHI---------------------------LE 134

Query: 533 DIIESIAGAIYLDSGLRTDIVF-----EKIRPVLEPMVTPESLRLNPVKELTELCQKRKY 369
           DI ES  GA YL+ G++   +F     EK + + E +   ++ +   ++   ++      
Sbjct: 135 DIFESFIGAFYLNFGMKYTRLFIIKLIEKHKNLSELIAYDDNYKDLLLRYFHQMKWGHPK 194

Query: 368 RMKEPVVVHKDGEACTTIEVMANG-----GVRSCSSSARNRKTAKRLA 240
            ++E V+  K+ +    I  + N      G+ S S+  ++ + A ++A
Sbjct: 195 YIEEIVIDPKNNQRNKFISKVKNPFDKVIGIGSASTKKKSEQLASQMA 242



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 55/242 (22%), Positives = 100/242 (41%), Gaps = 21/242 (8%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPHGT-----------------QSYQRLEFLGDAVLDYAVTRHFYD 762
           D  L  EA+TH SY+                     +S +RL+FLGDAV+ + +  + ++
Sbjct: 312 DLKLFYEAMTHRSYLIRKNLPNRDVPKSKSIVRLQKKSNERLQFLGDAVIHFIIGEYLFN 371

Query: 761 QYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSAS 582
           +Y     G LT LR +  N+      + ++ + +Y+L S            +NIE     
Sbjct: 372 KYADSGEGYLTRLRCKLENSESLFFLAKQSDISSYLLIS------------QNIEVLHGR 419

Query: 581 STFGWVLKTSFPWVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNP 408
                        ++   +E+  GA+YL+ GL T    + E +R  L+     E+   N 
Sbjct: 420 ENVN---------IIGGGLEAFVGALYLNIGLGTVKQFLLEIMRIELDINQIAEN-ETNY 469

Query: 407 VKELTELCQKRKYRMKEPVVVHKDGEACTTIEVMA--NGGVRSCSSSARNRKTAKRLACE 234
              + +L  K K+      ++ ++G     I  M    G        A ++K A+++A +
Sbjct: 470 KDLILQLYNKNKWGHPVYKILKEEGPDHCKIFTMGLYLGNKLMGIGKASSKKKAEQIASK 529

Query: 233 RM 228
           +M
Sbjct: 530 KM 531



>gb:AY051775_1290369 Drosophila melanogaster LD29995 full length cDNA.
          Length = 1071

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 61/218 (27%), Positives = 92/218 (42%), Gaps = 16/218 (7%)
 Frame = -3

Query: 1091 IADVTEALIGAFLSTAG-----EIAALSFLRW----LGLDIDFIDAPIVGNFPLNAEQMV 939
            +A+  EAL+GA L   G     E+   +  R     L +  +  + P+    PL     +
Sbjct: 651  MANCFEALMGALLLDGGIKVADEVFTDALFRQDEKLLSIWKNLPEHPLQEQEPLGDRSCI 710

Query: 938  NVKRL-----ESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ-SYQRLEFLGDAVLDYAV 780
            +  R+     + +  +   F+   LL  A T  S    H T  S QRLEFLGD VL    
Sbjct: 711  DSYRVLKELTKFEDSIGIKFKHIRLLARAFTDRSIGFTHLTLGSNQRLEFLGDTVLQLIC 770

Query: 779  TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI 600
            + + Y  +P    G L+ LRS  VNN   A+     G+  Y ++++       AD     
Sbjct: 771  SEYLYRHFPEHHEGHLSLLRSSLVNNRTQAVVCDDLGMPKYAVYANPK-----AD----- 820

Query: 599  EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                        LKT      AD++E+  GA+Y+D GL
Sbjct: 821  ------------LKTK---DRADLLEAFLGALYVDKGL 843



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 6/132 (4%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDAV+++  + H +  +P L  G L   R+  V N   AL + K  L  ++L++
Sbjct: 577 ERLEFLGDAVVEFLSSIHLFFMFPELEEGGLATYRAAIVQNQHLALLAKKLQLEEFMLYA 636

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLR------ 483
                   +D    +E   A               +A+  E++ GA+ LD G++      
Sbjct: 637 HG------SDLCHELELRHA---------------MANCFEALMGALLLDGGIKVADEVF 675

Query: 482 TDIVFEKIRPVL 447
           TD +F +   +L
Sbjct: 676 TDALFRQDEKLL 687



>gb:AE013599_1130539 Drosophila melanogaster chromosome 2R, complete
            sequence.>gb:AE003839_1227169 Drosophila melanogaster
            chromosome 2R, section 11 of 74 of the complete
            sequence.>gb:AF116572_1242532 Drosophila melanogaster
            ribonuclease (drosha) mRNA, complete cds.
          Length = 1327

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 61/218 (27%), Positives = 92/218 (42%), Gaps = 16/218 (7%)
 Frame = -3

Query: 1091 IADVTEALIGAFLSTAG-----EIAALSFLRW----LGLDIDFIDAPIVGNFPLNAEQMV 939
            +A+  EAL+GA L   G     E+   +  R     L +  +  + P+    PL     +
Sbjct: 907  MANCFEALMGALLLDGGIKVADEVFTDALFRQDEKLLSIWKNLPEHPLQEQEPLGDRSCI 966

Query: 938  NVKRL-----ESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ-SYQRLEFLGDAVLDYAV 780
            +  R+     + +  +   F+   LL  A T  S    H T  S QRLEFLGD VL    
Sbjct: 967  DSYRVLKELTKFEDSIGIKFKHIRLLARAFTDRSIGFTHLTLGSNQRLEFLGDTVLQLIC 1026

Query: 779  TRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNI 600
            + + Y  +P    G L+ LRS  VNN   A+     G+  Y ++++       AD     
Sbjct: 1027 SEYLYRHFPEHHEGHLSLLRSSLVNNRTQAVVCDDLGMPKYAVYANPK-----AD----- 1076

Query: 599  EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                        LKT      AD++E+  GA+Y+D GL
Sbjct: 1077 ------------LKTK---DRADLLEAFLGALYVDKGL 1099



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 6/132 (4%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLEFLGDAV+++  + H +  +P L  G L   R+  V N   AL + K  L  ++L++
Sbjct: 833  ERLEFLGDAVVEFLSSIHLFFMFPELEEGGLATYRAAIVQNQHLALLAKKLQLEEFMLYA 892

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLR------ 483
                    +D    +E   A               +A+  E++ GA+ LD G++      
Sbjct: 893  HG------SDLCHELELRHA---------------MANCFEALMGALLLDGGIKVADEVF 931

Query: 482  TDIVFEKIRPVL 447
            TD +F +   +L
Sbjct: 932  TDALFRQDEKLL 943



>gb:BX251410_764403 Tropheryma whipplei TW08/27, complete genome;
           segment 1/3.
          Length = 215

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 49/166 (29%), Positives = 74/166 (44%), Gaps = 8/166 (4%)
 Frame = -3

Query: 887 PSLLVEALTHGSY-IPHGT-QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSE 714
           P LL  A  H S+   +G  Q+ +RLEFLGDAVL   V+ + ++  P    G L+  RS 
Sbjct: 10  PGLLRTAFVHKSFSFENGACQNNERLEFLGDAVLGLVVSHYLFETCPEYTEGQLSAARSY 69

Query: 713 SVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLA 534
            V+    A  + +  L  ++L                          G + KTS   +LA
Sbjct: 70  IVSGTSIAQIAKELNLGQFML------------------LGKGEKLAGGMDKTS---LLA 108

Query: 533 DIIESIAGAIYLDSGLRT------DIVFEKIRPVLEPMVTPESLRL 414
           D++ES+ GA+ +D G  +       +V EK+R V E  V     +L
Sbjct: 109 DLLESLIGAVMVDQGFESARDFVLALVGEKLRQVGEFSVDDPKTKL 154



>gb:AP006841_570744 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 290

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 59/236 (25%), Positives = 101/236 (42%), Gaps = 10/236 (4%)
 Frame = -3

Query: 911 LLNYTFRDPSLLVEALTHGSYIPHGTQ----SYQRLEFLGDAVLDYAVTRHFYDQYPGLF 744
           +L +  R+  L  +AL H S      +    + +RLEFLGDA+LD  V    Y  + G  
Sbjct: 26  ILGFYPRNIRLYEQALLHKSTAVRSEKGRPLNNERLEFLGDAILDAIVGDIVYQHFEGKR 85

Query: 743 PGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWV 564
            G LT  RS+ V        +V+ GL   I +S+               +SS+ +++   
Sbjct: 86  EGFLTNTRSKIVQRETLNKLAVEIGLDKLIKYST---------------RSSSHNSY--- 127

Query: 563 LKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESL---RLNPVKELT 393
                  +  +  E+  GAIYLD G      F + R ++EP +  + L    +N   +L 
Sbjct: 128 -------MYGNAFEAFIGAIYLDRGYECCKQFME-RRIIEPYIDLDKLSRKEVNFKSKLI 179

Query: 392 ELCQKRKYRMKEPVV---VHKDGEACTTIEVMANGGVRSCSSSARNRKTAKRLACE 234
           E  QK K  +   ++   + K+       EV    G+   S +  ++K +++ A +
Sbjct: 180 EWSQKNKMEVSFELIEQSLDKENNPVFQTEVRIE-GILGGSGTGYSKKESQQNAAQ 234



>gb:AE017308_438034 Mycoplasma mobile 163K complete genome.
          Length = 246

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 52/215 (24%), Positives = 92/215 (42%), Gaps = 9/215 (4%)
 Frame = -3

Query: 914 SLLNYTFRDPSLLVEALTHGSYIPH--GTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           +L N  F+D    ++ALTH +Y       +SY  LEF+GDA+L    +   +  +  +  
Sbjct: 15  TLNNIIFKDIKYYIQALTHKTYANEHANIESYDILEFIGDAILQMKSSIFIFQHFQNITE 74

Query: 740 GCLTELRSESVNNACYALSSVKAGLHNYILHS--STALRSSIADFVKNIEQSSASSTFGW 567
           G  + +R+++V ++  +  S K GL   +L S  S  LR ++                  
Sbjct: 75  GEASLIRAKNVCSSGLSELSKKLGLSKLLLISKGSEHLRENVK----------------- 117

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLR--LNPVKELT 393
                   + AD+ ES   AIYLD G   + + E ++ +  P ++  +L    +P     
Sbjct: 118 --------INADLFESFVAAIYLDLG--DEKLEEFLKEIFYPYISTTNLESIKDPKSSFQ 167

Query: 392 ELCQKRKYRMKEPVVVHKDGEACTTI---EVMANG 297
           E  Q     + E  +   + E  + +   E+M NG
Sbjct: 168 EYIQSYSNEIIEYKITQLENELRSELFKAELMHNG 202



>gb:AE016852_349086 Tropheryma whipplei str. Twist, section 3 of 3
           of the complete genome.>gb:AE014184_1029282 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 223

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 49/166 (29%), Positives = 74/166 (44%), Gaps = 8/166 (4%)
 Frame = -3

Query: 887 PSLLVEALTHGSY-IPHGT-QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSE 714
           P LL  A  H S+   +G  Q+ +RLEFLGDAVL   V+ + ++  P    G L+  RS 
Sbjct: 18  PGLLRTAFVHKSFSFENGACQNNERLEFLGDAVLGLVVSHYLFETCPEYTEGQLSAARSY 77

Query: 713 SVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLA 534
            V+    A  + +  L  ++L                          G + KTS   +LA
Sbjct: 78  IVSGTSIAQIAKELNLGQFML------------------LGKGEKLAGGMDKTS---LLA 116

Query: 533 DIIESIAGAIYLDSGLRT------DIVFEKIRPVLEPMVTPESLRL 414
           D++ES+ GA+ +D G  +       +V EK+R V E  V     +L
Sbjct: 117 DLLESLIGAVMVDQGFESARDFVLALVGEKLRQVGEFSVDDPKTKL 162



>sp|Q9ZLH2|RNC_HELPJ Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|E71911|E71911 ribonuclease III - Helicobacter
           pylori (strain J99)>gb:AE001492_35598 Helicobacter
           pylori, strain J99 section 53 of 132 of the complete
           genome.>gb:AE001439_884368 Helicobacter pylori, strain
           J99 complete genome.
          Length = 239

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 45/172 (26%), Positives = 79/172 (45%)
 Frame = -3

Query: 926 LESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGL 747
           L  +  L Y+F+D  LL +ALTH S       + +RLEFLGDAVL   +    Y ++   
Sbjct: 19  LTLEKALGYSFKDKRLLEQALTHKSC--KLALNNERLEFLGDAVLGLVIGELLYHKFYQY 76

Query: 746 FPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGW 567
             G L++LR+  V+   +   +    L +Y+  SS+       +  K  E+         
Sbjct: 77  DEGKLSKLRASIVSAHGFTKLAKAIALQDYLRVSSS------EEISKGREK--------- 121

Query: 566 VLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN 411
                 P +L+   E++   +YL++GL       K+R +++ ++     RL+
Sbjct: 122 ------PSILSSAFEALMAGVYLEAGL------AKVRKIIQNLLNRAYKRLD 161



>pir|F64602|F64602 ribonuclease III - Helicobacter pylori (strain
           26695)>gb:AE000579_24835 Helicobacter pylori 26695
           section 57 of 134 of the complete
           genome.>gb:AE000511_880274 Helicobacter pylori 26695
           complete genome.
          Length = 240

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 43/169 (25%), Positives = 78/169 (46%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           +  L Y+F+D  LL +ALTH S       + +RLEFLGDAVL   +    Y ++     G
Sbjct: 23  EKALGYSFKDKRLLEQALTHKSC--KLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEG 80

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L++LR+  V+   +   +    L +Y       LR S ++ + N  +            
Sbjct: 81  KLSKLRASIVSAHGFTKLAKAIALQDY-------LRVSSSEEISNGREK----------- 122

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN 411
              P +L+   E++   +YL++GL       K++ +++ ++     RL+
Sbjct: 123 ---PSILSSAFEALMAGVYLEAGL------AKVQKIMQNLLNRAYKRLD 162



>sp|P56118|RNC_HELPY Ribonuclease III (EC 3.1.26.3) (RNase III).
          Length = 239

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 43/169 (25%), Positives = 78/169 (46%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           +  L Y+F+D  LL +ALTH S       + +RLEFLGDAVL   +    Y ++     G
Sbjct: 22  EKALGYSFKDKRLLEQALTHKSC--KLALNNERLEFLGDAVLGLVIGELLYHKFYQYDEG 79

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            L++LR+  V+   +   +    L +Y       LR S ++ + N  +            
Sbjct: 80  KLSKLRASIVSAHGFTKLAKAIALQDY-------LRVSSSEEISNGREK----------- 121

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLN 411
              P +L+   E++   +YL++GL       K++ +++ ++     RL+
Sbjct: 122 ---PSILSSAFEALMAGVYLEAGL------AKVQKIMQNLLNRAYKRLD 161



>gb:AP006628_567043 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 238

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 51/191 (26%), Positives = 86/191 (45%), Gaps = 4/191 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGT---QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           LN T ++ +L  +ALTH SY        +  +RLEFLGDA++   +  + Y Q      G
Sbjct: 11  LNITPQNLTLYKQALTHSSYSNEQNPPQEDNERLEFLGDAIVGLLMADYLYSQSKE-DEG 69

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            +T+ R+++V      + +    L NY+L         +    KN + ++ S        
Sbjct: 70  IMTKKRAQAVCERSLTIYAHNIELQNYLL---------LGKGEKNKDFNAKS-------- 112

Query: 557 TSFPWVLADIIESIAGAIYLDSG-LRTDIVFEKIRPVLEPMVTPESLRLNPVKELTELCQ 381
                ++AD  E++ GAIYLD G L    VF  I   + P +      ++   +L E+ Q
Sbjct: 113 -----IIADTFEALFGAIYLDLGYLTAKKVFHNI---VLPHLAKTIYIIDFKTQLQEIVQ 164

Query: 380 KRKYRMKEPVV 348
             K  ++  +V
Sbjct: 165 SEKKTIQYKIV 175



>gb:AF533231_519871 Western X phytoplasma tRNA-Ser gene, complete
           sequence; immunodominant protein (idpA), putative DNA
           polymerase III (dnaX), conserved hypothetical protein,
           putative DNA-directed RNA polymerase delta subunit
           (rpoE), putative phosphatidylserine synthase (pssA),
           putative phosphatidylserine decarboxylase (psd),
           putative CTP synthase (ctrA), hypothetical protein,
           putative chromosome replication initiation protein
           (dnaD), putative ribonuclease III (rnc), putative fatty
           acid/phospholipid biosynthesis (plsX), putative
           ATP-dependent DNA helicase (recG), conserved
           hypothetical GTP-binding protein, putative valyl-tRNA
           synthetase (valS), putative lysophospholipase (pldB),
           putative cation-transporting ATPase (pacL), and putative
           peptidyl-tRNA hydrolase (pth) genes, complete cds; 16S
           ribosomal RNA gene, complete sequence; tRNA-Ile gene,
           complete sequence; and 23S ribosomal RNA gene, partial
           sequence.
          Length = 228

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 44/195 (22%), Positives = 83/195 (42%), Gaps = 5/195 (2%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHGTQSY---QRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           LN   ++ SL + ALTH SY       +   +RLEFLGD+V+++ +  + Y        G
Sbjct: 10  LNIKPKNISLFINALTHSSYANENNAKHNNNERLEFLGDSVINFFMASYLYKNNKD-DEG 68

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            +T+ R+++V      + + +  L  YI       + S+ ++                  
Sbjct: 69  VMTKKRAQAVCVDSLLIYAEEIQLKKYIYLGKGEKKRSVHNYS----------------- 111

Query: 557 TSFPWVLADIIESIAGAIYLDSGLR--TDIVFEKIRPVLEPMVTPESLRLNPVKELTELC 384
                ++ D  E++ GAIYLD G +      ++ + P L  ++     +     +L EL 
Sbjct: 112 -----IVTDAFEALFGAIYLDLGFKQAQKTFYQVVLPCLNKIINIIDFK----TQLQELV 162

Query: 383 QKRKYRMKEPVVVHK 339
           Q +K  +   ++  K
Sbjct: 163 QTKKQNITYKIISEK 177



>gb:AE016969_369762 Mycoplasma gallisepticum strain R section 3 of 4
           of the complete genome.>gb:AE015450_1034411 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 669

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 46/165 (27%), Positives = 70/165 (42%), Gaps = 19/165 (11%)
 Frame = -3

Query: 926 LESDSLL---NYTFRDPSLLV--------------EALTHGSYIP--HGTQSYQRLEFLG 804
           L+ D L+   NY  +D  LL+              EALTH SY    H   +YQRLEFLG
Sbjct: 430 LDDDKLIVYANYEAKDLELLLKKFKVVTNNIGLYEEALTHNSYANEMHLKYNYQRLEFLG 489

Query: 803 DAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSS 624
           DA+++  V  + ++ +     G +T+ R + + +     ++ +  L NYI          
Sbjct: 490 DAIINKIVAEYLFN-HSDSSEGEMTKDRIKIIQSNTLIKAATQLELINYIRVGE------ 542

Query: 623 IADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSG 489
                            G  +    P +L DI E+  GA+YLD G
Sbjct: 543 -----------------GLKIAPLSPKILEDIFEAFIGAMYLDQG 570



>pir|C90532|C90532 ribonuclease III (rnase III) [imported] -
           Mycoplasma pulmonis (strain UAB CTIP)>gb:MPULM01_149676
           Mycoplasma pulmonis (strain UAB CTIP) complete genome;
           segment 1/3.
          Length = 241

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 37/138 (26%), Positives = 65/138 (47%), Gaps = 3/138 (2%)
 Frame = -3

Query: 893 RDPSLLVEALTHGSYIP-HGTQSYQRLEFLGDAVLDYAVTRHFYDQYPG--LFPGCLTEL 723
           ++ ++  +A TH ++   +  +SY+ LEFLGDA+L   V+ + +       + PG  T +
Sbjct: 35  KEKNIFFQAFTHTTFHNLYKAKSYEMLEFLGDAILQKNVSEYIFKNTESNKINPGTATLI 94

Query: 722 RSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPW 543
           RS+ VN  C +  + +  L  ++L     L     + VKN +                  
Sbjct: 95  RSKLVNKTCLSNLAKELKLDKFLL-----LPKGQEELVKNEK------------------ 131

Query: 542 VLADIIESIAGAIYLDSG 489
           VL+D+ ES+  AIY+  G
Sbjct: 132 VLSDLFESLCAAIYITKG 149



>sp|Q8NNV6|RNC_CORGL Ribonuclease III (EC 3.1.26.3) (RNase
           III).>gb:BA000036_719801 Corynebacterium glutamicum ATCC
           13032 DNA, complete genome.>gb:BX927154_833604
           Corynebacterium glutamicum ATCC 13032, IS fingerprint
           type 4-5, complete genome; segment 7/10.
          Length = 247

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 43/136 (31%), Positives = 62/136 (45%), Gaps = 2/136 (1%)
 Frame = -3

Query: 881 LLVEALTHGSYIPHGTQ--SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESV 708
           LLV ALTH S+        + +RLEFLGDAVL  +V    Y+QYP      ++++R+  V
Sbjct: 38  LLVLALTHRSFANENGMLPNNERLEFLGDAVLGLSVANKLYEQYPSSPESDVSKMRASIV 97

Query: 707 NNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADI 528
           +    A  + +  L N+IL     L +         E  S  S            +LAD 
Sbjct: 98  SRYGLADIAREIDLGNHILLGKGELLT---------EGRSKDS------------ILADT 136

Query: 527 IESIAGAIYLDSGLRT 480
            E++ GAI+   G  T
Sbjct: 137 TEALFGAIFRQHGFET 152



>sp|Q9PQT8|RNC_UREPA Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|F82919|F82919 ribonuclease III UU205
           [imported] - Ureaplasma urealyticum>gb:AE002120_43075
           Ureaplasma parvum serovar 3 str. ATCC 700970 section 21
           of 59 of the complete genome.>gb:AF222894_1114446
           Ureaplasma parvum serovar 3 str. ATCC 700970, complete
           genome.
          Length = 236

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 44/193 (22%), Positives = 87/193 (45%), Gaps = 11/193 (5%)
 Frame = -3

Query: 884 SLLVEALTHGSYIPHG--TQSYQRLEFLGDAVLDYAVTRHFY-------DQYPGLFPGCL 732
           S+ +EALTH SY      T++YQRLEFLGDA +++ ++   +       ++   L  G +
Sbjct: 21  SIYLEALTHKSYANEHKLTKNYQRLEFLGDACVEWVISNFIFNYKIKDNEKMRSLDEGEM 80

Query: 731 TELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTS 552
           T  RS  V +   + ++   GL ++++                +EQ  ++          
Sbjct: 81  TRARSNMVRSEILSYAAKDLGLTDFLM------------IGVGLEQDQSA---------R 119

Query: 551 FPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTP--ESLRLNPVKELTELCQK 378
              +  DI E+  GA+  D G++      K+  +LE  +       ++N  K+   + Q+
Sbjct: 120 MEKIYEDIFEAFIGAVAQDQGIK------KVSLILEKTLIKYFREGQINYQKDYKTIFQE 173

Query: 377 RKYRMKEPVVVHK 339
           +  R+ +  +++K
Sbjct: 174 QAQRINKKPIMYK 186



>gb:BC054003_1985132 Homo sapiens nuclear RNase III Drosha, mRNA (cDNA
            clone MGC:61568 IMAGE:6148714), complete cds.
          Length = 1192

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 54/182 (29%), Positives = 82/182 (45%), Gaps = 21/182 (11%)
 Frame = -3

Query: 1130 LYSRGR---RKMD-NETIADVTEALIGA-FLSTAGEIAALSFLRWLGLDIDFIDAPIVGN 966
            LY+ G    R+ D    +A+  EALIGA +L  + E A   F R L  D D  +  +  N
Sbjct: 986  LYAHGPDLCRESDLRHAMANCFEALIGAVYLEGSLEEAKQLFGRLLFNDPDLREVWL--N 1043

Query: 965  FPLNAEQM--------------VNVKRLESDSLLNYTFRDPSLLVEALTHGSY-IPHGTQ 831
            +PL+  Q+              V  K  E +  +   F    LL  A T  +    H T 
Sbjct: 1044 YPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFTLRTVGFNHLTL 1103

Query: 830  SY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYI 654
             + QR+EFLGD+++    T + +  +P    G LT LRS  VNN   A  + + G+  + 
Sbjct: 1104 GHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQVWS 1163

Query: 653  LH 648
            ++
Sbjct: 1164 IY 1165



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 31/113 (27%), Positives = 52/113 (46%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLEFLGDAV+++  + H Y  +P L  G L   R+  V N   A+ + K  L  ++L++
Sbjct: 929  ERLEFLGDAVVEFLTSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYA 988

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGL 486
                     D  +  +   A               +A+  E++ GA+YL+  L
Sbjct: 989  HGP------DLCRESDLRHA---------------MANCFEALIGAVYLEGSL 1020



>sp|Q9CHD0|RNC_LACLA Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|B86725|B86725 ribonuclease III (EC 3.1.26.3)
           [imported] - Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006313_217704 Lactococcus lactis subsp.
           lactis IL1403 section 75 of 218 of the complete
           genome.>gb:AE005176_1094777 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 231

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 55/245 (22%), Positives = 98/245 (40%), Gaps = 12/245 (4%)
 Frame = -3

Query: 932 KRLESDSLLNYTFRDPSLLVEALTHGSYIPHGT----QSYQRLEFLGDAVLDYAVTRHFY 765
           K+L++D  L   F D  LL  A TH S+          + +RLEFLGD  L   ++ + Y
Sbjct: 6   KKLKNDYGL--VFNDEDLLKTAFTHSSFTNEERLPKIANNERLEFLGDVALSLVISDYLY 63

Query: 764 DQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSA 585
             YP    G L+++RS  V     A  S   G   ++       +    D    +E    
Sbjct: 64  RTYPEKLEGELSKMRSSIVRTESLANFSRSCGFGEFLRLGHGEEKMGGRDRETTLE---- 119

Query: 584 SSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKIRPVLEPMVTPESLRLNPV 405
                            ++ E+  GA+++D G+      +++R  ++ +V P     + V
Sbjct: 120 -----------------NLFEAFLGALFIDQGM------DEVRKFIQHVVIPHVKNDDYV 156

Query: 404 K------ELTELCQKRKYRMKEPVVVHKDGEA--CTTIEVMANGGVRSCSSSARNRKTAK 249
           K      EL E+ Q          ++ ++G A   + +  + N G        +++K A+
Sbjct: 157 KVIDYKTELQEVLQIGGETTISYKILKEEGPAHDRSFVAAVFNNGKELGRGLGKSKKVAE 216

Query: 248 RLACE 234
           + A E
Sbjct: 217 QKAAE 221



>gb:AE017249_416073 Treponema denticola ATCC 35405, section 4 of 10
           of the complete genome.>gb:AE017226_1069669 Treponema
           denticola ATCC 35405, complete genome.
          Length = 246

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 51/204 (25%), Positives = 81/204 (39%), Gaps = 14/204 (6%)
 Frame = -3

Query: 926 LESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSY---QRLEFLGDAVLDYAVTRHFYDQY 756
           LE        F+D  LL  A  H S+       +   +RLEFLGD+VL      + Y  +
Sbjct: 17  LEFQKQAGLKFKDLRLLDLAFHHRSFSNEHNNFHANNERLEFLGDSVLGLVAASYLYKSF 76

Query: 755 PGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASST 576
                G L ++++ +V+    + ++ K  + NY++              +  E S     
Sbjct: 77  EDRPEGELAKIKASAVSEDALSKTASKLNISNYLVLG------------RGEEMSGGREK 124

Query: 575 FGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVF------EKIRPVLEPMVTPESLRL 414
                      +LAD +E++ GA Y+DSG +    F        I  VLE     +   L
Sbjct: 125 KA---------ILADALEAVIGAYYIDSGFKAAQKFVLRLLESTIHSVLEKKFISDYKSL 175

Query: 413 NPVKELTELCQKR-----KYRMKE 357
                L EL QK+     KY +K+
Sbjct: 176 -----LQELVQKKFKTVPKYELKK 194



>gb:AE015940_320373 Clostridium tetani E88, section 5 of 10 of the
           complete genome.>gb:AE015927_963162 Clostridium tetani
           E88, complete genome.
          Length = 235

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 5/178 (2%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSYIPHGT--QSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTEL 723
           F +  LL  ALTH SY       Q  +RLEFLGD+VL   +T + +  Y     G L++ 
Sbjct: 18  FENIKLLHIALTHSSYANEKKRIQYNERLEFLGDSVLQLVITEYLFMNYKDKSEGELSKK 77

Query: 722 RSESV-NNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFP 546
           R+  V  N+ +                S A    + +++K    S      G   + S  
Sbjct: 78  RALIVCENSLF----------------SIAKNLELGEYIK---MSKGEELTGGRERIS-- 116

Query: 545 WVLADIIESIAGAIYLDSGLRT--DIVFEKIRPVLEPMVTPESLRLNPVKELTELCQK 378
            +LAD +E++  +IYLD G+    + + +    ++E  +  E + L+   +L E+ QK
Sbjct: 117 -ILADAVEALIASIYLDKGIDVVREFILKNFYNIVEKAMKDEII-LDYKTKLQEIIQK 172



>sp|P75233|RNC_MYCPN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|S73623|S73623 ribonuclease III - Mycoplasma
           pneumoniae (strain ATCC 29342)>gb:AE000027_19162
           Mycoplasma pneumoniae M129 section 53 of 63 of the
           complete genome.>gb:U00089_1101585 Mycoplasma pneumoniae
           M129, complete genome.
          Length = 282

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 35/137 (25%), Positives = 55/137 (40%), Gaps = 8/137 (5%)
 Frame = -3

Query: 872 EALTHGSYIPHGTQ---SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNN 702
           +A  H SY+        SY RLEFLGDA++D+ V +  ++ YP    G LT  + E V  
Sbjct: 37  DAFVHSSYVNENEDARASYDRLEFLGDALIDFIVAKKLFELYPNYNEGMLTRTKIEIVKG 96

Query: 701 ACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK--TSFPW---VL 537
                                          +N+ +      FG  +K     P+   + 
Sbjct: 97  -------------------------------ENLNRIGKELNFGNFIKLGKGMPYTETLF 125

Query: 536 ADIIESIAGAIYLDSGL 486
            D++E++  AIY D G+
Sbjct: 126 GDVLEALVAAIYEDLGI 142



>gb:AF160248_1246101 Caenorhabditis elegans ribonuclease mRNA,
           partial cds.
          Length = 860

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/132 (28%), Positives = 58/132 (43%), Gaps = 5/132 (3%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLE+LGDAV++  V+ H Y      F G L   R+  V N   A  +    +   + +S
Sbjct: 465 ERLEYLGDAVVELIVSHHLYFMLTHHFEGGLATYRTALVQNRNLATLAKNCRIDEMLQYS 524

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLR-TDIVF 468
             A   ++A+                     F   LA+  E++  AIYLD GL   D++F
Sbjct: 525 HGADLINVAE---------------------FKHALANAFEAVMAAIYLDGGLAPCDVIF 563

Query: 467 EKI----RPVLE 444
            K     +PVL+
Sbjct: 564 SKAMYGHQPVLK 575



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 3/153 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG--TQSY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           L   F +  LL +A T  + IP+   T+ + QRLE+LGD+VL   V+   Y ++P    G
Sbjct: 614 LGIQFNNIRLLAKAFTRRN-IPNNDLTKGHNQRLEWLGDSVLQLIVSDFLYRRFPYHHEG 672

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            ++ LR+  V+N   A+     G   +++                    +   T    LK
Sbjct: 673 HMSLLRTSLVSNQTQAVVCDDLGFTEFVI-------------------KAPYKTPELKLK 713

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI 459
                  AD++E+  GA+Y+D G+     F +I
Sbjct: 714 DK-----ADLVEAFIGALYVDRGIEHCRAFIRI 741



>gb:PMJ001135_158866 Prochlorococcus marinus genomic region for
           RNase P RNA subunit and for Ribonuclease
           III.>gb:AE017166_396217 Prochlorococcus marinus subsp.
           marinus str. CCMP1375 section 6 of 6 of the complete
           genome.>gb:AE017126_1031886 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 249

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 30/88 (34%), Positives = 50/88 (56%)
 Frame = -3

Query: 881 LLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNN 702
           +L EALTH S+  + + +++RLEF GDAVL  A + +    +P L  G  + LR++ V++
Sbjct: 45  ILNEALTHTSF--NLSINHERLEFQGDAVLRLAASEYIQSHFPKLSVGDRSALRAQLVSD 102

Query: 701 ACYALSSVKAGLHNYILHSSTALRSSIA 618
              A    K G+   +L ++ AL+   A
Sbjct: 103 RWLAKVGYKIGIKTTMLIANKALKDEAA 130



>pir|T21419|T21419 hypothetical protein F26E4.13 - Caenorhabditis
           elegans
          Length = 412

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/132 (28%), Positives = 58/132 (43%), Gaps = 5/132 (3%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLE+LGDAV++  V+ H Y      F G L   R+  V N   A  +    +   + +S
Sbjct: 20  ERLEYLGDAVVELIVSHHLYFMLTHHFEGGLATYRTALVQNRNLATLAKNCRIDEMLQYS 79

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLR-TDIVF 468
             A   ++A+                     F   LA+  E++  AIYLD GL   D++F
Sbjct: 80  HGADLINVAE---------------------FKHALANAFEAVMAAIYLDGGLAPCDVIF 118

Query: 467 EKI----RPVLE 444
            K     +PVL+
Sbjct: 119 SKAMYGHQPVLK 130



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 3/153 (1%)
 Frame = -3

Query: 908 LNYTFRDPSLLVEALTHGSYIPHG--TQSY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
           L   F +  LL +A T  + IP+   T+ + QRLE+LGD+VL   V+   Y ++P    G
Sbjct: 169 LGIQFNNIRLLAKAFTRRN-IPNNDLTKGHNQRLEWLGDSVLQLIVSDFLYRRFPYHHEG 227

Query: 737 CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
            ++ LR+  V+N   A+     G   +++                    +   T    LK
Sbjct: 228 HMSLLRTSLVSNQTQAVVCDDLGFTEFVI-------------------KAPYKTPELKLK 268

Query: 557 TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI 459
                  AD++E+  GA+Y+D G+     F +I
Sbjct: 269 DK-----ADLVEAFIGALYVDRGIEHCRAFIRI 296



>sp|O01326|RNC_CAEEL Ribonuclease III (EC 3.1.26.3) (RNase
            III).>gb:CEF26E4_1363013 Caenorhabditis elegans cosmid
            F26E4, complete sequence.
          Length = 1086

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 38/132 (28%), Positives = 58/132 (43%), Gaps = 5/132 (3%)
 Frame = -3

Query: 824  QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
            +RLE+LGDAV++  V+ H Y      F G L   R+  V N   A  +    +   + +S
Sbjct: 691  ERLEYLGDAVVELIVSHHLYFMLTHHFEGGLATYRTALVQNRNLATLAKNCRIDEMLQYS 750

Query: 644  STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLR-TDIVF 468
              A   ++A+                     F   LA+  E++  AIYLD GL   D++F
Sbjct: 751  HGADLINVAE---------------------FKHALANAFEAVMAAIYLDGGLAPCDVIF 789

Query: 467  EKI----RPVLE 444
             K     +PVL+
Sbjct: 790  SKAMYGHQPVLK 801



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 41/153 (26%), Positives = 68/153 (44%), Gaps = 3/153 (1%)
 Frame = -3

Query: 908  LNYTFRDPSLLVEALTHGSYIPHG--TQSY-QRLEFLGDAVLDYAVTRHFYDQYPGLFPG 738
            L   F +  LL +A T  + IP+   T+ + QRLE+LGD+VL   V+   Y ++P    G
Sbjct: 840  LGIQFNNIRLLAKAFTRRN-IPNNDLTKGHNQRLEWLGDSVLQLIVSDFLYRRFPYHHEG 898

Query: 737  CLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLK 558
             ++ LR+  V+N   A+     G   +++                    +   T    LK
Sbjct: 899  HMSLLRTSLVSNQTQAVVCDDLGFTEFVI-------------------KAPYKTPELKLK 939

Query: 557  TSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI 459
                   AD++E+  GA+Y+D G+     F +I
Sbjct: 940  DK-----ADLVEAFIGALYVDRGIEHCRAFIRI 967



>gb:BX569689_775054 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 238

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 44/136 (32%), Positives = 65/136 (47%), Gaps = 3/136 (2%)
 Frame = -3

Query: 887 PSLLVE---ALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           PSLL+E   A+TH S     T   +RLEFLGDAVL  A T +    +PGL  G  + LR+
Sbjct: 24  PSLLLEVERAMTHTS--SGRTDHNERLEFLGDAVLRLAATLYLDRHHPGLTVGDSSSLRA 81

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
           + V++   A            L  +  + S +   VK +  ++A +T           + 
Sbjct: 82  QLVSDRWLA-----------ELGEAIDIESCLILGVKALGDAAARTT-----------IR 119

Query: 536 ADIIESIAGAIYLDSG 489
           AD  E++ GA+Y  SG
Sbjct: 120 ADATEALIGALYKVSG 135



>gb:BA000035_716759 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 255

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 42/136 (30%), Positives = 60/136 (44%), Gaps = 2/136 (1%)
 Frame = -3

Query: 890 DPSLLVEALTHGSYIPHGTQ--SYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRS 717
           D  LLV ALTH S+        + +RLEFLGDAVL  AV    Y+ YP      ++++R+
Sbjct: 43  DRDLLVLALTHRSFANENGMLPNNERLEFLGDAVLGLAVANRLYELYPSSPESDISKMRA 102

Query: 716 ESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVL 537
             V+    A  + +  L  +IL     L +         E  S  S            +L
Sbjct: 103 SIVSRYGLADIAREINLGEFILLGKGELLT---------EGRSKDS------------IL 141

Query: 536 ADIIESIAGAIYLDSG 489
           AD  E++ GAI+   G
Sbjct: 142 ADTTEALLGAIFRQHG 157



>gb:AE016940_362724 Bacteroides thetaiotaomicron VPI-5482, section
           15 of 21 of the complete genome.>gb:AE015928_989212
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 324

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 50/213 (23%), Positives = 89/213 (41%), Gaps = 14/213 (6%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGDA+LD  V    Y ++ G   G LT  RS+ V        +V+ GL   I +S
Sbjct: 72  ERLEFLGDAILDAIVGDIVYKRFEGKREGFLTNTRSKIVQRETLNKLAVEIGLDKLIKYS 131

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFE 465
           +               +SS+ +++          +  +  E+  GAIYLD G      +E
Sbjct: 132 T---------------RSSSHNSY----------MYGNAFEAFIGAIYLDQG------YE 160

Query: 464 KIRPVLEPMVTPESLRLNPV--------KELTELCQKRKYRMKEPVV---VHKDGEACTT 318
           + +  +E  +    + L+ +         +L E  QK K  +   ++   +  D      
Sbjct: 161 RCKQFMEQRIINRYIDLDKISRKEVNFKSKLIEWSQKNKMEVSFELIEQFLDHDSNPVFQ 220

Query: 317 IEVMANG---GVRSCSSSARNRKTAKRLACERM 228
            EV   G   G  +  S   +++ A ++A +++
Sbjct: 221 TEVRIEGLPAGTGTGYSKKESQQNAAQMAIKKV 253



>gb:CP000031_87199 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 225

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 24/42 (57%), Positives = 27/42 (64%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVL 792
           ++ L Y+F  P LLV ALTHGS      Q  QRLEFLGD VL
Sbjct: 11  EARLGYSFERPELLVRALTHGSISSSTRQDNQRLEFLGDRVL 52



>gb:CR380959_1653872 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 449

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 42/161 (26%), Positives = 74/161 (45%), Gaps = 7/161 (4%)
 Frame = -3

Query: 824 QRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHS 645
           +RLEFLGD++L+  +T   Y+++P L  G LTELR + V N                   
Sbjct: 215 ERLEFLGDSILNTVMTMIIYNKFPSLNEGNLTELRKKLVKN------------------E 256

Query: 644 STALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFE 465
           +    S + +  K ++ + +        KTS     ADI E+  G + ++   +T++V  
Sbjct: 257 TLREWSELYELPKQLKSNLSPDVDLSTSKTS-----ADIFEAYIGGL-MEDDPKTNLV-- 308

Query: 464 KIRPVLEPMVTPE-------SLRLNPVKELTELCQKRKYRM 363
           KIR  L+ +  P+       S++L P   L    +++ Y +
Sbjct: 309 KIRKWLKKLAKPKIEEAMKTSIQLEPTNNLDMNAKRKLYSL 349



>gb:BX572094_797229 Prochlorococcus marinus MED4 complete genome;
           segment 5/5.
          Length = 249

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 56/252 (22%), Positives = 101/252 (40%), Gaps = 7/252 (2%)
 Frame = -3

Query: 974 VGNFPLNAEQMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAV 795
           + +  +N+++ + +   E D L+ +TF       EALTH S   +   +Y++LEF GDAV
Sbjct: 17  LNSLEINSKRFIKIIN-EKDKLILHTFN------EALTHSS--ANNIVNYEKLEFFGDAV 67

Query: 794 LDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIAD 615
           L  + +      Y  +  G  +ELRS+ V++        K  +   I+    A+      
Sbjct: 68  LRLSASDFIERTYKSMSVGSRSELRSQIVSDEWLTELGKKIFIEKVIIKGPKAMGD---- 123

Query: 614 FVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIY--LDSGLRTDIVFEKIRPVLEP 441
                             + S   ++A+  E++ GAIY   +S    +I  +        
Sbjct: 124 ------------------ENSKDTIIAETSEALIGAIYKCFNSINEVNIWLDNFWKKDAE 165

Query: 440 MVTPESLRLNPVKELTELCQKRK-----YRMKEPVVVHKDGEACTTIEVMANGGVRSCSS 276
           +      + N    L E CQ +      Y++ E    H D +   + E+  NG  ++ S 
Sbjct: 166 LYLQAPHKYNAKSALQEWCQSQGFDLPIYKIYEVSKNHGDPKR-FSCEIYINGSKKAFSF 224

Query: 275 SARNRKTAKRLA 240
              ++K  K  A
Sbjct: 225 GHSHKKAEKNAA 236



>gb:AE017180_400523 Geobacter sulfurreducens PCA, complete genome.
          Length = 248

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 39/148 (26%), Positives = 62/148 (41%), Gaps = 4/148 (2%)
 Frame = -3

Query: 917 DSLLNYTFRDPSLLVEALTHGSYIPH----GTQSYQRLEFLGDAVLDYAVTRHFYDQYPG 750
           ++ + Y F D   L EALTH S++           +RLEF GDA+L + + +     YP 
Sbjct: 20  ETSIGYRFTDRRFLDEALTHRSWLNEVRSPTVPDNERLEFFGDAILGFCIGKMLLRHYPE 79

Query: 749 LFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFG 570
              G L  ++S  V     A  +    L +Y+       RS                  G
Sbjct: 80  SREGALARMKSALVGEETLADLAAAVELGSYLRLGRGEERS------------------G 121

Query: 569 WVLKTSFPWVLADIIESIAGAIYLDSGL 486
              + S   +LA+ +E++  A+YLD G+
Sbjct: 122 GRHRRS---LLANALEALLAAMYLDGGM 146



>gb:AE016819_1749373 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 432

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 9/73 (12%)
 Frame = -3

Query: 893 RDPSLLVEALTHGS------YIPHG---TQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           +DP++     TH S      Y+          +RLEFLGD++L+  +T   Y+++PG   
Sbjct: 174 KDPAIRARVFTHRSLTNDKLYLDEAQMINSHNERLEFLGDSILNTTMTMIIYNKFPGFNE 233

Query: 740 GCLTELRSESVNN 702
           G L++LR++ +NN
Sbjct: 234 GRLSQLRTKLINN 246



>gb:AC116984_1207230 Dictyostelium discoideum chromosome 2 map
            2567470-3108875 strain AX4, complete
            sequence.>gb:DDI314911_1376950 Dictyostelium discoideum
            DrnA gene for putative RNaseIII.
          Length = 1203

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 61/220 (27%), Positives = 90/220 (40%), Gaps = 20/220 (9%)
 Frame = -3

Query: 1088 ADVTEALIGAFLSTAGEIAALSFL-RWLGLDIDFI--DAPIVGN------------FPLN 954
            AD+ EA IGA     G   +  ++ +W+  D  +   D  I G              P+ 
Sbjct: 995  ADLIEAFIGAIYIECGFKDSFDWIIKWI-FDNSYYGSDNKIYGGGGGGSEINNNDELPII 1053

Query: 953  AEQMVNVKRLES-DSLLNYT-FRDPSLLVEALTH---GSYIPHGTQSYQRLEFLGDAVLD 789
             + ++N K  +  +  LN T F D +  + +  H        + T   +RLEFLGDAVLD
Sbjct: 1054 EDNLINYKYYDQINQYLNSTDFNDQTNELVSNDHFYSNQNNNNNTNFSERLEFLGDAVLD 1113

Query: 788  YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV 609
            + V  + + +Y     G LTE +S+ VNN                 + S  L+S+     
Sbjct: 1114 FIVADYLFSKYKEQQEGYLTESKSKLVNNE----------------NLSKILKSN----- 1152

Query: 608  KNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSG 489
            KNI   S   +F    K      + D IES  G  YL  G
Sbjct: 1153 KNIFSPSQQDSF----KHFSVKRMGDHIESYIGGFYLKFG 1188



 Score = 40.0 bits (92), Expect = 0.091
 Identities = 54/201 (26%), Positives = 80/201 (39%), Gaps = 5/201 (2%)
 Frame = -3

Query: 1070 LIGAFLSTAGEIAALSFLRWLGLDIDFIDAP-----IVGNFPLNAEQMVNVKRLESDSLL 906
            L+G F    G +  +  L+W    + FI+       IV  F  N    V  + L   S  
Sbjct: 847  LLGKF----GVLPLICELKWNLKVLKFINESNYIKDIVCKFKNNTNNQVLREVLTHPSTK 902

Query: 905  NYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFPGCLTE 726
              + R P   +E     SY P   + YQRLEFLGD+VL    + + + ++     G L++
Sbjct: 903  VISERKP---IEKDQFQSYRPF-MKDYQRLEFLGDSVLKITSSLYLFKKFDNEGEGLLSK 958

Query: 725  LRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFVKNIEQSSASSTFGWVLKTSFP 546
             R     N      S + G  +YIL  +T     I D  K                    
Sbjct: 959  KREFYTKNEYLTELSRRIGF-DYILRITT-----IGDHSK-------------------- 992

Query: 545  WVLADIIESIAGAIYLDSGLR 483
               AD+IE+  GAIY++ G +
Sbjct: 993  -PHADLIEAFIGAIYIECGFK 1012



>gb:AE017332_445669 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 183

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 41/124 (33%), Positives = 57/124 (45%)
 Frame = -3

Query: 818 LEFLGDAVLDYAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSST 639
           LEFLGD+V++YAV++  YD +     G  T++RS   + +  A ++ K GL NY+L    
Sbjct: 2   LEFLGDSVINYAVSKVIYDNF-YKNEGNSTQIRSLLTSTSSLANATKKVGLMNYVLLGRG 60

Query: 638 ALRSSIADFVKNIEQSSASSTFGWVLKTSFPWVLADIIESIAGAIYLDSGLRTDIVFEKI 459
           A  S I +  K                     + ADI ES   AI LD G      FEK+
Sbjct: 61  A--SEIRENNK---------------------LKADIFESFCAAILLDQG------FEKL 91

Query: 458 RPVL 447
              L
Sbjct: 92  NEFL 95



>gb:AE017343_1755609 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 839

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 53/221 (23%), Positives = 97/221 (43%), Gaps = 23/221 (10%)
 Frame = -3

Query: 1091 IADVTEALIGAFLSTAGEIAALSFLRWLGLDID---------FIDAPIVGNFPLNAEQMV 939
            +  V  A  G+++STA   A     ++L  + +         F    ++  F    E M+
Sbjct: 425  VETVNLAKTGSYISTAAMAAEERPRQYLVPEFEHRHCIPASVFRTCTVIPYFIFYLESML 484

Query: 938  NVKRLESDSLLNYTFRDPSLLVEALT--HGSYIPHGTQSYQRLEFLGDAVLDYAVTRHFY 765
              + + +      +  DP L ++A+T   G  +P  T  Y+RLE LGD +L +  T HFY
Sbjct: 485  IAEEMSAKEF--NSILDPELALQAITAAEGLNVPRWT--YERLEILGDTLLKFMTTLHFY 540

Query: 764  DQYPGLFP----GCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRS-SIADFVKNI 600
                G         + + R   ++N     ++VK GL  Y+ +    ++  +  D+  ++
Sbjct: 541  LLGGGADSEDDMNKVWQDRHMLISNRTLTANAVKQGLVKYVRNKKFKVKEWTPRDWELDL 600

Query: 599  -------EQSSASSTFGWVLKTSFPWVLADIIESIAGAIYL 498
                   +++  +S  G   +     V+ADIIE+I GA Y+
Sbjct: 601  LPGQFAPKKTMPTSFDGPESRVLGDKVIADIIEAIIGASYM 641



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 39/190 (20%), Positives = 79/190 (41%), Gaps = 12/190 (6%)
 Frame = -3

Query: 1112 RKMDNETIADVTEALIGA-FLSTAGEIAALSFLRWLGL---------DIDFIDAPIVGNF 963
            R + ++ IAD+ EA+IGA ++      + ++ L  L +         D+  +  P     
Sbjct: 621  RVLGDKVIADIIEAIIGASYMPNKDLDSVIAILHHLMVPLNLFNTWDDVKHVLPPPKAEE 680

Query: 962  PLNAE--QMVNVKRLESDSLLNYTFRDPSLLVEALTHGSYIPHGTQSYQRLEFLGDAVLD 789
            P N +    +N  +  S  +L Y F+D     +A +         +  +R + +G+A+LD
Sbjct: 681  PKNPDVPAYINFFKKSSYEVLGYKFKDNKKFEDAFSLAP-AQQTRRIRERYKMMGNALLD 739

Query: 788  YAVTRHFYDQYPGLFPGCLTELRSESVNNACYALSSVKAGLHNYILHSSTALRSSIADFV 609
              V     D YP   P  L+ ++            +V+ G+ + I+      RS +    
Sbjct: 740  LYVIELLMDSYPDEGPASLSIMKLSRTTEGLRCALAVELGMSDLIIDGDDHSRSELKRAT 799

Query: 608  KNIEQSSASS 579
              ++++ A +
Sbjct: 800  HFMQKAKAQA 809



>pir|F98012|F98012 ribonuclease III (EC 3.1.26.3) [imported] -
           Streptococcus pneumoniae (strain R6)>gb:AE008485_237447
           Streptococcus pneumoniae R6 section 101 of 184 of the
           complete genome.>gb:AE007317_943605 Streptococcus
           pneumoniae R6, complete genome.
          Length = 232

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 30/77 (38%), Positives = 38/77 (49%), Gaps = 8/77 (10%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSY--------IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           F D  LL  A TH SY        I H     +RLEFLGDAVL   ++ + Y +YP    
Sbjct: 16  FADKKLLETAFTHTSYANEHRLLKISHN----ERLEFLGDAVLQLLISEYLYKKYPKKPE 71

Query: 740 GCLTELRSESVNNACYA 690
           G L++LR+  V     A
Sbjct: 72  GDLSKLRAMIVREESLA 88



>sp|Q97QG6|RNC_STRPN Ribonuclease III (EC 3.1.26.3) (RNase
           III).>pir|H95144|H95144 ribonuclease III [imported] -
           Streptococcus pneumoniae  (strain
           TIGR4)>gb:AE007424_226414 Streptococcus pneumoniae TIGR4
           section 107 of 194 of the complete
           genome.>gb:AE005672_1104182 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 232

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 30/77 (38%), Positives = 38/77 (49%), Gaps = 8/77 (10%)
 Frame = -3

Query: 896 FRDPSLLVEALTHGSY--------IPHGTQSYQRLEFLGDAVLDYAVTRHFYDQYPGLFP 741
           F D  LL  A TH SY        I H     +RLEFLGDAVL   ++ + Y +YP    
Sbjct: 16  FADKKLLETAFTHTSYANEHRLLKISHN----ERLEFLGDAVLQLLISEYLYKKYPKKPE 71

Query: 740 GCLTELRSESVNNACYA 690
           G L++LR+  V     A
Sbjct: 72  GDLSKLRAMIVREESLA 88


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,231,655,160
Number of Sequences: 1806583
Number of extensions: 26359705
Number of successful extensions: 69078
Number of sequences better than 10.0: 304
Number of HSP's better than 10.0 without gapping: 65670
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68697
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 92823591454
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)