BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12084
         (730 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:CQ871351_1454690 Sequence 3 from Patent WO2004078983.              338   4e-92   
gb:AX720364_1473831 Sequence 23 from Patent WO03014365.>gb:AY062...   288   9e-77   
gb:CQ871359_1454694 Sequence 11 from Patent WO2004078983.             288   9e-77   
pir|T00444|T00444 hypothetical protein T14N5.1 - Arabidopsis tha...   288   9e-77   Arabidopsis thaliana [mouse-ear cress]
gb:AP003227_1825661 Oryza sativa (japonica cultivar-group) genom...   265   8e-70   
gb:AY056133_1563468 Arabidopsis thaliana unknown protein (At3g18...   254   1e-66   
gb:CQ871361_1454695 Sequence 13 from Patent WO2004078983.>gb:AX7...   254   1e-66   
gb:CQ871357_1454693 Sequence 9 from Patent WO2004078983.              253   2e-66   
gb:AC135429_1742391 Oryza sativa (japonica cultivar-group) chrom...   250   2e-65   
gb:AP004017_1836429 Oryza sativa (japonica cultivar-group) genom...   162   4e-39   
gb:BT005924_1638846 Arabidopsis thaliana At4g33330 gene, complet...   144   1e-33   
pir|T05984|T05984 hypothetical protein F17M5.90 - Arabidopsis th...   144   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AX720366_1473832 Sequence 25 from Patent WO03014365.>gb:AC079...   134   1e-30   
gb:AX720370_1473834 Sequence 29 from Patent WO03014365.               127   2e-28   
pir|H96590|H96590 hypothetical protein T24C10.6 [imported] - Ara...   108   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AX720349_1473824 Sequence 8 from Patent WO03014365.                107   3e-22   
pir|G86221|G86221 protein F7G19.14 [imported] - Arabidopsis thal...   107   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AB051552_1868064 Homo sapiens mRNA for KIAA1765 protein, part...    35   1.1     
gb:AX803409_1475542 Sequence 71 from Patent WO03000901.                35   1.1     
gb:AE013599_1130638 Drosophila melanogaster chromosome 2R, compl...    35   1.4     


>gb:CQ871351_1454690 Sequence 3 from Patent WO2004078983.
          Length = 648

 Score =  338 bits (868), Expect = 4e-92
 Identities = 144/163 (88%), Positives = 156/163 (95%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEF 551
           HMNFLKHYWEGDEEEKK+MKT+LF ADPPVLYVLHYLGLKPWLCFRDYDCNWNV KL EF
Sbjct: 486 HMNFLKHYWEGDEEEKKQMKTRLFGADPPVLYVLHYLGLKPWLCFRDYDCNWNVGKLQEF 545

Query: 550 ASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPRL 371
           ASDVAHRTWWK+HDAMP+NLHKYCLLRSKQKAALEWDRREAEK N++DGHWK+KIKDPRL
Sbjct: 546 ASDVAHRTWWKVHDAMPDNLHKYCLLRSKQKAALEWDRREAEKANFSDGHWKIKIKDPRL 605

Query: 370 QICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL 242
           + C+E+FCFWESMLWHWGETNWTDN+TS+PTPPMV T SLSSL
Sbjct: 606 ETCYEEFCFWESMLWHWGETNWTDNATSSPTPPMVNTASLSSL 648



>gb:AX720364_1473831 Sequence 23 from Patent
           WO03014365.>gb:AY062695_1565351 Arabidopsis thaliana
           Unknown protein (At1g77130; T14N5.1) mRNA, complete
           cds.>gb:AY114677_1578719 Arabidopsis thaliana unknown
           protein (At1g77130) mRNA, complete cds.
          Length = 618

 Score =  288 bits (736), Expect = 9e-77
 Identities = 125/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (0%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGL-KPWLCFRDYDCNWNVEKLHE 554
           HMNFLKH+WEGDE E K+MKT LF ADPP+LYVLHYLG  KPWLCFRDYDCNWNV+   E
Sbjct: 455 HMNFLKHFWEGDEPEIKKMKTSLFGADPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQE 514

Query: 553 FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           FASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHWK+KIKD R
Sbjct: 515 FASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHWKIKIKDKR 574

Query: 373 LQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL 242
           L+ CFEDFCFWESMLWHWGETN T+NS++T T       +L SL
Sbjct: 575 LKTCFEDFCFWESMLWHWGETNSTNNSSTTTTSSPPHKTALPSL 618



>gb:CQ871359_1454694 Sequence 11 from Patent WO2004078983.
          Length = 618

 Score =  288 bits (736), Expect = 9e-77
 Identities = 125/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (0%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGL-KPWLCFRDYDCNWNVEKLHE 554
           HMNFLKH+WEGDE E K+MKT LF ADPP+LYVLHYLG  KPWLCFRDYDCNWNV+   E
Sbjct: 455 HMNFLKHFWEGDEPEIKKMKTSLFGADPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQE 514

Query: 553 FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           FASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHWK+KIKD R
Sbjct: 515 FASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHWKIKIKDKR 574

Query: 373 LQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL 242
           L+ CFEDFCFWESMLWHWGETN T+NS++T T       +L SL
Sbjct: 575 LKTCFEDFCFWESMLWHWGETNSTNNSSTTTTSSPPHKTALPSL 618



>pir|T00444|T00444 hypothetical protein T14N5.1 - Arabidopsis
            thaliana>gb:AE005173_895239 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AX720347_1473823 Sequence 6 from Patent
            WO03014365.>gb:AC004260_1531601 Arabidopsis thaliana
            chromosome I BAC T14N5 genomic sequence, complete
            sequence.
          Length = 1201

 Score =  288 bits (736), Expect = 9e-77
 Identities = 125/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (0%)
 Frame = -1

Query: 730  HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGL-KPWLCFRDYDCNWNVEKLHE 554
            HMNFLKH+WEGDE E K+MKT LF ADPP+LYVLHYLG  KPWLCFRDYDCNWNV+   E
Sbjct: 1038 HMNFLKHFWEGDEPEIKKMKTSLFGADPPILYVLHYLGYNKPWLCFRDYDCNWNVDIFQE 1097

Query: 553  FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
            FASD AH+TWW++HDAMPENLHK+CLLRSKQKA LEWDRR+AEKGNY DGHWK+KIKD R
Sbjct: 1098 FASDEAHKTWWRVHDAMPENLHKFCLLRSKQKAQLEWDRRQAEKGNYKDGHWKIKIKDKR 1157

Query: 373  LQICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL 242
            L+ CFEDFCFWESMLWHWGETN T+NS++T T       +L SL
Sbjct: 1158 LKTCFEDFCFWESMLWHWGETNSTNNSSTTTTSSPPHKTALPSL 1201



 Score =  250 bits (638), Expect = 2e-65
 Identities = 102/140 (72%), Positives = 120/140 (85%), Gaps = 1/140 (0%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGL-KPWLCFRDYDCNWNVEKLHE 554
           HMNFLKH+WEGD  + ++ KT+LF ADPP+LYVLHYLG  KPW+CFRDYDCNWNV   H+
Sbjct: 431 HMNFLKHFWEGDTPKHRKSKTRLFGADPPILYVLHYLGYNKPWVCFRDYDCNWNVVGYHQ 490

Query: 553 FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           FASD AH+TWW++HDAMP+ L ++CLL SKQKA LEWDRR+AEK NY DGHW++KIKD R
Sbjct: 491 FASDEAHKTWWRVHDAMPKKLQRFCLLSSKQKAQLEWDRRQAEKANYRDGHWRIKIKDKR 550

Query: 373 LQICFEDFCFWESMLWHWGE 314
           L  CFEDFCFWESMLWHWG+
Sbjct: 551 LTTCFEDFCFWESMLWHWGD 570



>gb:AP003227_1825661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0018C10.
          Length = 635

 Score =  265 bits (676), Expect = 8e-70
 Identities = 116/162 (71%), Positives = 128/162 (79%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEF 551
           HMNFLKH+WEGDEEE K  KT+LF ADPP+LYVLHYLGLKPWLCFRDYDCNWN   L EF
Sbjct: 476 HMNFLKHFWEGDEEEVKVKKTRLFGADPPILYVLHYLGLKPWLCFRDYDCNWNNPILREF 535

Query: 550 ASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPRL 371
           ASDVAH  WWK+HD MP+ L  YCLLRS+QKA LEWDRR+AEK N+TDGHW+  I DPRL
Sbjct: 536 ASDVAHARWWKVHDKMPKKLQHYCLLRSRQKAGLEWDRRQAEKANFTDGHWRRNITDPRL 595

Query: 370 QICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSS 245
           + CFE FCFWESMLWHWGE+    NST     P   T SL+S
Sbjct: 596 KTCFEKFCFWESMLWHWGESK---NSTKENPVPATPTASLTS 634



>gb:AY056133_1563468 Arabidopsis thaliana unknown protein
           (At3g18660) mRNA, complete cds.>gb:AY142690_1583106
           Arabidopsis thaliana unknown protein (At3g18660) mRNA,
           complete cds.
          Length = 655

 Score =  254 bits (649), Expect = 1e-66
 Identities = 104/163 (63%), Positives = 130/163 (79%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEF 551
           HMNFLKH+W GDE++ K  KT+LF A+PPVLYVLHYLG+KPWLC+RDYDCN+N +   EF
Sbjct: 488 HMNFLKHFWIGDEDDAKRKKTELFGAEPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEF 547

Query: 550 ASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPRL 371
           A+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHWK+++KDPR 
Sbjct: 548 ATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHWKIRVKDPRF 607

Query: 370 QICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL 242
           +IC +  C W+SML HWGE+NWTD  +  PTPP +     SSL
Sbjct: 608 KICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITVDRRSSL 650



>gb:CQ871361_1454695 Sequence 13 from Patent
           WO2004078983.>gb:AX720343_1473822 Sequence 2 from Patent
           WO03014365.>gb:AB026654_1517295 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MVE11.>gb:AY749109_1626644 Arabidopsis thaliana
           glycogenin-like starch initiation protein (PGSIP1) mRNA,
           complete cds.
          Length = 659

 Score =  254 bits (649), Expect = 1e-66
 Identities = 104/163 (63%), Positives = 130/163 (79%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEF 551
           HMNFLKH+W GDE++ K  KT+LF A+PPVLYVLHYLG+KPWLC+RDYDCN+N +   EF
Sbjct: 492 HMNFLKHFWIGDEDDAKRKKTELFGAEPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEF 551

Query: 550 ASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPRL 371
           A+D+AHR WW +HDAMP+ LH++C LRSKQKA LE+DRR+AE  NY DGHWK+++KDPR 
Sbjct: 552 ATDIAHRKWWMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHWKIRVKDPRF 611

Query: 370 QICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKTVSLSSL 242
           +IC +  C W+SML HWGE+NWTD  +  PTPP +     SSL
Sbjct: 612 KICIDKLCNWKSMLRHWGESNWTDYESFVPTPPAITVDRRSSL 654



>gb:CQ871357_1454693 Sequence 9 from Patent WO2004078983.
          Length = 647

 Score =  253 bits (647), Expect = 2e-66
 Identities = 107/148 (72%), Positives = 124/148 (83%), Gaps = 1/148 (0%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGL-KPWLCFRDYDCNWNVEKLHE 554
           HMNFLKH+WEGD  + ++ KT+LF ADPP+LYVLHYLG  KPW+CFRDYDCNWNV   H+
Sbjct: 493 HMNFLKHFWEGDTPKHRKSKTRLFGADPPILYVLHYLGYNKPWVCFRDYDCNWNVVGYHQ 552

Query: 553 FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           FASD AH+TWW++HDAMP+ L ++CLL SKQKA LEWDRR+AEK NY DGHW++KIKD R
Sbjct: 553 FASDEAHKTWWRVHDAMPKKLQRFCLLSSKQKAQLEWDRRQAEKANYRDGHWRIKIKDKR 612

Query: 373 LQICFEDFCFWESMLWHWGETNWTDNST 290
           L  CFEDFCFWESMLWHWGET    NST
Sbjct: 613 LTTCFEDFCFWESMLWHWGETQ--TNST 638



>gb:AC135429_1742391 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0636F09, complete sequence.
          Length = 671

 Score =  250 bits (638), Expect = 2e-65
 Identities = 105/157 (66%), Positives = 123/157 (78%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEF 551
           HMNFLKH+WEGD++  K  KT+LF ADPP+LYVLHYLG+KPWLCFRDYDCNWN+  + EF
Sbjct: 517 HMNFLKHFWEGDDDSAKAKKTELFGADPPILYVLHYLGMKPWLCFRDYDCNWNIPLMREF 576

Query: 550 ASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPRL 371
           ASDVAH  WWK+HD MPE L  YCLLRSK KA LEW+RR+AEK N  DGHW+  I DPRL
Sbjct: 577 ASDVAHARWWKVHDNMPEKLQSYCLLRSKLKAGLEWERRQAEKANLEDGHWRRNITDPRL 636

Query: 370 QICFEDFCFWESMLWHWGETNWTDNSTSTPTPPMVKT 260
            IC+E FC+WESML HWGE N T+N+   P P  + +
Sbjct: 637 TICYEKFCYWESMLLHWGEKNPTNNN---PVPATISS 670



>gb:AP004017_1836429 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1008_F08.
          Length = 654

 Score =  162 bits (411), Expect = 4e-39
 Identities = 67/124 (54%), Positives = 85/124 (68%), Gaps = 1/124 (0%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEK-KEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHE 554
           H NF+KH+WEGD  E+    +  + AA+P V   +H++G+KPW CFRDYDCNWN  +L +
Sbjct: 492 HANFMKHFWEGDSGERLAAARRAVLAAEPAVALAVHFVGMKPWFCFRDYDCNWNSPQLRQ 551

Query: 553 FASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           FASD AH  WW+ HDAMP  L  +CLL  +QKA L WD  EA   N++DGHW+V I DPR
Sbjct: 552 FASDEAHARWWRAHDAMPAALQGFCLLDERQKALLRWDAAEARAANFSDGHWRVPIADPR 611

Query: 373 LQIC 362
             IC
Sbjct: 612 RNIC 615



>gb:BT005924_1638846 Arabidopsis thaliana At4g33330 gene, complete
           cds.>gb:AK118592_1816561 Arabidopsis thaliana At4g33330
           mRNA for unknown protein, complete cds, clone:
           RAFL19-84-B16.>gb:AK175846_1817834 Arabidopsis thaliana
           mRNA for putative protein, complete cds, clone:
           RAFL22-46-H06.>gb:AK176001_1817989 Arabidopsis thaliana
           mRNA for putative protein, complete cds, clone:
           RAFL22-69-H08.
          Length = 596

 Score =  144 bits (364), Expect = 1e-33
 Identities = 58/118 (49%), Positives = 84/118 (71%)
 Frame = -1

Query: 727 MNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEFA 548
           +NFLK++W    +E+  +K  LFAA+PP +Y +HYLG KPWLC+RDYDCN++V++   +A
Sbjct: 472 VNFLKNFWSNTTKERN-IKNNLFAAEPPQVYAVHYLGWKPWLCYRDYDCNYDVDEQLVYA 530

Query: 547 SDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           SD AH  WWK+HD+M + L K+C L  K++  + W+RR+A     TD HWK+ + DPR
Sbjct: 531 SDAAHVRWWKVHDSMDDALQKFCRLTKKRRTEINWERRKARLRGSTDYHWKINVTDPR 588



>pir|T05984|T05984 hypothetical protein F17M5.90 - Arabidopsis
           thaliana>gb:AX720353_1473826 Sequence 12 from Patent
           WO03014365.>gb:ATCHRIV79_1547253 Arabidopsis thaliana
           DNA chromosome 4, contig fragment No.
           79.>gb:ATF17M5_1549012 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17M5 (ESSA project).
          Length = 333

 Score =  144 bits (364), Expect = 1e-33
 Identities = 58/118 (49%), Positives = 84/118 (71%)
 Frame = -1

Query: 727 MNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEFA 548
           +NFLK++W    +E+  +K  LFAA+PP +Y +HYLG KPWLC+RDYDCN++V++   +A
Sbjct: 209 VNFLKNFWSNTTKERN-IKNNLFAAEPPQVYAVHYLGWKPWLCYRDYDCNYDVDEQLVYA 267

Query: 547 SDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           SD AH  WWK+HD+M + L K+C L  K++  + W+RR+A     TD HWK+ + DPR
Sbjct: 268 SDAAHVRWWKVHDSMDDALQKFCRLTKKRRTEINWERRKARLRGSTDYHWKINVTDPR 325



>gb:AX720366_1473832 Sequence 25 from Patent
           WO03014365.>gb:AC079633_1732636 Genomic Sequence for
           Oryza sativa, Nipponbare strain, clone OSJNBa0032G08,
           from Chromosome 3, complete sequence.
          Length = 614

 Score =  134 bits (338), Expect = 1e-30
 Identities = 54/118 (45%), Positives = 78/118 (66%)
 Frame = -1

Query: 727 MNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEFA 548
           +N+LK++W     E+  +K +LF ADP  ++ +HYLGLKPW C+RDYDCNWN+     +A
Sbjct: 495 VNYLKNFWANTTAERA-LKERLFRADPAEVWSIHYLGLKPWTCYRDYDCNWNIGDQRVYA 553

Query: 547 SDVAHRTWWKIHDAMPENLHKYCLLRSKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
           SD AH  WW+++D M E +   C L  ++K  + WDR  AE+  ++D HWK+ I DPR
Sbjct: 554 SDAAHARWWQVYDDMGEAMRSPCRLSERRKIEIAWDRHLAEEAGFSDHHWKINITDPR 611



>gb:AX720370_1473834 Sequence 29 from Patent WO03014365.
          Length = 184

 Score =  127 bits (320), Expect = 2e-28
 Identities = 54/66 (81%), Positives = 59/66 (89%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEF 551
           HMNFLKH+WEGDE+E K  KT+LF A+PP+LYVLHYLG KPWLCFRDYDCNWNVE L EF
Sbjct: 118 HMNFLKHFWEGDEDEVKAKKTRLFGANPPILYVLHYLGRKPWLCFRDYDCNWNVEILREF 177

Query: 550 ASDVAH 533
           ASDVAH
Sbjct: 178 ASDVAH 183



>pir|H96590|H96590 hypothetical protein T24C10.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_893380 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AX720351_1473825 Sequence 10 from Patent
           WO03014365.>gb:AC064840_1540258 Arabidopsis thaliana
           chromosome I BAC T24C10 genomic sequence, complete
           sequence.>gb:AC069144_1540618 Arabidopsis thaliana
           chromosome 1 BAC F14C21 genomic sequence, complete
           sequence.
          Length = 557

 Score =  108 bits (269), Expect = 1e-22
 Identities = 42/86 (48%), Positives = 58/86 (67%)
 Frame = -1

Query: 631 LHYLGLKPWLCFRDYDCNWNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLRSKQKAA 452
           LHYLGLKPW+C+RDYDCNW++ +   FASD  H  WWK++D M E L  YC L    +  
Sbjct: 465 LHYLGLKPWVCYRDYDCNWDISERRVFASDSVHEKWWKVYDKMSEQLKGYCGLNKNMEKR 524

Query: 451 LEWDRREAEKGNYTDGHWKVKIKDPR 374
           +E  RR A+  +  D HW+++++DPR
Sbjct: 525 IEKWRRIAKNNSLPDRHWEIEVRDPR 550



>gb:AX720349_1473824 Sequence 8 from Patent WO03014365.
          Length = 550

 Score =  107 bits (266), Expect = 3e-22
 Identities = 43/92 (46%), Positives = 61/92 (66%)
 Frame = -1

Query: 649 PPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLR 470
           P  L  +HYLGLKPW C+RDYDCNW+++    +AS+  H  WWK++D MP+ L  YC L 
Sbjct: 452 PENLEGIHYLGLKPWRCYRDYDCNWDLKTRRVYASESVHARWWKVYDKMPKKLKGYCGLN 511

Query: 469 SKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
            K +  +E  R+ A+   + + HWK++IKDPR
Sbjct: 512 LKMEKNVEKWRKMAKLNGFPENHWKIRIKDPR 543



>pir|G86221|G86221 protein F7G19.14 [imported] - Arabidopsis
           thaliana>gb:AE005172_889902 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F7G19_1678552 Sequence of BAC F7G19 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 546

 Score =  107 bits (266), Expect = 3e-22
 Identities = 43/92 (46%), Positives = 61/92 (66%)
 Frame = -1

Query: 649 PPVLYVLHYLGLKPWLCFRDYDCNWNVEKLHEFASDVAHRTWWKIHDAMPENLHKYCLLR 470
           P  L  +HYLGLKPW C+RDYDCNW+++    +AS+  H  WWK++D MP+ L  YC L 
Sbjct: 448 PENLEGIHYLGLKPWRCYRDYDCNWDLKTRRVYASESVHARWWKVYDKMPKKLKGYCGLN 507

Query: 469 SKQKAALEWDRREAEKGNYTDGHWKVKIKDPR 374
            K +  +E  R+ A+   + + HWK++IKDPR
Sbjct: 508 LKMEKNVEKWRKMAKLNGFPENHWKIRIKDPR 539



>gb:AB051552_1868064 Homo sapiens mRNA for KIAA1765 protein, partial
           cds.
          Length = 608

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 13/43 (30%), Positives = 21/43 (48%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWL 602
           H  FL  YW+   +  K++ ++L   DP   Y  H +   PW+
Sbjct: 531 HFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWI 573



>gb:AX803409_1475542 Sequence 71 from Patent WO03000901.
          Length = 366

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 13/43 (30%), Positives = 21/43 (48%)
 Frame = -1

Query: 730 HMNFLKHYWEGDEEEKKEMKTQLFAADPPVLYVLHYLGLKPWL 602
           H  FL  YW+   +  K++ ++L   DP   Y  H +   PW+
Sbjct: 222 HFEFLPPYWDNISDAAKDLVSRLLVVDPKKRYTAHQVLQHPWI 264



>gb:AE013599_1130638 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003837_1227051 Drosophila melanogaster
           chromosome 2R, section 13 of 74 of the complete
           sequence.>gb:AY122074_1301436 Drosophila melanogaster
           AT16994 full insert cDNA.
          Length = 994

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 4/90 (4%)
 Frame = +1

Query: 442 PTPRPPSVWI*ASSTCASSPALHRGFSTMSYAQHHLQTRAISQHSSCNHSRGSIATVSTL 621
           P P PP       +       LH    T ++  HHLQT++ S  SS      ++  +S  
Sbjct: 471 PQPPPPG------AAFLLQQQLHIKPETQTHLHHHLQTQSTSAVSS------TLPQISLR 518

Query: 622 NSEEHTG----LEDLQQTAAFSFPSSPPRH 699
           + +E T     L+ L+ +A+ S P+ PPRH
Sbjct: 519 HPDELTAPQMDLKPLELSASTSPPAPPPRH 548


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 735,765,381
Number of Sequences: 1806583
Number of extensions: 15538986
Number of successful extensions: 42282
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 40755
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42234
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 43961893272
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)