BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12124
         (662 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T04570|T04570 hypothetical protein T12H17.140 - Arabidopsis ...    49   1e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AY323213_1599154 Arabidopsis thaliana sterol-4-alpha methyl o...    44   2e-08   
gb:AE016959_1023694 Oryza sativa (japonica cultivar-group) chrom...    45   7e-07   
gb:AC113930_1739090 Oryza sativa (japonica cultivar-group) chrom...    45   9e-07   
pir|T06618|T06618 hypothetical protein F16J13.180 - Arabidopsis ...    52   7e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AF039199_1763321 Arabidopsis thaliana sterol-4-methyl-oxidase...    50   3e-05   
gb:AY125499_1580307 Arabidopsis thaliana AT4g12110/F16J13_180 mR...    50   3e-05   
gb:AY087412_1572443 Arabidopsis thaliana clone 35110 mRNA, compl...    50   3e-05   
gb:AY087876_1572903 Arabidopsis thaliana clone 39135 mRNA, compl...    49   8e-05   
gb:AY035393_1559971 Arabidopsis thaliana putative sterol 4-alpha...    49   8e-05   
gb:AB090884_1524975 Aster tripolium mRNA for putative C-4 sterol...    36   0.002   
gb:AY321103_1599075 Nicotiana benthamiana C-4 sterol methyl oxid...    42   0.009   
gb:AY078158_1568038 Zea mays putative sterol 4-alpha-methyl-oxid...    31   0.021   
gb:AP005869_1859335 Oryza sativa (japonica cultivar-group) genom...    31   0.058   
gb:BT002780_1636382 Arabidopsis thaliana clone RAFL14-89-L18 (R2...    30   0.058   
pir|G84695|G84695 probable C-4 sterol methyl oxidase [imported] ...    30   0.058   Arabidopsis thaliana [mouse-ear cress]
gb:AF222719_1778402 Arabidopsis thaliana sterol 4-alpha-methyl-o...    30   0.058   
gb:AC004561_1531885 Arabidopsis thaliana chromosome 2 clone F16P...    29   0.074   
gb:AY163803_1586037 Nicotiana tabacum 4,4-dimethyl-sterol C4-met...    37   0.39    
gb:AF352575_1790524 Gossypium arboreum putative sterol 4-alpha-m...    29   0.74    
gb:AF346734_1789992 Arabidopsis thaliana sterol 4-alpha-methyl-o...    29   0.74    
gb:AY087267_1572300 Arabidopsis thaliana clone 33426 mRNA, compl...    29   0.74    
gb:AE005172_889745 Arabidopsis thaliana chromosome 1, top arm co...    29   0.74    
sp|O35532|ER25_RAT|ER25_RAT C-4 methyl sterol oxidase (EC 1.-.-.-) (Neuro...    28   0.95    Rattus norvegicus [brown rat]
sp|P03075|TALA_POVHA|TALA_POVHA Large T antigen.>pir|A03612|TVVPTH large T ...    35   1.5     
gb:AE016951_365322 Enterococcus faecalis V583, section 5 of 11 o...    34   2.6     
pir|T29927|T29927 hypothetical protein F29B9.8 - Caenorhabditis ...    33   3.3     Caenorhabditis elegans [roundworm]
sp|Q15800|ER25_HUMAN|ER25_HUMAN C-4 methyl sterol oxidase (EC 1.-.-.-).>gb:...    26   4.3     Homo sapiens [man]
gb:AB073679_1197495 Ornithodoros moubata mitochondrial DNA, comp...    33   4.4     
gb:AY370690_1429615 Sus scrofa sterol-C4-methyl oxidase-like pro...    26   5.6     
gb:AJ719718_2501905 Gallus gallus mRNA for hypothetical protein,...    26   7.2     
gb:CR382135_1668324 Debaryomyces hansenii chromosome C of strain...    32   7.4     


>pir|T04570|T04570 hypothetical protein T12H17.140 - Arabidopsis
           thaliana>gb:ATCHRIV57_1546112 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           57.>gb:ATT12H17_1554360 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T12H17 (ESSAII project).
          Length = 820

 Score = 48.9 bits (115), Expect(2) = 1e-09
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNFASVFTYCDYIYGTDK
Sbjct: 462 GGQSQSNFASVFTYCDYIYGTDK 484



 Score = 48.9 bits (115), Expect(2) = 1e-09
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNFASVFTYCDYIYGTDK
Sbjct: 257 GGQSQSNFASVFTYCDYIYGTDK 279



 Score = 36.2 bits (82), Expect(2) = 1e-09
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGP 513
           YD PW+ TK IPFYGGP
Sbjct: 436 YDFPWSVTKLIPFYGGP 452



 Score = 36.2 bits (82), Expect(2) = 1e-09
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           YD PW+ TKYIPFYGG
Sbjct: 231 YDFPWSLTKYIPFYGG 246



>gb:AY323213_1599154 Arabidopsis thaliana sterol-4-alpha methyl
           oxidase mRNA, partial cds.
          Length = 273

 Score = 44.3 bits (103), Expect(2) = 2e-08
 Identities = 21/24 (87%), Positives = 21/24 (87%), Gaps = 1/24 (4%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYI-YGTDK 416
           GG S SNFASVFTYCDYI YGTDK
Sbjct: 243 GGQSQSNFASVFTYCDYISYGTDK 266



 Score = 36.2 bits (82), Expect(2) = 2e-08
 Identities = 13/17 (76%), Positives = 14/17 (82%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGP 513
           YD PW+ TK IPFYGGP
Sbjct: 217 YDFPWSVTKLIPFYGGP 233



>gb:AE016959_1023694 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC025783_1539529
           Oryza sativa chromosome 10 BAC OSJNBa0001O14 genomic
           sequence, complete sequence.>gb:AE017117_1753513 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           71 of 77 of the complete sequence.
          Length = 301

 Score = 45.1 bits (105), Expect(2) = 7e-07
 Identities = 19/23 (82%), Positives = 20/23 (86%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           G  S SNFASVFTYCDY+YGTDK
Sbjct: 245 GRQSQSNFASVFTYCDYLYGTDK 267



 Score = 30.4 bits (67), Expect(2) = 7e-07
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           +D P+  TKYIPFYGG
Sbjct: 219 FDFPFNLTKYIPFYGG 234



>gb:AC113930_1739090 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1384D03, complete sequence.
          Length = 284

 Score = 44.7 bits (104), Expect(2) = 9e-07
 Identities = 18/23 (78%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNF+SVFT+CDYIYGTD+
Sbjct: 244 GGHSQSNFSSVFTFCDYIYGTDR 266



 Score = 30.4 bits (67), Expect(2) = 9e-07
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           + LP+ PTKYIP YGG
Sbjct: 218 FKLPFDPTKYIPLYGG 233



>pir|T06618|T06618 hypothetical protein F16J13.180 - Arabidopsis
           thaliana>gb:ATCHRIV33_1544976 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           33.>gb:ATF16J13_1548811 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16J13 (ESSA project).
          Length = 303

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 37/110 (33%), Positives = 51/110 (46%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKL*IIYI 384
           YD PW+PTKYIPFYGG        YV       F                V+     IY 
Sbjct: 221 YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA--------------SVFTYCDYIY- 265

Query: 383 GSILDSDLYRP*DQTFSYIFLALISQGYRYQKKVLQQLREASKINSEQNG 234
           G+          D+ + Y       QGYR+QKK+L+Q++E+SK +++ NG
Sbjct: 266 GT----------DKMWLY-------QGYRFQKKLLEQIKESSKKSNKHNG 298



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 21/24 (87%), Positives = 22/24 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDKV 413
           GG S SNFASVFTYCDYIYGTDK+
Sbjct: 247 GGQSQSNFASVFTYCDYIYGTDKM 270



>gb:AF039199_1763321 Arabidopsis thaliana sterol-4-methyl-oxidase
           mRNA, complete cds.
          Length = 298

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 32/111 (28%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKL*IIYI 384
           YD PW+PTKYIPFYGG        YV       F                          
Sbjct: 221 YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA------------------------- 255

Query: 383 GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQLREASKINSEQNG 234
                          F+Y  ++    +GYR+QKK+L+Q++E+SK +++ NG
Sbjct: 256 -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNFASVFTYCDYIYGTDK
Sbjct: 247 GGQSQSNFASVFTYCDYIYGTDK 269



>gb:AY125499_1580307 Arabidopsis thaliana AT4g12110/F16J13_180 mRNA,
           complete cds.>gb:BT000546_1634824 Arabidopsis thaliana
           putative C-4 sterol methyl oxidase
           (At4g12110/F16J13_180) mRNA, complete cds.
          Length = 298

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 32/111 (28%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKL*IIYI 384
           YD PW+PTKYIPFYGG        YV       F                          
Sbjct: 221 YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA------------------------- 255

Query: 383 GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQLREASKINSEQNG 234
                          F+Y  ++    +GYR+QKK+L+Q++E+SK +++ NG
Sbjct: 256 -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNFASVFTYCDYIYGTDK
Sbjct: 247 GGQSQSNFASVFTYCDYIYGTDK 269



>gb:AY087412_1572443 Arabidopsis thaliana clone 35110 mRNA, complete
           sequence.
          Length = 298

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 32/111 (28%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKL*IIYI 384
           YD PW+PTKYIPFYGG        YV       F                          
Sbjct: 221 YDFPWSPTKYIPFYGGAEYHDYHHYVGGQSQSNFA------------------------- 255

Query: 383 GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQLREASKINSEQNG 234
                          F+Y  ++    +GYR+QKK+L+Q++E+SK +++ NG
Sbjct: 256 -------------SVFTYCDYIYGTDKGYRFQKKLLEQIKESSKKSNKHNG 293



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNFASVFTYCDYIYGTDK
Sbjct: 247 GGQSQSNFASVFTYCDYIYGTDK 269



>gb:AY087876_1572903 Arabidopsis thaliana clone 39135 mRNA, complete
           sequence.
          Length = 299

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNFASVFTYCDYIYGTDK
Sbjct: 247 GGQSQSNFASVFTYCDYIYGTDK 269



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 33/118 (27%), Positives = 45/118 (38%), Gaps = 1/118 (0%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKL*IIYI 384
           YD PW+ TKYIPFYGG        YV       F                          
Sbjct: 221 YDFPWSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA------------------------- 255

Query: 383 GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQLREASKINSEQNGFSHAGEE 213
                          F+Y  ++    +GYR+QKK+LQQ++E SK   + N   + GE+
Sbjct: 256 -------------SVFTYCDYIYGTDKGYRFQKKLLQQMKEKSK---KSNKLVNGGEK 297



>gb:AY035393_1559971 Arabidopsis thaliana putative sterol
           4-alpha-methyl-oxidase mRNA, complete cds.
          Length = 299

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 21/23 (91%), Positives = 21/23 (91%)
 Frame = -2

Query: 484 GGLSHSNFASVFTYCDYIYGTDK 416
           GG S SNFASVFTYCDYIYGTDK
Sbjct: 247 GGQSQSNFASVFTYCDYIYGTDK 269



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 33/118 (27%), Positives = 45/118 (38%), Gaps = 1/118 (0%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQFCFSIHLL*LHLWN*QGVYIKL*IIYI 384
           YD PW+ TKYIPFYGG        YV       F                          
Sbjct: 221 YDFPWSLTKYIPFYGGAEYHDYHHYVGGQSQSNFA------------------------- 255

Query: 383 GSILDSDLYRP*DQTFSYI-FLALISQGYRYQKKVLQQLREASKINSEQNGFSHAGEE 213
                          F+Y  ++    +GYR+QKK+LQQ++E SK   + N   + GE+
Sbjct: 256 -------------SVFTYCDYIYGTDKGYRFQKKLLQQMKEKSK---KSNKLVNGGEK 297



>gb:AB090884_1524975 Aster tripolium mRNA for putative C-4 sterol
           methyl oxidase, complete cds.
          Length = 297

 Score = 35.8 bits (81), Expect(2) = 0.002
 Identities = 16/24 (66%), Positives = 18/24 (75%), Gaps = 1/24 (4%)
 Frame = -2

Query: 484 GGLSHSNF-ASVFTYCDYIYGTDK 416
           G  S SNF   +FTYCDY+YGTDK
Sbjct: 245 GEKSQSNFWHPIFTYCDYLYGTDK 268



 Score = 28.1 bits (61), Expect(2) = 0.002
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           YD PWT  K+IPF  G
Sbjct: 219 YDFPWTYKKFIPFSAG 234



>gb:AY321103_1599075 Nicotiana benthamiana C-4 sterol methyl oxidase
           1 mRNA, partial cds.
          Length = 244

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 16/17 (94%), Positives = 16/17 (94%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGP 513
           YDLPWT TKYIPFYGGP
Sbjct: 219 YDLPWTITKYIPFYGGP 235



>gb:AY078158_1568038 Zea mays putative sterol 4-alpha-methyl-oxidase
           mRNA, complete cds.
          Length = 264

 Score = 30.8 bits (68), Expect(2) = 0.021
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+P+ ++P YGG         V + KS  +
Sbjct: 200 YHFPWSPSNFLPLYGGSDFHDYHHRVLYTKSGNY 233



 Score = 29.3 bits (64), Expect(2) = 0.021
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N+AS F Y D+++GTDK
Sbjct: 232 NYASTFVYMDWLFGTDK 248



>gb:AP005869_1859335 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 268

 Score = 30.8 bits (68), Expect(2) = 0.058
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+P+ ++P YGG         V + KS  +
Sbjct: 203 YHFPWSPSNFLPLYGGAEFHDYHHRVLYTKSGNY 236



 Score = 27.7 bits (60), Expect(2) = 0.058
 Identities = 9/17 (52%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+++GTDK
Sbjct: 235 NYSSTFIYMDWLFGTDK 251



>gb:BT002780_1636382 Arabidopsis thaliana clone RAFL14-89-L18
           (R20198) putative C-4 sterol methyl oxidase (At2g29390)
           mRNA, complete cds.>gb:BT005125_1638071 Arabidopsis
           thaliana clone U20198 putative C-4 sterol methyl oxidase
           (At2g29390) mRNA, complete cds.>gb:AF327853_1786900
           Arabidopsis thaliana sterol 4-alpha-methyl-oxidase mRNA,
           complete cds.
          Length = 260

 Score = 29.6 bits (65), Expect(2) = 0.058
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+P+ ++P YGG         + + KS  +
Sbjct: 201 YHFPWSPSNFLPLYGGADFHDYHHRLLYTKSGNY 234



 Score = 28.9 bits (63), Expect(2) = 0.058
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 233 NYSSTFVYMDWIFGTDK 249



>pir|G84695|G84695 probable C-4 sterol methyl oxidase [imported] -
           Arabidopsis thaliana
          Length = 253

 Score = 29.6 bits (65), Expect(2) = 0.058
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+P+ ++P YGG         + + KS  +
Sbjct: 194 YHFPWSPSNFLPLYGGADFHDYHHRLLYTKSGNY 227



 Score = 28.9 bits (63), Expect(2) = 0.058
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 226 NYSSTFVYMDWIFGTDK 242



>gb:AF222719_1778402 Arabidopsis thaliana sterol
           4-alpha-methyl-oxidase (SMO) mRNA, partial cds.
          Length = 239

 Score = 29.6 bits (65), Expect(2) = 0.058
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+P+ ++P YGG         + + KS  +
Sbjct: 180 YHFPWSPSNFLPLYGGADFHDYHHRLLYTKSGNY 213



 Score = 28.9 bits (63), Expect(2) = 0.058
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 212 NYSSTFVYMDWIFGTDK 228



>gb:AC004561_1531885 Arabidopsis thaliana chromosome 2 clone F16P2
           map ve014, complete sequence.>gb:AY086287_1571340
           Arabidopsis thaliana clone 23439 mRNA, complete
           sequence.
          Length = 272

 Score = 29.3 bits (64), Expect(2) = 0.074
 Identities = 8/16 (50%), Positives = 12/16 (75%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           Y  PW+P+ ++P YGG
Sbjct: 201 YHFPWSPSNFLPLYGG 216



 Score = 28.9 bits (63), Expect(2) = 0.074
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 245 NYSSTFVYMDWIFGTDK 261



>gb:AY163803_1586037 Nicotiana tabacum 4,4-dimethyl-sterol
           C4-methyl-oxidase mRNA, partial cds.
          Length = 129

 Score = 36.6 bits (83), Expect = 0.39
 Identities = 14/17 (82%), Positives = 14/17 (82%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGP 513
           YDLPWT TKYIPF  GP
Sbjct: 104 YDLPWTITKYIPFMSGP 120



>gb:AF352575_1790524 Gossypium arboreum putative sterol
           4-alpha-methyl-oxidase mRNA, complete cds.
          Length = 269

 Score = 28.9 bits (63), Expect(2) = 0.74
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 233 NYSSTFVYMDWIFGTDK 249



 Score = 25.8 bits (55), Expect(2) = 0.74
 Identities = 9/34 (26%), Positives = 16/34 (47%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+ + ++P YGG         + + KS  +
Sbjct: 201 YHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNY 234



>gb:AF346734_1789992 Arabidopsis thaliana sterol
           4-alpha-methyl-oxidase mRNA, complete cds.
          Length = 266

 Score = 28.9 bits (63), Expect(2) = 0.74
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 233 NYSSTFVYMDWIFGTDK 249



 Score = 25.8 bits (55), Expect(2) = 0.74
 Identities = 9/34 (26%), Positives = 16/34 (47%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+ + ++P YGG         + + KS  +
Sbjct: 201 YHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNY 234



>gb:AY087267_1572300 Arabidopsis thaliana clone 33426 mRNA, complete
           sequence.
          Length = 266

 Score = 28.9 bits (63), Expect(2) = 0.74
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 233 NYSSTFVYMDWIFGTDK 249



 Score = 25.8 bits (55), Expect(2) = 0.74
 Identities = 9/34 (26%), Positives = 16/34 (47%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+ + ++P YGG         + + KS  +
Sbjct: 201 YHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNY 234



>gb:AE005172_889745 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC022464_1539014 Genomic sequence
           for Arabidopsis thaliana BAC F22G5 from chromosome I,
           complete sequence.
          Length = 261

 Score = 28.9 bits (63), Expect(2) = 0.74
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTDK 416
           N++S F Y D+I+GTDK
Sbjct: 228 NYSSTFVYMDWIFGTDK 244



 Score = 25.8 bits (55), Expect(2) = 0.74
 Identities = 9/34 (26%), Positives = 16/34 (47%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGGPXXXXXXXYVWWPKSQQF 462
           Y  PW+ + ++P YGG         + + KS  +
Sbjct: 196 YHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNY 229



>sp|O35532|ER25_RAT C-4 methyl sterol oxidase (EC 1.-.-.-) (Neuropep
           1) (RANP-1).>gb:BC063155_2105176 Rattus norvegicus
           sterol-C4-methyl oxidase-like, mRNA (cDNA clone
           MGC:72715 IMAGE:6918081), complete
           cds.>gb:D50559_2112263 Rattus norvegicus mRNA for
           RANP-1, complete cds.
          Length = 293

 Score = 28.1 bits (61), Expect(2) = 0.95
 Identities = 10/16 (62%), Positives = 11/16 (68%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           YD+P  P  YIPFY G
Sbjct: 231 YDIPLNPLNYIPFYTG 246



 Score = 26.2 bits (56), Expect(2) = 0.95
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTD 419
           N+AS FT+ D I+GTD
Sbjct: 260 NYASTFTWWDRIFGTD 275



>sp|P03075|TALA_POVHA Large T antigen.>pir|A03612|TVVPTH large T
           antigen - hamster polyomavirus>gb:HAPVXX_2404259 Hamster
           polyomavirus (HapV) genome.>gb:PPCCGAAA_2446922 Hamster
           polyomavirus, complete genome.
          Length = 751

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 5/117 (4%)
 Frame = -2

Query: 625 FGSYFRSSDLLHTSIANIDSGM--TFLGLPQNIFLFMVVQITMTTIIMSGGLSHSNFASV 452
           FGSYF S++ L   I+        T    P        V       I+ G LSH+ F++ 
Sbjct: 225 FGSYFNSTEELEEEISQTQQSHHNTTPKKPPP-----TVSPDDFPTILRGFLSHAIFSNK 279

Query: 451 FTYCDYIYGTDKVCI*NYK*SILDQFST---AIYIGRKTKPFLTFFWP*SHRATAIK 290
                 IY T + C   Y+   +D+++     I+I ++T+ F+ F  P  HR  A+K
Sbjct: 280 TQNAFIIYSTKEKCEVLYE--QIDKYNPDYKGIFIMKQTEAFVMFMTPGKHRVAAVK 334



>gb:AE016951_365322 Enterococcus faecalis V583, section 5 of 11 of
           the complete genome.>gb:AE016830_991810 Enterococcus
           faecalis V583, complete genome.
          Length = 806

 Score = 33.9 bits (76), Expect = 2.6
 Identities = 19/63 (30%), Positives = 36/63 (57%), Gaps = 2/63 (3%)
 Frame = -2

Query: 649 IRINCPFFFGSYFRSSDLLHTSIANIDSGMTFLGLPQNIFLFMVVQITMTTIIMS--GGL 476
           I I C  FF SYF +   LH SI ++++ +  + +P+ ++L   V +  +T+ ++  G L
Sbjct: 245 IPIGCVLFFQSYFINHQGLHDSIVSMEAALIGM-IPEGLYLLTTVALAASTMRLAKRGVL 303

Query: 475 SHS 467
            H+
Sbjct: 304 LHN 306



>pir|T29927|T29927 hypothetical protein F29B9.8 - Caenorhabditis
           elegans>gb:U70849_1405977 Caenorhabditis elegans cosmid
           F29B9, complete sequence.
          Length = 381

 Score = 33.5 bits (75), Expect = 3.3
 Identities = 17/61 (27%), Positives = 31/61 (50%)
 Frame = -2

Query: 622 GSYFRSSDLLHTSIANIDSGMTFLGLPQNIFLFMVVQITMTTIIMSGGLSHSNFASVFTY 443
           GS F  + +        D+ ++   +PQ  +L ++  I +T  I+S G+    FAS+F +
Sbjct: 211 GSVFFKAQITPVIFTAFDTLISIYQIPQWAYLSIISSIRLTACIVSFGIVTQMFASLFLF 270

Query: 442 C 440
           C
Sbjct: 271 C 271



>sp|Q15800|ER25_HUMAN C-4 methyl sterol oxidase (EC
           1.-.-.-).>gb:CR860990_1185031 Pongo pygmaeus mRNA; cDNA
           DKFZp459K1318 (from clone
           DKFZp459K1318).>gb:BC010653_1972741 Homo sapiens
           sterol-C4-methyl oxidase-like, mRNA (cDNA clone MGC:8923
           IMAGE:3866053), complete cds.>gb:HSU60205_2025221 Human
           methyl sterol oxidase (ERG25) mRNA, complete
           cds.>gb:HSU93162_2027584 Homo sapiens C4-sterol methyl
           oxidase homolog (DESP4) mRNA, complete cds.
          Length = 293

 Score = 26.2 bits (56), Expect(2) = 4.3
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTD 419
           N+AS FT+ D I+GTD
Sbjct: 260 NYASTFTWWDRIFGTD 275



 Score = 25.8 bits (55), Expect(2) = 4.3
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           YD+P  P   IPFY G
Sbjct: 231 YDIPLNPLNLIPFYAG 246



>gb:AB073679_1197495 Ornithodoros moubata mitochondrial DNA,
           complete sequence.
          Length = 92

 Score = 33.1 bits (74), Expect = 4.4
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 7/80 (8%)
 Frame = -2

Query: 631 FFFGSYFRSSDLLHTSIANIDSGMTFLGLPQNIFL-------FMVVQITMTTIIMSGGLS 473
           FF GS+    +  H  +  +     +LG+  N+F+       F+V+ I M  ++   G+ 
Sbjct: 9   FFSGSFSLLMNRKHILLIMLSLEFMYLGVMVNVFIICGISKFFLVLIIFMIVVVCEAGMG 68

Query: 472 HSNFASVFTYCDYIYGTDKV 413
                SV     Y YG+DK+
Sbjct: 69  ----LSVLVLSVYFYGSDKI 84



>gb:AY370690_1429615 Sus scrofa sterol-C4-methyl oxidase-like
           protein (SC4MOL) mRNA, complete cds.
          Length = 293

 Score = 26.2 bits (56), Expect(2) = 5.6
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTD 419
           N+AS FT+ D I+GTD
Sbjct: 260 NYASTFTWWDRIFGTD 275



 Score = 25.4 bits (54), Expect(2) = 5.6
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           YD+P  P   IPFY G
Sbjct: 231 YDIPLNPLHLIPFYAG 246



>gb:AJ719718_2501905 Gallus gallus mRNA for hypothetical protein,
           clone 5j19.
          Length = 296

 Score = 26.2 bits (56), Expect(2) = 7.2
 Identities = 10/16 (62%), Positives = 13/16 (81%)
 Frame = -2

Query: 466 NFASVFTYCDYIYGTD 419
           N+AS FT+ D I+GTD
Sbjct: 260 NYASTFTWWDRIFGTD 275



 Score = 25.0 bits (53), Expect(2) = 7.2
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -1

Query: 563 YDLPWTPTKYIPFYGG 516
           YD+P  P   +PFY G
Sbjct: 231 YDIPLNPLHLVPFYAG 246



>gb:CR382135_1668324 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 312

 Score = 32.3 bits (72), Expect = 7.4
 Identities = 17/59 (28%), Positives = 28/59 (47%)
 Frame = -3

Query: 453 YSPIVITSMELTRCVYKIINNLYWINSRQRFI*AVRPNLFLHFFGLNLTGLPLSKESTS 277
           + P   T +     + K++NN  WI +R   +   +    LH F +N+   P+ KES S
Sbjct: 93  HEPSSSTGVNAKEILNKVLNNQLWIGNRGEILHRYQK---LHLFDINIENGPILKESNS 148


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 672,498,546
Number of Sequences: 1806583
Number of extensions: 13508023
Number of successful extensions: 31762
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 30955
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31757
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 36512801500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)