BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12242
         (334 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T32711|T32711 hypothetical protein T22D1.2 - Caenorhabditis ...    22   0.038   Caenorhabditis elegans [roundworm]
gb:AF309490_1784993 Coccidioides immitis spherule outer wall gly...    22   0.078   
gb:AY155576_593417 Bordetella avium strain 197N ABC transporter ...    21   0.20    
gb:AF308873_1784882 Coccidioides immitis spherule outer wall gly...    22   1.1     
gb:AF309491_1784994 Coccidioides immitis spherule outer wall gly...    22   1.1     
pir|T28770|T28770 hypothetical protein W03D2.1 - Caenorhabditis ...    22   2.4     Caenorhabditis elegans [roundworm]
sp|Q95107|WASL_BOVIN|WASL_BOVIN Neural Wiskott-Aldrich syndrome protein (N-...    23   2.7     Bos taurus [bovine]
gb:CR382127_1659910 Yarrowia lipolytica chromosome A of strain C...    32   3.9     
gb:AF452097_1800847 Trichoderma atroviride G protein alpha subun...    31   6.6     
gb:CRPGNRPB_1673522 Cryphonectria parasitica guanine nucleotide ...    31   8.7     
gb:CP000027_79525 Dehalococcoides ethenogenes 195, complete genome.    31   8.7     


>pir|T32711|T32711 hypothetical protein T22D1.2 - Caenorhabditis
           elegans>gb:AF039052_1235428 Caenorhabditis elegans
           cosmid T22D1, complete sequence.
          Length = 302

 Score = 22.3 bits (46), Expect(6) = 0.038
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           GTPPPPP
Sbjct: 197 GTPPPPP 203



 Score = 22.3 bits (46), Expect(6) = 0.038
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           GTPPPPP
Sbjct: 104 GTPPPPP 110



 Score = 22.3 bits (46), Expect(6) = 0.038
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           GTPPPPP
Sbjct: 72  GTPPPPP 78



 Score = 22.3 bits (46), Expect(6) = 0.038
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           GTPPPPP
Sbjct: 41  GTPPPPP 47



 Score = 20.8 bits (42), Expect(6) = 0.038
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           G+PPPPP
Sbjct: 166 GSPPPPP 172



 Score = 20.8 bits (42), Expect(6) = 0.038
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           G+PPPPP
Sbjct: 135 GSPPPPP 141



>gb:AF309490_1784993 Coccidioides immitis spherule outer wall
           glycoprotein (SOWgp66) mRNA, complete cds.
          Length = 375

 Score = 22.3 bits (46), Expect(5) = 0.078
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 289 SPPPPPKK 296



 Score = 22.3 bits (46), Expect(5) = 0.078
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 242 SPPPPPKK 249



 Score = 22.3 bits (46), Expect(5) = 0.078
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 195 SPPPPPKK 202



 Score = 22.3 bits (46), Expect(5) = 0.078
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 148 SPPPPPKK 155



 Score = 22.3 bits (46), Expect(5) = 0.078
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 101 SPPPPPKK 108



>gb:AY155576_593417 Bordetella avium strain 197N ABC transporter gene,
            partial cds; and adhesin FhaB (fhaB), complete cds;
            fimbrial gene cluster, complete sequence; and FHA
            accessory protein FhaC (fhaC) gene, complete cds.
          Length = 2621

 Score = 20.8 bits (42), Expect(7) = 0.20
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 310  PPPPPKKI 333
            PPPPP K+
Sbjct: 2489 PPPPPPKV 2496



 Score = 20.8 bits (42), Expect(7) = 0.20
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 310  PPPPPKKI 333
            PPPPP K+
Sbjct: 2474 PPPPPPKV 2481



 Score = 20.8 bits (42), Expect(7) = 0.20
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 310  PPPPPKKI 333
            PPPPP K+
Sbjct: 2458 PPPPPPKV 2465



 Score = 20.8 bits (42), Expect(7) = 0.20
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 310  PPPPPKKI 333
            PPPPP K+
Sbjct: 2442 PPPPPPKV 2449



 Score = 20.8 bits (42), Expect(7) = 0.20
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 310  PPPPPKKI 333
            PPPPP K+
Sbjct: 2409 PPPPPPKV 2416



 Score = 20.8 bits (42), Expect(7) = 0.20
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 310  PPPPPKKI 333
            PPPPP K+
Sbjct: 2376 PPPPPPKV 2383



 Score = 20.8 bits (42), Expect(7) = 0.20
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +1

Query: 310  PPPPPKKI 333
            PPPPP K+
Sbjct: 2330 PPPPPPKV 2337



>gb:AF308873_1784882 Coccidioides immitis spherule outer wall
           glycoprotein (SOWgp82) gene, complete cds.
          Length = 422

 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 242 SPPPPPKK 249



 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 195 SPPPPPKK 202



 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 148 SPPPPPKK 155



 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 101 SPPPPPKK 108



>gb:AF309491_1784994 Coccidioides immitis spherule outer wall
           glycoprotein (SOWgp58) mRNA, complete cds.
          Length = 328

 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 242 SPPPPPKK 249



 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 195 SPPPPPKK 202



 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 148 SPPPPPKK 155



 Score = 22.3 bits (46), Expect(4) = 1.1
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = +1

Query: 307 TPPPPPKK 330
           +PPPPPKK
Sbjct: 101 SPPPPPKK 108



>pir|T28770|T28770 hypothetical protein W03D2.1 - Caenorhabditis
           elegans>gb:AF000298_1230575 Caenorhabditis elegans
           cosmid W03D2, complete sequence.
          Length = 539

 Score = 21.9 bits (45), Expect(5) = 2.4
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = +1

Query: 304 GTPPPPPKK 330
           G+PPPPP++
Sbjct: 348 GSPPPPPRQ 356



 Score = 21.2 bits (43), Expect(5) = 2.4
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +1

Query: 298 KRGTPPPPP 324
           + G+PPPPP
Sbjct: 314 RAGSPPPPP 322



 Score = 21.2 bits (43), Expect(5) = 2.4
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +1

Query: 298 KRGTPPPPP 324
           + G+PPPPP
Sbjct: 289 RTGSPPPPP 297



 Score = 20.8 bits (42), Expect(5) = 2.4
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           G+PPPPP
Sbjct: 274 GSPPPPP 280



 Score = 20.8 bits (42), Expect(5) = 2.4
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = +1

Query: 304 GTPPPPP 324
           G+PPPPP
Sbjct: 256 GSPPPPP 262



>sp|Q95107|WASL_BOVIN Neural Wiskott-Aldrich syndrome protein
           (N-WASP).>pir|S72273|S72273 actin-depolymerizing protein
           N-WASP, brain - bovine>gb:D67066_1439127 Bos taurus mRNA
           for novel actin-depolymerizing protein, N-WASP, complete
           cds.>gb:AX167555_1462888 Sequence 55 from Patent
           WO0144292.
          Length = 505

 Score = 23.1 bits (48), Expect(4) = 2.7
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 301 RGTPPPPPKK 330
           RG PPPPP +
Sbjct: 307 RGAPPPPPSR 316



 Score = 21.6 bits (44), Expect(4) = 2.7
 Identities = 6/10 (60%), Positives = 8/10 (80%)
 Frame = +1

Query: 304 GTPPPPPKKI 333
           G PPPPP ++
Sbjct: 333 GAPPPPPNRM 342



 Score = 21.6 bits (44), Expect(4) = 2.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 301 RGTPPPPP 324
           RG PPPPP
Sbjct: 284 RGGPPPPP 291



 Score = 21.6 bits (44), Expect(4) = 2.7
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +1

Query: 295 LKRGTPPPPP 324
           L+R  PPPPP
Sbjct: 272 LRRQAPPPPP 281



>gb:CR382127_1659910 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 442

 Score = 32.0 bits (71), Expect = 3.9
 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 8/69 (11%)
 Frame = +1

Query: 43  NILN*TW-VKKPIILITQKVD--SSRIYISPTVVMIPDAGGPTRASKTAAYVLFKF---- 201
           +I+N  W V+  ++L   K+D  + ++ +SP     PD  G    +K A Y+L++F    
Sbjct: 341 SIINSRWFVRTSVVLFLNKIDVFTEKLPLSPLENQFPDYMGGNDINKGAKYILWRFTQMN 400

Query: 202 -CIIMIFPH 225
              + I+PH
Sbjct: 401 RAGLNIYPH 409



>gb:AF452097_1800847 Trichoderma atroviride G protein alpha subunit
           Tga3 (tga3) gene, complete cds.
          Length = 355

 Score = 31.2 bits (69), Expect = 6.6
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 8/69 (11%)
 Frame = +1

Query: 43  NILN*TW-VKKPIILITQKVD--SSRIYISPTVVMIPDAGGPTRASKTAAYVLFKF---- 201
           +++N  W ++  IIL   KVD    ++  SP     PD  G T  +K A Y+L++F    
Sbjct: 255 SVVNSRWFMRTSIILFLNKVDIFKQKLGRSPLSNFFPDYTGGTDVNKAAKYLLWRFNQVN 314

Query: 202 -CIIMIFPH 225
              + ++PH
Sbjct: 315 RAHLNLYPH 323



>gb:CRPGNRPB_1673522 Cryphonectria parasitica guanine nucleotide
           regulatory protein exons 1-6, complete cds.
          Length = 355

 Score = 30.8 bits (68), Expect = 8.7
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 8/69 (11%)
 Frame = +1

Query: 43  NILN*TW-VKKPIILITQKVD--SSRIYISPTVVMIPDAGGPTRASKTAAYVLFKF---- 201
           +++N  W V+  IIL   KVD    ++  SP     PD  G    +K A Y+L++F    
Sbjct: 255 SVVNSRWFVRTSIILFLNKVDIFKQKLGRSPLSNYFPDYSGGNDVNKAAKYLLWRFNQVN 314

Query: 202 -CIIMIFPH 225
              + ++PH
Sbjct: 315 RAHLNLYPH 323



>gb:CP000027_79525 Dehalococcoides ethenogenes 195, complete genome.
          Length = 316

 Score = 30.8 bits (68), Expect = 8.7
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 1/58 (1%)
 Frame = -3

Query: 224 WGKIMIMQNLN-KT*AAVLDALVGPPASGIITTVGLI*IRLESTFCVIRIMGFFTQVQ 54
           +G+++ ++ LN       L AL+GP  +G  TT+ ++   L+ T    RIMGF    Q
Sbjct: 23  YGQLLAVEKLNLNIRRGELFALLGPNGAGKSTTINMLCCLLKPTAGTARIMGFDINTQ 80


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 417,138,391
Number of Sequences: 1806583
Number of extensions: 9505281
Number of successful extensions: 22321
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 21332
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22241
length of database: 581,917,975
effective HSP length: 77
effective length of database: 442,811,084
effective search space used: 14612765772
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)