BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12071
         (1723 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003537_1830561 Oryza sativa (japonica cultivar-group) genom...   600   e-170   
gb:AC119288_1739617 Oryza sativa (japonica cultivar-group) chrom...   597   e-169   
gb:AB026636_1517072 Arabidopsis thaliana genomic DNA, chromosome...   596   e-169   
gb:AP003537_1830562 Oryza sativa (japonica cultivar-group) genom...   574   e-162   
gb:AP004069_1837209 Oryza sativa (japonica cultivar-group) genom...   466   e-130   
pir|G86244|G86244 Serine carboxypeptidase homolog, 30227-33069 [...   465   e-129   Arabidopsis thaliana [mouse-ear cress]
gb:AB007648_1510197 Arabidopsis thaliana genomic DNA, chromosome...   456   e-127   
gb:AF370198_1792086 Arabidopsis thaliana putative serine carboxy...   448   e-124   
pir|B85358|B85358 SERINE CARBOXYPEPTIDASE II-like protein [impor...   446   e-124   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00221_1696957 Oryza sativa genomic DNA, chromosome 4, BAC...   438   e-121   
gb:AP004094_1837601 Oryza sativa (japonica cultivar-group) genom...   436   e-121   
pir|B96637|B96637 hypothetical protein F11P17.14 [imported] - Ar...   431   e-119   Arabidopsis thaliana [mouse-ear cress]
pir|D84631|D84631 probable serine carboxypeptidase II [imported]...   430   e-119   Arabidopsis thaliana [mouse-ear cress]
gb:AP005750_1857143 Oryza sativa (japonica cultivar-group) genom...   429   e-119   
pir|H84772|H84772 probable serine carboxypeptidase II [imported]...   427   e-118   Arabidopsis thaliana [mouse-ear cress]
pir|E84631|E84631 probable serine carboxypeptidase II [imported]...   427   e-118   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023668 Oryza sativa (japonica cultivar-group) chrom...   426   e-117   
gb:AC051633_1540157 Oryza sativa chromosome 10 BAC OSJNBb0015I11...   424   e-117   
gb:AP004366_1840850 Oryza sativa (japonica cultivar-group) genom...   418   e-115   
gb:AP003225_1825630 Oryza sativa (japonica cultivar-group) genom...   417   e-115   
gb:AP002539_1822533 Oryza sativa (japonica cultivar-group) genom...   417   e-115   
pir|T50511|T50511 serine-type carboxypeptidase II-like protein -...   417   e-115   Arabidopsis thaliana [mouse-ear cress]
gb:AY088154_1573176 Arabidopsis thaliana clone 42069 mRNA, compl...   408   e-112   
gb:ATAC011664_1543341 Arabidopsis thaliana chromosome III BAC F1...   408   e-112   
gb:ATAC013483_1543561 Arabidopsis thaliana chromosome III BAC F1...   407   e-112   
gb:AC136522_1743266 Oryza sativa (japonica cultivar-group) chrom...   400   e-110   
gb:AY308957_1597860 Medicago truncatula putative serine carboxyp...   398   e-109   
gb:AP005184_1848974 Oryza sativa (japonica cultivar-group) genom...   398   e-109   
gb:AY050958_1562441 Arabidopsis thaliana putative serine carboxy...   396   e-109   
gb:AP003489_1829915 Oryza sativa (japonica cultivar-group) genom...   394   e-108   
sp|P55748|CP22_HORVU|CP22_HORVU Serine carboxypeptidase II-2 precursor (EC ...   391   e-107   Hordeum vulgare [barley]
pir|A29639|A29639 carboxypeptidase D (EC 3.4.16.6) - wheat            387   e-106   Triticum aestivum [Canadian hard winter wheat]
sp|P08819|CBP2_WHEAT|CBP2_WHEAT Serine carboxypeptidase II chains A and B (...   387   e-106   Triticum aestivum [Canadian hard winter wheat]
pir|G71414|G71414 hydroxymandelonitrile lyase (EC 4.1.2.11) chai...   385   e-105   Arabidopsis thaliana [mouse-ear cress]
pir|T05701|T05701 carboxypeptidase D (EC 3.4.16.6) precursor - b...   384   e-105   Hordeum vulgare [barley]
sp|P08818|CBP2_HORVU|CBP2_HORVU Serine carboxypeptidase II precursor (EC 3....   382   e-105   Hordeum vulgare [barley]
gb:AP004094_1837603 Oryza sativa (japonica cultivar-group) genom...   380   e-104   
sp|P52711|CP23_HORVU|CP23_HORVU Serine carboxypeptidase II-3 precursor (EC ...   377   e-103   Hordeum vulgare [barley]
gb:PSA251969_1701942 Pisum sativum mRNA for putative serine carb...   374   e-102   
pir|G84772|G84772 probable serine carboxypeptidase II [imported]...   372   e-101   Arabidopsis thaliana [mouse-ear cress]
gb:AY224473_1590675 Oryza sativa (japonica cultivar-group) isola...   369   e-100   
gb:AP004094_1837602 Oryza sativa (japonica cultivar-group) genom...   361   2e-98   
gb:AC103551_1737295 Oryza sativa chromosome 3 BAC OSJNBb0058G04 ...   357   4e-97   
gb:AP005755_1857275 Oryza sativa (japonica cultivar-group) genom...   357   6e-97   
gb:AC103551_1737296 Oryza sativa chromosome 3 BAC OSJNBb0058G04 ...   356   7e-97   
gb:SBI421152_1704871 Sorghum bicolor mRNA for hydroxynitrile lya...   356   9e-97   
gb:AC136522_1743265 Oryza sativa (japonica cultivar-group) chrom...   355   2e-96   
pir|T49188|T49188 serin carboxypeptidase-like protein - Arabidop...   353   5e-96   Arabidopsis thaliana [mouse-ear cress]
gb:AP005755_1857272 Oryza sativa (japonica cultivar-group) genom...   344   4e-93   
pir|F85360|F85360 SERINE CARBOXYPEPTIDASE II-like protein [impor...   336   8e-91   Arabidopsis thaliana [mouse-ear cress]
gb:AP004069_1837210 Oryza sativa (japonica cultivar-group) genom...   334   3e-90   
gb:AC136522_1743268 Oryza sativa (japonica cultivar-group) chrom...   323   7e-87   
pir|T49081|T49081 serine-type carboxypeptidase like protein - Ar...   322   2e-86   Arabidopsis thaliana [mouse-ear cress]
pir|T49079|T49079 serine-type carboxypeptidase like protein - Ar...   322   2e-86   Arabidopsis thaliana [mouse-ear cress]
gb:AF061282_1765198 Sorghum bicolor 22 kDa kafirin cluster.           316   8e-85   
pir|B84472|B84472 probable serine carboxypeptidase II [imported]...   316   1e-84   Arabidopsis thaliana [mouse-ear cress]
pir|G96501|G96501 probable serine carboxypeptidases [imported] -...   312   2e-83   Arabidopsis thaliana [mouse-ear cress]
gb:BT003902_1637028 Arabidopsis thaliana clone RAFL15-18-D10 (R2...   305   2e-81   
pir|T49080|T49080 serine-type carboxypeptidase like protein - Ar...   305   2e-81   Arabidopsis thaliana [mouse-ear cress]
pir|D84503|D84503 probable serine carboxypeptidase II [imported]...   302   2e-80   Arabidopsis thaliana [mouse-ear cress]
gb:AB023032_1515330 Arabidopsis thaliana genomic DNA, chromosome...   300   6e-80   
pir|H86406|H86406 probable serine carboxypeptidase II [imported]...   298   3e-79   Arabidopsis thaliana [mouse-ear cress]
pir|F84746|F84746 probable serine carboxypeptidase II [imported]...   298   3e-79   Arabidopsis thaliana [mouse-ear cress]
gb:AY074317_1567474 Arabidopsis thaliana putative serine carboxy...   296   7e-79   
gb:AY059854_1564698 Arabidopsis thaliana serine carboxypeptidase...   296   9e-79   
gb:OSJN00240_1697235 Oryza sativa genomic DNA, chromosome 4, BAC...   296   1e-78   
gb:AB023032_1515329 Arabidopsis thaliana genomic DNA, chromosome...   295   3e-78   
gb:BT004306_1637382 Arabidopsis thaliana clone RAFL15-29-H20 (R2...   289   1e-76   
sp|P55747|CP21_HORVU|CP21_HORVU Serine carboxypeptidase II-1 precursor (EC ...   275   2e-72   Hordeum vulgare [barley]
gb:AF061282_1765201 Sorghum bicolor 22 kDa kafirin cluster.           271   3e-71   
gb:AY136365_1581866 Arabidopsis thaliana serine carboxypeptidase...   264   4e-69   
gb:AB025639_1516683 Arabidopsis thaliana genomic DNA, chromosome...   263   6e-69   
pir|S53311|S53311 hydroxymandelonitrile lyase (EC 4.1.2.11) chai...   261   3e-68   Sorghum bicolor [broomcorn]
sp|P37890|CBP1_ORYSA|CBP1_ORYSA Serine carboxypeptidase I precursor (EC 3.4...   258   2e-67   Oryza sativa [red rice]
sp|P52708|HNLS_SORBI|HNLS_SORBI P-(S)-hydroxymandelonitrile lyase precursor...   256   1e-66   Sorghum bicolor [broomcorn]
sp|P07519|CBP1_HORVU|CBP1_HORVU Serine carboxypeptidase I precursor (EC 3.4...   255   2e-66   Hordeum vulgare [barley]
gb:AF242849_1780201 Lycopersicon esculentum wound-inducible carb...   254   5e-66   
sp|Q09991|YSS2_CAEEL|YSS2_CAEEL Putative serine carboxypeptidase K10B2.2 pr...   244   3e-63   Caenorhabditis elegans [roundworm]
sp|P42661|NF31_NAEFO|NF31_NAEFO Virulence-related protein Nf314 (EC 3.4.16....   241   4e-62   Naegleria fowleri [brain-eating amoeba]
gb:BC082950_2563019 Xenopus laevis hypothetical LOC494810, mRNA ...   238   2e-61   
pir|A85139|A85139 hypothetical protein AT4g12910 [imported] - Ar...   238   2e-61   Arabidopsis thaliana [mouse-ear cress]
gb:AJ720789_2502976 Gallus gallus mRNA for hypothetical protein,...   238   3e-61   
gb:OSJN00208_1696721 Oryza sativa genomic DNA, chromosome 4, BAC...   235   2e-60   
gb:AY280669_1315649 Branchiostoma belcheri tsingtaunese cathepsi...   229   2e-58   
gb:BC056531_2551805 Danio rerio zgc:65802, mRNA (cDNA clone MGC:...   226   1e-57   
gb:BC018534_2092764 Mus musculus protective protein for beta-gal...   219   1e-55   
gb:AK019861_1160222 Mus musculus 11 days pregnant adult female o...   219   1e-55   
sp|P16675|PRTP_MOUSE|PRTP_MOUSE Lysosomal protective protein precursor (EC ...   219   2e-55   Mus musculus [mouse]
sp|P52717|YUW5_CAEEL|YUW5_CAEEL Putative serine carboxypeptidase F41C3.5 pr...   218   2e-55   Caenorhabditis elegans [roundworm]
sp|P52715|YUA6_CAEEL|YUA6_CAEEL Putative serine carboxypeptidase F13S12.6 p...   214   4e-54   Caenorhabditis elegans [roundworm]
pir|A31589|A31589 carboxypeptidase C (EC 3.4.16.5) precursor - h...   213   1e-53   Homo sapiens [man]
gb:HS337O18_1998140 Human DNA sequence from clone RP3-337O18 on ...   212   2e-53   
gb:HS337O18_1998139 Human DNA sequence from clone RP3-337O18 on ...   212   2e-53   
gb:AF248647_1780666 Lycopersicon pennellii glucose acyltransfera...   212   2e-53   
sp|P10619|PRTP_HUMAN|PRTP_HUMAN Lysosomal protective protein precursor (EC ...   212   2e-53   Homo sapiens [man]
gb:BC000597_1966866 Homo sapiens protective protein for beta-gal...   211   4e-53   
gb:CR860232_1184319 Pongo pygmaeus mRNA; cDNA DKFZp469O2419 (fro...   210   8e-53   
gb:AF061282_1765199 Sorghum bicolor 22 kDa kafirin cluster.           207   4e-52   
gb:U39852_1403143 Caenorhabditis elegans cosmid K10C2, complete ...   204   6e-51   
gb:AF006078_1760851 Solanum berthaultii glucose acyltransferase ...   203   8e-51   
gb:AF006080_1760853 Solanum berthaultii glucose acyltransferase ...   202   2e-50   
gb:BLYCBX_1633132 H.vulgare (barley) carboxypeptidase I mRNA, 3'...   201   4e-50   
pir|T25810|T25810 hypothetical protein K10C2.1 - Caenorhabditis ...   201   5e-50   Caenorhabditis elegans [roundworm]
gb:OSJN00121_1695240 Oryza sativa genomic DNA, chromosome 4, BAC...   199   1e-49   
pir|T33463|T33463 probable serine carboxypeptidase (EC 3.4.16.-)...   195   2e-48   Caenorhabditis elegans [roundworm]
gb:BC078934_2107081 Rattus norvegicus protective protein for bet...   191   3e-47   
sp|P52714|YXD2_CAEEL|YXD2_CAEEL Putative serine carboxypeptidase C08H9.1 (E...   191   4e-47   Caenorhabditis elegans [roundworm]
pir|C84619|C84619 probable serine carboxypeptidase I [imported] ...   191   5e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1020561 Oryza sativa (japonica cultivar-group) chrom...   190   9e-47   
pir|T18968|T18968 probable serine-type carboxypeptidase (EC 3.4....   189   1e-46   Caenorhabditis elegans [roundworm]
gb:AC004401_1531648 Arabidopsis thaliana chromosome 2 clone F21P...   189   2e-46   
pir|A96759|A96759 protein serine carboxypeptidase T18K17.5 [impo...   188   3e-46   Arabidopsis thaliana [mouse-ear cress]
pir|T49055|T49055 serine carboxypeptidase-like protein - Arabido...   187   6e-46   Arabidopsis thaliana [mouse-ear cress]
pir|B96759|B96759 protein serine carboxypeptidase T18K17.4 [impo...   186   1e-45   Arabidopsis thaliana [mouse-ear cress]
pir|C86459|C86459 probable serine carboxypeptidase, 88458-86107 ...   186   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AC011560_1537254 Arabidopsis thaliana chromosome 3 BAC F13M14...   186   2e-45   
gb:AF006079_1760852 Solanum berthaultii glucose acyltransferase ...   185   2e-45   
sp|P38109|YBY9_YEAST|YBY9_YEAST Putative serine carboxypeptidase in ESR1-IR...   185   2e-45   Saccharomyces cerevisiae [brewer's yeast]
pir|E84618|E84618 probable serine carboxypeptidase I [imported] ...   184   4e-45   Arabidopsis thaliana [mouse-ear cress]
pir|A84619|A84619 probable serine carboxypeptidase II [imported]...   184   4e-45   Arabidopsis thaliana [mouse-ear cress]
pir|H96758|H96758 protein serine carboxypeptidase T18K17.6 [impo...   183   8e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AY383718_1604128 Brassica napus 1-O-sinapoylglucose:choline s...   182   2e-44   
gb:AC069472_1540870 Arabidopsis thaliana chromosome 3 BAC F28J15...   182   2e-44   
pir|T48977|T48977 carboxypeptidase-like protein F14D17.80 [impor...   181   5e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AY057639_1564052 Arabidopsis thaliana AT3g45010/F14D17_80 mRN...   180   7e-44   
gb:AB005243_1509545 Arabidopsis thaliana genomic DNA, chromosome...   180   9e-44   
gb:CR548612_1375165 Paramecium tetraurelia macronuclear largest ...   180   9e-44   
pir|C96759|C96759 protein serine carboxypeptidase T18K17.3 [impo...   179   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb:AY072822_1567406 Gossypium hirsutum putative serine carboxype...   176   1e-42   
pir|D84619|D84619 probable serine carboxypeptidase I [imported] ...   175   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AE016818_1748170 Ashbya gossypii (= Eremothecium gossypii) AT...   175   3e-42   
gb:AY436353_1606115 Aspergillus fumigatus carboxypeptidase 3 gen...   175   3e-42   
sp|P52710|CBPY_PICPA|CBPY_PICPA Carboxypeptidase Y precursor (EC 3.4.16.5) ...   174   4e-42   Komagataella pastoris
pir|E84619|E84619 probable serine carboxypeptidase I [imported] ...   174   5e-42   Arabidopsis thaliana [mouse-ear cress]
sp|P32826|CBPX_ARATH|CBPX_ARATH Serine carboxypeptidase precursor (EC 3.4.1...   174   5e-42   Arabidopsis thaliana [mouse-ear cress]
gb:CR382129_1662174 Yarrowia lipolytica chromosome C of strain C...   174   7e-42   
gb:CR382127_1660225 Yarrowia lipolytica chromosome A of strain C...   174   7e-42   
gb:ATHCPYLP_1553131 Arabidopsis thaliana carboxypeptidase Y-like...   174   7e-42   
pir|B84619|B84619 probable serine carboxypeptidase I [imported] ...   174   7e-42   Arabidopsis thaliana [mouse-ear cress]
pir|JC1380|JC1380 carboxypeptidase C (EC 3.4.16.5) precursor - y...   174   7e-42   Candida albicans
gb:CR380959_1654243 Candida glabrata strain CBS138 chromosome M ...   173   9e-42   
gb:AC010556_1536957 Arabidopsis thaliana chromosome 1 BAC T18K17...   173   9e-42   
sp|P30574|CBPY_CANAL|CBPY_CANAL Carboxypeptidase Y precursor (EC 3.4.16.5) ...   173   9e-42   Candida albicans
gb:AY093044_1574998 Arabidopsis thaliana serine carboxypeptidase...   172   1e-41   
gb:HS337O18_1998143 Human DNA sequence from clone RP3-337O18 on ...   172   2e-41   
gb:CR382136_1668687 Debaryomyces hansenii chromosome D of strain...   172   3e-41   
gb:TCA313514_1724861 Theobroma cacao mRNA for carboxypeptidase t...   171   3e-41   
gb:AY033947_1559549 Arabidopsis thaliana sinapoylglucose:choline...   171   4e-41   
pir|S51516|S51516 serine-type carboxypeptidase (EC 3.4.16.-) Z p...   171   6e-41   Lentamyces zychae
gb:AY063833_1565782 Arabidopsis thaliana putative carboxypeptida...   170   1e-40   
pir|JC7666|JC7666 serine-type carboxypeptidase homolog precursor...   170   1e-40   Aspergillus nidulans
sp|P21529|CBP3_HORVU|CBP3_HORVU Serine carboxypeptidase III precursor (EC 3...   170   1e-40   Hordeum vulgare [barley]
gb:AP004299_1839763 Oryza sativa (japonica cultivar-group) genom...   169   1e-40   
gb:CR382121_1654697 Kluyveromyces lactis strain NRRL Y-1140 chro...   169   1e-40   
gb:AC069472_1540872 Arabidopsis thaliana chromosome 3 BAC F28J15...   169   1e-40   
pir|A35275|A35275 carboxypeptidase C (EC 3.4.16.5) - barley           169   1e-40   Hordeum vulgare [barley]
gb:CR382135_1668312 Debaryomyces hansenii chromosome C of strain...   169   2e-40   
gb:AY497024_1609150 Trichophyton rubrum carboxypeptidase Y gene,...   169   2e-40   
sp|P52712|CBPX_ORYSA|CBPX_ORYSA Serine carboxypeptidase-like precursor (EC ...   169   2e-40   Oryza sativa [red rice]
gb:A75535_1450610 Sequence 2 from Patent WO9400579.>gb:CR382125_...   168   3e-40   
sp|O13849|CBPY_SCHPO|CBPY_SCHPO Carboxypeptidase Y precursor (EC 3.4.16.5) ...   168   4e-40   Schizosaccharomyces pombe
gb:NCB7H23_1690174 Neurospora crassa DNA linkage group V BAC con...   167   5e-40   
gb:AB018112_1513782 Arabidopsis thaliana genomic DNA, chromosome...   167   5e-40   
sp|P37891|CBP3_ORYSA|CBP3_ORYSA Serine carboxypeptidase III precursor (EC 3...   166   1e-39   Oryza sativa [red rice]
gb:AC120983_1739976 Oryza sativa chromosome 3 BAC OSJNBb0011H13 ...   166   1e-39   
pir|A29412|A29412 carboxypeptidase C (EC 3.4.16.5) precursor - w...   166   1e-39   Triticum aestivum [Canadian hard winter wheat]
sp|P11515|CBP3_WHEAT|CBP3_WHEAT Serine carboxypeptidase III precursor (EC 3...   166   1e-39   Triticum aestivum [Canadian hard winter wheat]
gb:AP004096_1837657 Oryza sativa (japonica cultivar-group) genom...   166   2e-39   
gb:AF141384_1771585 Matricaria chamomilla serine carboxypeptidas...   166   2e-39   
gb:AF083796_1767026 Arabidopsis thaliana clone sps894 unknown mRNA.   166   2e-39   
gb:AE017354_461243 Legionella pneumophila subsp. pneumophila str...   166   2e-39   
gb:AE016820_1749627 Ashbya gossypii (= Eremothecium gossypii) AT...   165   3e-39   
gb:AE017346_1757516 Cryptococcus neoformans var. neoformans JEC2...   164   4e-39   
gb:AP002047_1821632 Arabidopsis thaliana genomic DNA, chromosome...   164   7e-39   
sp|P52716|YPP3_CAEEL|YPP3_CAEEL Putative serine carboxypeptidase F32A5.3 pr...   164   7e-39   Caenorhabditis elegans [roundworm]
gb:AC120983_1739972 Oryza sativa chromosome 3 BAC OSJNBb0011H13 ...   162   3e-38   
gb:AC069472_1540873 Arabidopsis thaliana chromosome 3 BAC F28J15...   161   3e-38   
gb:AY184244_1308371 Trypanosoma cruzi serine carboxypeptidase pr...   161   3e-38   
sp|P00729|CBPY_YEAST|CBPY_YEAST Carboxypeptidase Y precursor (EC 3.4.16.5) ...   159   1e-37   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382129_1662267 Yarrowia lipolytica chromosome C of strain C...   158   4e-37   
gb:AB020752_1514673 Arabidopsis thaliana genomic DNA, chromosome...   157   5e-37   
gb:AX083419_1460838 Sequence 111 from Patent WO0112660.               157   6e-37   
gb:CR857214_1181461 Pongo pygmaeus mRNA; cDNA DKFZp469A0432 (fro...   157   6e-37   
sp|Q9H3G5|CPVL_HUMAN|CPVL_HUMAN Probable serine carboxypeptidase CPVL precu...   157   6e-37   Homo sapiens [man]
gb:AP002047_1821630 Arabidopsis thaliana genomic DNA, chromosome...   157   8e-37   
gb:BC016838_1975749 Homo sapiens carboxypeptidase, vitellogenic-...   156   1e-36   
gb:AY358549_1947428 Homo sapiens clone DNA33206 CPVL (UNQ197) mR...   155   2e-36   
gb:AF282617_1894630 Homo sapiens vitellogenic carboxypeptidase-l...   155   2e-36   
gb:AX136207_1461983 Sequence 129 from Patent EP1067182.>gb:AK075...   155   2e-36   
gb:CR382128_1660399 Yarrowia lipolytica chromosome B of strain C...   155   3e-36   
gb:CR382130_1662680 Yarrowia lipolytica chromosome D of strain C...   153   1e-35   
gb:AF085063_1767107 Pichia angusta carboxypeptidase Y precursor ...   152   3e-35   
gb:CR382132_1665434 Yarrowia lipolytica chromosome F of strain C...   150   6e-35   
gb:AE016959_1020563 Oryza sativa (japonica cultivar-group) chrom...   150   8e-35   
gb:CR382128_1660547 Yarrowia lipolytica chromosome B of strain C...   150   1e-34   
gb:PAU67174_1698928 Pichia angusta carboxypeptidase Y (CPY) gene...   149   1e-34   
gb:AC069472_1540874 Arabidopsis thaliana chromosome 3 BAC F28J15...   149   2e-34   
gb:AP002047_1821631 Arabidopsis thaliana genomic DNA, chromosome...   147   9e-34   
pir|D96759|D96759 probable serine carboxypeptidase T9L24.47 [imp...   147   9e-34   Arabidopsis thaliana [mouse-ear cress]
gb:BT003126_1636707 Arabidopsis thaliana At3g63470 mRNA, complet...   145   2e-33   
gb:HS337O18_1998142 Human DNA sequence from clone RP3-337O18 on ...   144   4e-33   
gb:CR382123_1656244 Kluyveromyces lactis strain NRRL Y-1140 chro...   143   1e-32   
gb:CR382128_1661203 Yarrowia lipolytica chromosome B of strain C...   142   2e-32   
gb:BC051154_2550407 Danio rerio carboxypeptidase, vitellogenic-l...   142   2e-32   
gb:KLA551275_1683559 Kluyveromyces lactis pcl1 gene for putative...   142   2e-32   
gb:CR382130_1662637 Yarrowia lipolytica chromosome D of strain C...   142   2e-32   
gb:AY143880_1583337 Arabidopsis thaliana At2g22990/T20K9.20 mRNA...   142   2e-32   
gb:AP002047_1821628 Arabidopsis thaliana genomic DNA, chromosome...   141   4e-32   
gb:AC116957_1206715 Dictyostelium discoideum chromosome 2 map 16...   138   3e-31   
gb:AC098573_1736774 Oryza sativa (japonica cultivar-group) chrom...   137   5e-31   
gb:AP005514_1853228 Oryza sativa (japonica cultivar-group) genom...   136   1e-30   
gb:CR382129_1661351 Yarrowia lipolytica chromosome C of strain C...   135   3e-30   
gb:AE017351_1759483 Cryptococcus neoformans var. neoformans JEC2...   134   4e-30   
pir|T49934|T49934 carboxypeptidase-like protein - Arabidopsis th...   133   1e-29   Arabidopsis thaliana [mouse-ear cress]
sp|P34946|CPS1_PENJA|CPS1_PENJA Carboxypeptidase S1 (EC 3.4.16.6).>pir|S389...   133   1e-29   Penicillium janthinellum
gb:AK017087_1159016 Mus musculus adult male testis cDNA, RIKEN f...   133   1e-29   
pir|D86283|D86283 T15D22.4 protein - Arabidopsis thaliana>gb:AE0...   126   2e-27   Arabidopsis thaliana [mouse-ear cress]
pir|T39601|T39601 serine carboxypeptidase-like protein - fission...   125   4e-27   Schizosaccharomyces pombe
gb:AP001633_1821371 Oryza sativa (japonica cultivar-group) genom...   124   8e-27   
gb:AE016819_1749384 Ashbya gossypii (= Eremothecium gossypii) AT...   124   8e-27   
gb:CAR271659_1645180 Cicer arietinum partial mRNA for serine car...   122   3e-26   
sp|P09620|KEX1_YEAST|KEX1_YEAST Carboxypeptidase KEX1 precursor (EC 3.4.16....   121   5e-26   Saccharomyces cerevisiae [brewer's yeast]
gb:AC120983_1739975 Oryza sativa chromosome 3 BAC OSJNBb0011H13 ...   120   7e-26   
gb:A16772_1447683 ysc alpha gene (coding for a soluble protein) ...   119   3e-25   
gb:AY310135_1318075 Trypanosoma cruzi serine carboxypeptidase CB...   119   3e-25   
pir|A41612|A41612 vitellogenic carboxypeptidase (EC 3.4.16.-) pr...   118   3e-25   Aedes aegypti
sp|P42660|VCP_AEDAE|VCP_AEDAE Vitellogenic carboxypeptidase precursor (EC ...   117   6e-25   Aedes aegypti
gb:AY436352_1606114 Aspergillus fumigatus carboxypeptidase 2 gen...   116   2e-24   
gb:CR380953_1650668 Candida glabrata strain CBS138 chromosome G ...   115   2e-24   
gb:AE014297_1140378 Drosophila melanogaster chromosome 3R, compl...   114   8e-24   
gb:AY290720_1595601 Triticum aestivum carboxypeptidase D mRNA, p...   112   2e-23   
gb:AC098573_1736773 Oryza sativa (japonica cultivar-group) chrom...   112   3e-23   
gb:AP002839_1823054 Oryza sativa (japonica cultivar-group) genom...   110   9e-23   
gb:AF095574_1767767 Pichia pastoris carboxypeptidase kex1 precur...   110   9e-23   
gb:AY190960_1308897 Drosophila pseudoobscura clone DPSF01_12_K22...   110   1e-22   
gb:AE016920_357973 Chromobacterium violaceum ATCC 12472 section ...   109   2e-22   
gb:AY087352_1572384 Arabidopsis thaliana clone 34525 mRNA, compl...   108   3e-22   
gb:BT016041_1358486 Drosophila melanogaster LP20617 full insert ...   108   3e-22   
gb:AE014296_1134046 Drosophila melanogaster chromosome 3L, compl...   108   3e-22   
gb:AC098573_1736772 Oryza sativa (japonica cultivar-group) chrom...   108   4e-22   
gb:AF394242_1795427 Aspergillus oryzae strain TK3 carboxypeptida...   107   6e-22   
gb:AY497022_1609148 Trichophyton rubrum carboxypeptidase S1 gene...   106   1e-21   
gb:BC004847_2089835 Mus musculus serine carboxypeptidase 1, mRNA...   105   4e-21   
gb:AK014680_1158089 Mus musculus 0 day neonate head cDNA, RIKEN ...   105   4e-21   
sp|Q920A5|RISC_MOUSE|RISC_MOUSE Retinoid-inducible serine carboxypeptidase ...   105   4e-21   Mus musculus [mouse]
gb:NCB11H7_1689053 Neurospora crassa DNA linkage group V BAC clo...   104   6e-21   
gb:AY433801_1605990 Aspergillus fumigatus carboxypeptidase 1 gen...   102   2e-20   
sp|Q920A6|RISC_RAT|RISC_RAT Retinoid-inducible serine carboxypeptidase pr...   102   2e-20   Rattus norvegicus [brown rat]
gb:CR382126_1658799 Kluyveromyces lactis strain NRRL Y-1140 chro...   102   3e-20   
gb:AB005243_1509543 Arabidopsis thaliana genomic DNA, chromosome...   101   4e-20   
gb:AE014296_1134045 Drosophila melanogaster chromosome 3L, compl...   101   5e-20   
gb:AF483728_1275692 Ixodes scapularis clone ISL1316_cluster379 p...   100   9e-20   
gb:BC045898_2549415 Danio rerio zgc:56081, mRNA (cDNA clone MGC:...    99   2e-19   
gb:AE017345_1756675 Cryptococcus neoformans var. neoformans JEC2...    99   2e-19   
gb:VRU49741_1727380 Vigna radiata clone pJJ12 serine carboxypept...    99   2e-19   
pir|T10858|T10858 probable carboxypeptidase C (EC 3.4.16.5) - mu...    99   2e-19   Vigna radiata [mung bean]
gb:CEY32F6A_1369598 Caenorhabditis elegans YAC Y32F6A, complete ...    99   3e-19   
pir|T21275|T21275 hypothetical protein F22E12.1 - Caenorhabditis...    99   3e-19   Caenorhabditis elegans [roundworm]
gb:AP005524_1853451 Oryza sativa (japonica cultivar-group) genom...    99   4e-19   
gb:BC066718_2554555 Danio rerio zgc:56081, mRNA (cDNA clone MGC:...    98   5e-19   
gb:AY436354_1606116 Aspergillus fumigatus carboxypeptidase 4 gen...    95   5e-18   
gb:AF462228_1801881 Narcissus pseudonarcissus putative serine ca...    94   7e-18   
gb:AE014134_1129330 Drosophila melanogaster chromosome 2L, compl...    94   7e-18   
sp|Q9HB40|RISC_HUMAN|RISC_HUMAN Retinoid-inducible serine carboxypeptidase ...    94   9e-18   Homo sapiens [man]
gb:DROSADH08_1382854 Drosophila melanogaster, chromosome 2L, reg...    94   1e-17   
gb:AC006929_1534804 Arabidopsis thaliana chromosome 2 clone T1E2...    92   3e-17   
gb:AF113214_1149837 Homo sapiens MSTP034 mRNA, complete cds.           92   3e-17   
gb:BC087391_2565234 Xenopus laevis hypothetical LOC496001, mRNA ...    92   3e-17   
gb:AE017344_1756129 Cryptococcus neoformans var. neoformans JEC2...    91   7e-17   
gb:AE017343_1755823 Cryptococcus neoformans var. neoformans JEC2...    91   7e-17   
gb:AY232097_1177390 Drosophila yakuba clone yak-ad_CG3344 mRNA s...    91   1e-16   
gb:AC099323_1737057 Oryza sativa chromosome 3 BAC OSJNBa0065F09 ...    90   1e-16   
gb:AC097279_1736570 Oryza sativa chromosome 3 BAC OSJNBa0093I13 ...    90   1e-16   
gb:AY752800_1179943 Culicoides sonorensis clone CsCPC1 carboxype...    90   2e-16   
gb:AF217508_1150581 Homo sapiens uncharacterized bone marrow pro...    90   2e-16   
pir|S55328|S55328 serine-type carboxypeptidase (EC 3.4.16.-) pre...    90   2e-16   Aspergillus phoenicis
pir|S78072|S78072 serine-type carboxypeptidase (EC 3.4.16.-) I -...    90   2e-16   Aspergillus niger
sp|P52719|PEPS_ASPSA|PEPS_ASPSA Carboxypeptidase cpdS precursor (EC 3.4.16....    90   2e-16   Aspergillus phoenicis
gb:AY497023_1609149 Trichophyton rubrum carboxypeptidase S1' gen...    88   6e-16   
gb:AY436355_1606117 Aspergillus fumigatus carboxypeptidase 5 gen...    87   8e-16   
gb:AC007096_1875211 Homo sapiens BAC clone RP11-306F13 from 7, c...    86   2e-15   
gb:U28730_1402484 Caenorhabditis elegans cosmid K10B2, complete ...    86   2e-15   
gb:AC097279_1736581 Oryza sativa chromosome 3 BAC OSJNBa0093I13 ...    86   3e-15   
gb:AE014134_1129331 Drosophila melanogaster chromosome 2L, compl...    86   3e-15   
gb:VRU49382_1727378 Vigna radiata clone pKL054 serine carboxypep...    85   4e-15   
pir|T10856|T10856 carboxypeptidase C (EC 3.4.16.5) - mung bean (...    85   4e-15   
sp|P52718|PEPF_ASPNG|PEPF_ASPNG Serine-type carboxypeptidase F precursor (E...    85   4e-15   
gb:AE017344_1756018 Cryptococcus neoformans var. neoformans JEC2...    85   5e-15   
pir|S57907|S57907 carboxypeptidase D (EC 3.4.16.6) precursor - A...    82   3e-14   
gb:AX616319_1471394 Sequence 3 from Patent WO02094864.                 82   3e-14   
sp|P32825|SXA2_SCHPO|SXA2_SCHPO Carboxypeptidase sxa2 precursor (EC 3.4.16....    81   6e-14   
gb:CR548612_1375613 Paramecium tetraurelia macronuclear largest ...    80   1e-13   
gb:AE017350_1759255 Cryptococcus neoformans var. neoformans JEC2...    79   3e-13   
pir|S57294|S57294 carboxypeptidase D (EC 3.4.16.6) - Penicillium...    76   2e-12   
sp|Q41005|CBPX_PEA|CBPX_PEA Serine carboxypeptidase-like (EC 3.4.16.-) (F...    76   2e-12   
gb:BT000529_1634807 Arabidopsis thaliana putative serine carboxy...    75   3e-12   
gb:AC005162_1874854 Homo sapiens BAC clone CTB-113D17 from 7, co...    75   4e-12   
pir|S62370|S62370 probable carboxypeptidase C (EC 3.4.16.5) - ga...    74   1e-11   
gb:AY448010S4_1606594 Ipomoea trifida haplotype S1 self-incompat...    73   2e-11   
gb:AC004786_1532167 Arabidopsis thaliana chromosome 2 clone T20K...    65   3e-09   
gb:AC004401_1531645 Arabidopsis thaliana chromosome 2 clone F21P...    65   3e-09   
gb:AP004862_1846150 Oryza sativa (japonica cultivar-group) genom...    62   5e-08   
gb:AY223316_1176776 Schistosoma japonicum clone ZZD627 mRNA sequ...    56   2e-06   
gb:AE016959_1020564 Oryza sativa (japonica cultivar-group) chrom...    56   2e-06   
pir|E84678|E84678 probable carboxypeptidase [imported] - Arabido...    56   2e-06   
gb:AY310135_1318076 Trypanosoma cruzi serine carboxypeptidase CB...    50   2e-04   
gb:AY093062_1575016 Arabidopsis thaliana putative serine carboxy...    47   0.001   
gb:PSA251970_1701943 Pisum sativum mRNA for putative serine carb...    45   0.004   
gb:BA000040_733774 Bradyrhizobium japonicum USDA 110 DNA, comple...    45   0.004   
gb:AE012555_283958 Xylella fastidiosa Temecula1, section 3 of 9 ...    45   0.006   
pir|E82699|E82699 carboxypeptidase related protein XF1282 [impor...    45   0.006   
gb:AY389693_1178311 Hyacinthus orientalis serine carboxypeptidas...    44   0.014   
pir|H87672|H87672 conserved hypothetical protein CC3418 [importe...    43   0.018   
gb:AK176585_1818573 Arabidopsis thaliana mRNA for putative carbo...    42   0.040   
gb:AE011803_276651 Xanthomonas axonopodis pv. citri str. 306, se...    42   0.052   
gb:BX572594_799960 Rhodopseudomonas palustris CGA009 complete ge...    41   0.068   
gb:AE012270_280943 Xanthomonas campestris pv. campestris str. AT...    39   0.26    
gb:AF265441_1893778 Homo sapiens DC39 mRNA, complete cds.              39   0.44    
gb:AK175926_1817914 Arabidopsis thaliana mRNA for putative carbo...    37   0.98    
gb:AE013598_296673 Xanthomonas oryzae pv. oryzae KACC10331, comp...    37   1.7     
pir|C75455|C75455 carboxypeptidase-related protein - Deinococcus...    36   2.2     
gb:AE008692_241029 Zymomonas mobilis subsp. mobilis ZM4, complet...    35   4.8     
gb:D90724_121637 Escherichia coli K12 genomic DNA. (19.4 - 19.8 ...    35   4.8     
pir|E64825|E64825 ybjT protein - Escherichia coli (strain K-12)>...    35   4.8     
sp|P75822|YBJT_ECOLI|YBJT_ECOLI Hypothetical protein ybjT.                        35   4.8     
gb:AY496068_2352076 Parietaria mottle virus segment RNA 1, compl...    34   8.3     


>gb:AP003537_1830561 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1140D12.
          Length = 500

 Score =  600 bits (1547), Expect = e-170
 Identities = 282/457 (61%), Positives = 351/457 (76%), Gaps = 2/457 (0%)
 Frame = -2

Query: 1623 CAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKP 1444
            C  ++     QE+D++ +LPGQPS+P ++ FSGYITVN+ +GRALFYWFFEA++ PS KP
Sbjct: 48   CYAAAGYNEQQEADRVAFLPGQPSSPKVSQFSGYITVNRQNGRALFYWFFEAQALPSQKP 107

Query: 1443 LVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSY 1264
            L+LWLNGGPGCSS+GYGAA+ELGPLRV RNG GL FNK++WNKEANLLF+ESPVGVGFSY
Sbjct: 108  LLLWLNGGPGCSSVGYGAASELGPLRVSRNGAGLEFNKFAWNKEANLLFLESPVGVGFSY 167

Query: 1263 TNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDR 1084
            TN         D FVA+D YNFLVNWL+RFPQ+K H+F+I+GESYAGHYVPQLA++V++R
Sbjct: 168  TNTSSDLTKLNDGFVAEDAYNFLVNWLDRFPQYKDHEFYISGESYAGHYVPQLADLVYER 227

Query: 1083 NRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENW 904
            N+D+     I LKGFIVGNP T+D YD KGL+EYAWSHA++SD  Y++ K+VC+F   NW
Sbjct: 228  NKDKKANRYIKLKGFIVGNPLTDDQYDSKGLVEYAWSHAVVSDGIYERVKKVCNFKISNW 287

Query: 903  SDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMK 724
            ++ CNEAMS +F +Y+EIDIYNIY P+C L  +S         D AL   ++    RR+ 
Sbjct: 288  TNDCNEAMSSIFRQYQEIDIYNIYAPKCNLAQTSRV----AAFDHALEASDQEQFSRRI- 342

Query: 723  RIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRA--PGSTVNWKTCSDPVFRAYKYTTFSL 550
            R+  GYD CYS YAE+YFN+ DVQKAFHAN     PG    WK CSD + R+Y ++  S+
Sbjct: 343  RMFSGYDACYSSYAEKYFNKPDVQKAFHANANGMLPG---KWKVCSDSILRSYNFSVLSV 399

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVE 370
            LP+Y KLIK GL+IW+YSGDADGRVPVIGSRYC+EAL L +K  W+ W+ N QV GR VE
Sbjct: 400  LPIYSKLIKAGLRIWLYSGDADGRVPVIGSRYCVEALGLHIKRDWQPWYLNRQVAGRFVE 459

Query: 369  YHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            Y G+T VT+RGAGHLVPLNKP E L LI +FL G++L
Sbjct: 460  YDGMTMVTIRGAGHLVPLNKPEEGLTLIDTFLLGKQL 496



>gb:AC119288_1739617 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0017J22, complete sequence.
          Length = 482

 Score =  597 bits (1539), Expect = e-169
 Identities = 275/450 (61%), Positives = 353/450 (78%), Gaps = 4/450 (0%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPS--NKPLVLWLNGG 1420
            QE+D++  LPGQP++P ++ F+GY+ V++ HGRALFYWFFEA++ P+   KPL+LWLNGG
Sbjct: 39   QEADRVARLPGQPASPAVSQFAGYVGVDERHGRALFYWFFEAQASPAPEKKPLLLWLNGG 98

Query: 1419 PGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXX 1240
            PGCSSIGYGAA+ELGPLRV R G  L FN+Y WNKEANLLF+ESPVGVGFSYTN      
Sbjct: 99   PGCSSIGYGAASELGPLRVARQGAALEFNQYGWNKEANLLFLESPVGVGFSYTNTSSDLS 158

Query: 1239 XXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYP 1060
               D FVA+D Y+FLVNW +RFPQ+K ++F+I+GESYAGHYVPQLA++V++RN+D+    
Sbjct: 159  NLNDDFVAEDAYSFLVNWFKRFPQYKDNEFYISGESYAGHYVPQLADLVYERNKDKRAST 218

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAM 880
             INLKGFIVGNP T+DYYD KGL EYAWSHAI+SDQ Y++ K+ C+F   NW+D CN AM
Sbjct: 219  YINLKGFIVGNPLTDDYYDSKGLAEYAWSHAIVSDQVYERIKKTCNFKNSNWTDDCNAAM 278

Query: 879  SIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDP 700
            +I+F++Y +IDIYNIY P+CLLN +S+++  R        N+E+   +R   ++  GYDP
Sbjct: 279  NIIFSQYNQIDIYNIYAPKCLLNSTSASSPDRAFF---ANNQEQ---FRWRIKMFSGYDP 332

Query: 699  CYSPYAEEYFNRIDVQKAFHANIRA--PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI 526
            CYS YAE+YFN+ DVQ+AFHAN     PG    W+ CSD +  +Y ++  S+LP+Y KLI
Sbjct: 333  CYSSYAEDYFNKHDVQEAFHANASGLLPG---KWQVCSDQILNSYNFSVLSILPIYSKLI 389

Query: 525  KGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVT 346
            K GL++W+YSGDADGRVPVI SRYC+EAL LP+K+ W+SW+ + QV GR VEYHG+T VT
Sbjct: 390  KAGLRVWLYSGDADGRVPVISSRYCVEALGLPIKTDWQSWYLDKQVAGRFVEYHGMTMVT 449

Query: 345  VRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            VRGAGHLVPLNKP+E L LI++FL GE+LP
Sbjct: 450  VRGAGHLVPLNKPAEGLMLINAFLHGEKLP 479



>gb:AB026636_1517072 Arabidopsis thaliana genomic DNA, chromosome 3,
            TAC clone:K14A17.
          Length = 472

 Score =  596 bits (1537), Expect = e-169
 Identities = 294/472 (62%), Positives = 351/472 (74%), Gaps = 3/472 (0%)
 Frame = -2

Query: 1659 FLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYW 1480
            FLL+  L+I +          AQ SDK+  LP QP  P ++HFSGY+ VNQ + R+LF+W
Sbjct: 6    FLLIISLLILLSLLHQDYHIEAQNSDKVVNLPEQPLNPKISHFSGYVNVNQENTRSLFFW 65

Query: 1479 FFEAKSH-PSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANL 1303
            FFEA S  PS +PLVLWLNGGPGCSSIGYGAA+ELGP RV  NG  L FN+YSW +EAN+
Sbjct: 66   FFEALSESPSTRPLVLWLNGGPGCSSIGYGAASELGPFRVVENGTSLSFNQYSWVQEANM 125

Query: 1302 LFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAG 1123
            LF+ESPVGVGFSYTN         D FVA+D YNF+V W  R+PQ+K  DFFIAGESYAG
Sbjct: 126  LFLESPVGVGFSYTNSSSDLENLNDAFVAEDAYNFMVAWFARYPQYKSRDFFIAGESYAG 185

Query: 1122 HYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYD 943
            HY PQLAE+++DRN+ +     INLKGFIVGNP T+D YD KG+LEYAWSHA+ISD  YD
Sbjct: 186  HYSPQLAELIYDRNKVQPKDSFINLKGFIVGNPLTDDEYDNKGILEYAWSHAVISDHLYD 245

Query: 942  KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIR-GVLDLA 766
             AK  CDF   NWS+ CN AM+ VFTKY+EIDIYNIY P+C+ N SS A+ +  GV D +
Sbjct: 246  SAKHNCDFKSSNWSEPCNVAMNTVFTKYKEIDIYNIYAPKCISNSSSGASYLGFGVNDKS 305

Query: 765  LTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDP 586
               K+    ++R++    GYDPCYS YAEEYFNR+DV+ + HA  R   +   WK C+D 
Sbjct: 306  PAVKD---WFKRVRWFE-GYDPCYSNYAEEYFNRVDVRLSLHATTR---NVARWKVCNDS 358

Query: 585  VFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSW 406
            + + Y +T  S+LP Y KLIK GLKIW+YSGDADGRVPVIGSRYC+EAL + +KS WRSW
Sbjct: 359  ILQTYHFTVSSMLPTYSKLIKAGLKIWVYSGDADGRVPVIGSRYCVEALGISVKSEWRSW 418

Query: 405  FHNHQVGGRIVEYH-GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPA 253
            FHNHQVGGRI EY  GLTFVTVRGAGHLVPLNKP EALAL  SFL+G+ELP+
Sbjct: 419  FHNHQVGGRITEYEGGLTFVTVRGAGHLVPLNKPEEALALFRSFLNGQELPS 470



>gb:AP003537_1830562 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1140D12.
          Length = 480

 Score =  574 bits (1479), Expect = e-162
 Identities = 267/450 (59%), Positives = 333/450 (74%), Gaps = 2/450 (0%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            QE+D++ +LPGQP +P ++ FSGYITVN  +GRALFYWFFEA++ PS KPL+LWLNGGPG
Sbjct: 36   QEADRVAFLPGQPRSPQMSQFSGYITVNSQNGRALFYWFFEAQALPSKKPLLLWLNGGPG 95

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
            CSS+GYGAA+ELGPL V  NG GL FNK++WN EANLLF+ESPVGVGFSYTN        
Sbjct: 96   CSSVGYGAASELGPLMVNGNGTGLEFNKFAWNNEANLLFLESPVGVGFSYTNTSSDLESI 155

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
             D+FVA+DTYNFLVNW +RFPQ+K HDF+I+GESYAGHYVPQLA+VV++RN+       I
Sbjct: 156  DDRFVAEDTYNFLVNWFKRFPQYKNHDFYISGESYAGHYVPQLADVVYERNKHVETNQHI 215

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NLKGFIVGN ET+DYYDYKGL+E+AWSH++ISDQ Y     VCDF     S++CN  M  
Sbjct: 216  NLKGFIVGNAETDDYYDYKGLVEFAWSHSVISDQLYKHVNNVCDFRLSPRSNECNHVMGY 275

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMK--RIPGGYDP 700
            ++ +Y+ IDI+N+Y P+C  + SS  +      D+         A +R+K  R+  GYDP
Sbjct: 276  IYDQYDMIDIFNVYAPKCNTDDSSLFSTSYSTADM--------NAKKRLKGTRMYSGYDP 327

Query: 699  CYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG 520
            CYS + E+Y N++DVQK+ HAN         W  CS  +F  Y  T FS+LP+Y KLIK 
Sbjct: 328  CYSSHIEDYMNKMDVQKSLHANTSGLIKDRKWSICSYSIFDNYDITVFSVLPIYSKLIKA 387

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVR 340
            GL+IW+YSGD DGRVPVIGSRYC+EAL LP+KS W+ W+ N+QV GR VEY GLT  TVR
Sbjct: 388  GLRIWVYSGDVDGRVPVIGSRYCVEALGLPVKSQWQPWYLNNQVAGRFVEYQGLTMATVR 447

Query: 339  GAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            GAGH VP +KP +AL +I+SFLSG  LP +
Sbjct: 448  GAGHAVPQDKPEQALVVINSFLSGRRLPTK 477



>gb:AP004069_1837209 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1626_B09.>gb:AP004192_1838819 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OJ1643_A10.
          Length = 485

 Score =  466 bits (1199), Expect = e-130
 Identities = 235/479 (49%), Positives = 307/479 (64%), Gaps = 5/479 (1%)
 Frame = -2

Query: 1677 APPNRTFLLVGFLVIWVLCAESSSPKAA-----QESDKIGYLPGQPSAPLLTHFSGYITV 1513
            A  + +FL +  L +    A  S    A     QE+D++  LPGQP A     ++GY+TV
Sbjct: 7    AAVSSSFLALALLSLCAAAAGGSPQLDAEAARQQEADRVTRLPGQP-AVRFAQYAGYVTV 65

Query: 1512 NQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFN 1333
            N++HGRALFYWFFEA +    KPLVLWLNGGPGCSS+GYG A ELGP  V++    L +N
Sbjct: 66   NETHGRALFYWFFEATAAADKKPLVLWLNGGPGCSSVGYGEAEELGPFLVQKGKPELKWN 125

Query: 1332 KYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHD 1153
            KYSWNKEANL+F+ESPVGVGFSYTN         DK  A D Y FL+NW +RFPQ+K HD
Sbjct: 126  KYSWNKEANLMFLESPVGVGFSYTNTSSDLQQLGDKITADDAYIFLLNWFKRFPQYKSHD 185

Query: 1152 FFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWS 973
            F+IAGESYAGHYVPQL+E +FD N+       IN KGF++GN   +D  D  G+++YAW 
Sbjct: 186  FYIAGESYAGHYVPQLSEKIFDGNKQGPKENYINFKGFMIGNALMDDETDQTGMIDYAWD 245

Query: 972  HAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSAT 793
            HA+ISD+ Y   K+ C+F+ EN +D C+ A++  F  Y  ID+Y++Y P C    SS+A 
Sbjct: 246  HAVISDRVYADVKKYCNFSMENVTDACDSALTEYFAVYRLIDMYSLYTPVCTEVSSSAAF 305

Query: 792  GIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGST 613
            G R V       K  +  Y      P GYDPC S +AE YFNR DVQ+A HAN+   G  
Sbjct: 306  GQRQVAVHGAAPKIFS-KYHGWYMRPAGYDPCTSDHAEVYFNRADVQEALHANVTNIG-- 362

Query: 612  VNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKL 433
             NW  CSD V   ++   FS LP+  KL+ GG+++W++SGD DGR+PV  +R  +  L L
Sbjct: 363  YNWTHCSD-VIGKWRDAPFSTLPIIRKLVAGGIRVWVFSGDTDGRIPVTSTRLTLNKLGL 421

Query: 432  PLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
                 W  W+ + QVGG  + Y GLTFVT+RGAGH VPL+ P +AL+L   FL+ +++P
Sbjct: 422  KTVQEWTPWYDHQQVGGWTILYEGLTFVTIRGAGHEVPLHAPRQALSLFSHFLADKKMP 480



>pir|G86244|G86244 Serine carboxypeptidase homolog, 30227-33069
            [imported] - Arabidopsis thaliana>gb:AE005172_890118
            Arabidopsis thaliana chromosome 1, top arm complete
            sequence.>gb:U95973_1726582 Arabidopsis thaliana
            chromosome 1 BAC T19D16 genomic sequence, complete
            sequence.
          Length = 465

 Score =  465 bits (1197), Expect = e-129
 Identities = 236/477 (49%), Positives = 304/477 (63%), Gaps = 8/477 (1%)
 Frame = -2

Query: 1662 TFLLVGFLVIWVLCAESSSPKA---AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRA 1492
            T L++  +VI        SPK    A E D +  LPGQP      H++GY+ V++S+GRA
Sbjct: 20   TLLILAPVVICTRQHRFDSPKRSLLANEQDLVTGLPGQPDVSF-RHYAGYVPVDESNGRA 78

Query: 1491 LFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKE 1312
            +FYWFFEA   P  KPLVLWLNGGPGCSS+GYGA  E+GP  V  NG GL+FN Y+WNKE
Sbjct: 79   MFYWFFEAMDLPKEKPLVLWLNGGPGCSSVGYGATQEIGPFLVDTNGNGLNFNPYAWNKE 138

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            AN+LF+ESPVGVGFSY+N         D F A+D Y FL NW E+FP+ K + F+IAGES
Sbjct: 139  ANMLFLESPVGVGFSYSNTSSDYQKLGDDFTARDAYTFLCNWFEKFPEHKENTFYIAGES 198

Query: 1131 YAGHYVPQLAEVVFD---RNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAII 961
            YAG YVP+LAEVV+D    N+  G    INLKG ++GNPET+D  D++G ++YAWSHA+I
Sbjct: 199  YAGKYVPELAEVVYDNNNNNKKNGSSFHINLKGILLGNPETSDAEDWRGWVDYAWSHAVI 258

Query: 960  SDQQYDKAKEVCDFTQEN-WS-DKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGI 787
            SD+ +      C+F+ +N WS D+CNEA++ V  +Y EIDIY+IY               
Sbjct: 259  SDETHRIITRTCNFSSDNTWSNDECNEAVAEVLKQYHEIDIYSIY--------------- 303

Query: 786  RGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVN 607
                                 R+ GGYDPC   YA  ++NR DVQK+ HA+     +  N
Sbjct: 304  ----------------TSMPPRLMGGYDPCLDDYARVFYNRADVQKSLHASDGV--NLKN 345

Query: 606  WKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPL 427
            W  C+  +F  +  +  S+LP+YEKLI GGL+IW+YSGD DGRVPV+ +RY + AL+LP+
Sbjct: 346  WSICNMEIFNNWTGSNPSVLPIYEKLIAGGLRIWVYSGDTDGRVPVLATRYSLNALELPI 405

Query: 426  KSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            K+ WR W+H  QV G + EY GLTF T RGAGH VP  KPS +LA   +FLSG   P
Sbjct: 406  KTAWRPWYHEKQVSGWLQEYEGLTFATFRGAGHAVPCFKPSSSLAFFSAFLSGVPPP 462



>gb:AB007648_1510197 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MKD15.
          Length = 499

 Score =  456 bits (1173), Expect = e-127
 Identities = 226/455 (49%), Positives = 299/455 (65%), Gaps = 7/455 (1%)
 Frame = -2

Query: 1599 AAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGG 1420
            AAQ +D++  LPGQP       ++GY+TVN++HGRALFYWFFEA  +PS KP++LWLNGG
Sbjct: 45   AAQRADRVKELPGQPPVKF-RQYAGYVTVNETHGRALFYWFFEATQNPSKKPVLLWLNGG 103

Query: 1419 PGCSSIGYGAAAELGPLRVKRNGVG-LHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXX 1243
            PGCSSIG+GAA ELGP   + +    L  N YSWNK ANLLF+ESPVGVGFSYTN     
Sbjct: 104  PGCSSIGFGAAEELGPFFPQNSSQPKLKLNPYSWNKAANLLFLESPVGVGFSYTNTSRDI 163

Query: 1242 XXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY 1063
                D   A+D+YNFLVNW +RFPQ+K HDF+IAGESYAGHYVPQL+E+++  N+     
Sbjct: 164  KQLGDTVTARDSYNFLVNWFKRFPQYKSHDFYIAGESYAGHYVPQLSELIYKENKIASKK 223

Query: 1062 PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEA 883
              INLKG ++GN   +D  D KG++EYAW HA+ISD  Y+K  + CDF Q+  + +CN+A
Sbjct: 224  DFINLKGLMIGNALLDDETDQKGMIEYAWDHAVISDALYEKVNKNCDFKQKLVTKECNDA 283

Query: 882  MSIVFTKYEEIDIYNIYGPRCLLNGSSSAT-----GIRGVLDLALTNKERTYAYRR-MKR 721
            +   F  Y+ +D+Y++Y P+C+   ++S+T     G R +       + R  ++    +R
Sbjct: 284  LDEYFDVYKILDMYSLYAPKCVPTSTNSSTSHSVAGNRPLPAFRSILRPRLISHNEGWRR 343

Query: 720  IPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV 541
            +  GYDPC S Y E+Y NR DVQ+A HAN+     +  W  CSD V   +     S+LP 
Sbjct: 344  MAAGYDPCASEYTEKYMNRKDVQEALHANV--TNISYPWTHCSDTV-SFWSDAPASMLPT 400

Query: 540  YEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHG 361
               L+  GL++W++SGD DGR+PV  +RY ++ L L +   W  W+   QVGG  VEY G
Sbjct: 401  LRTLVSAGLRVWVFSGDTDGRIPVTATRYSLKKLGLKIVQDWTPWYTKLQVGGWTVEYDG 460

Query: 360  LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            L FVTVRGAGH VP  KP EAL LIH FL  ++LP
Sbjct: 461  LMFVTVRGAGHQVPTFKPREALQLIHHFLGNKKLP 495



>gb:AF370198_1792086 Arabidopsis thaliana putative serine
            carboxypeptidase II (At4g30610) mRNA, complete cds.
          Length = 465

 Score =  448 bits (1153), Expect = e-124
 Identities = 236/483 (48%), Positives = 307/483 (63%), Gaps = 8/483 (1%)
 Frame = -2

Query: 1680 MAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSH 1501
            MA  +  FLL+  L+     + SSS +  QE D+I  LPGQP     + +SGY+ VNQSH
Sbjct: 1    MARTHFIFLLLVALLSTTFPSSSSSRE--QEKDRIKALPGQPKVAF-SQYSGYVNVNQSH 57

Query: 1500 GRALFYWFFEAKS-HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYS 1324
            GRALFYW  E+ S  P  KPL+LWLNGGPGCSSI YGA+ E+GP R+ +NG  L+ NK++
Sbjct: 58   GRALFYWLTESSSPSPHTKPLLLWLNGGPGCSSIAYGASEEIGPFRINKNGSNLYLNKFA 117

Query: 1323 WNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFI 1144
            WNK+ANLLF+ESP GVG+SYTN         D+  AQD   FL+ WL RFPQ+K  DF+I
Sbjct: 118  WNKDANLLFLESPAGVGYSYTNTSSDLKDSGDERTAQDNLIFLIKWLSRFPQYKYRDFYI 177

Query: 1143 AGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI 964
            AGESYAGHYVPQLA+ + D N+     P INLKGF+VGN  T++ YD  G + Y W+HAI
Sbjct: 178  AGESYAGHYVPQLAKKINDYNKAFS-KPIINLKGFLVGNAVTDNQYDSIGTVTYWWTHAI 236

Query: 963  ISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFT-KYEEIDIYNIYGPRCLLNGSSSATGI 787
            ISD+ Y    + C+FT E  SD C+ A++     ++ +ID Y+IY P C+          
Sbjct: 237  ISDKSYKSILKYCNFTVERVSDDCDNAVNYAMNHEFGDIDQYSIYTPTCV---------- 286

Query: 786  RGVLDLALTNKERTYAYRRMK------RIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRA 625
                  A   K  T  + RMK      R+  GYDPC   YAE+YFNR DVQ+A HAN+  
Sbjct: 287  -----AAQQKKNTTGFFVRMKNTLLRRRLVSGYDPCTESYAEKYFNRPDVQRAMHANV-- 339

Query: 624  PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIE 445
             G    W  CSD + + +K +  ++LP+Y++L   GL+IWI+SGD D  VPV  +R+ + 
Sbjct: 340  TGIRYKWTACSDVLIKTWKDSDKTMLPIYKELAASGLRIWIFSGDTDSVVPVTATRFSLS 399

Query: 444  ALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             L LP+K+ W  W+ ++QVGG    Y GLTF TVRGAGH VPL +P  AL L  SFL+G+
Sbjct: 400  HLNLPVKTRWYPWYTDNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRALILFRSFLAGK 459

Query: 264  ELP 256
            ELP
Sbjct: 460  ELP 462



>pir|B85358|B85358 SERINE CARBOXYPEPTIDASE II-like protein [imported]
            - Arabidopsis thaliana>gb:ATCHRIV73_1546982 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            73.>gb:BT002334_1635937 Arabidopsis thaliana clone
            C104745 putative serine carboxypeptidase II (At4g30610)
            mRNA, complete cds.
          Length = 465

 Score =  446 bits (1147), Expect = e-124
 Identities = 235/483 (48%), Positives = 306/483 (63%), Gaps = 8/483 (1%)
 Frame = -2

Query: 1680 MAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSH 1501
            MA  +  FLL+  L+     + SSS +  QE D+I  LPGQP     + +SGY+ VNQSH
Sbjct: 1    MARTHFIFLLLVALLSTTFPSSSSSRE--QEKDRIKALPGQPKVAF-SQYSGYVNVNQSH 57

Query: 1500 GRALFYWFFEAKS-HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYS 1324
            GRALFYW  E+ S  P  KPL+LWLNGGPGCSSI YGA+ E+GP R+ + G  L+ NK++
Sbjct: 58   GRALFYWLTESSSPSPHTKPLLLWLNGGPGCSSIAYGASEEIGPFRINKTGSNLYLNKFA 117

Query: 1323 WNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFI 1144
            WNK+ANLLF+ESP GVG+SYTN         D+  AQD   FL+ WL RFPQ+K  DF+I
Sbjct: 118  WNKDANLLFLESPAGVGYSYTNTSSDLKDSGDERTAQDNLIFLIKWLSRFPQYKYRDFYI 177

Query: 1143 AGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI 964
            AGESYAGHYVPQLA+ + D N+     P INLKGF+VGN  T++ YD  G + Y W+HAI
Sbjct: 178  AGESYAGHYVPQLAKKINDYNKAFS-KPIINLKGFLVGNAVTDNQYDSIGTVTYWWTHAI 236

Query: 963  ISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFT-KYEEIDIYNIYGPRCLLNGSSSATGI 787
            ISD+ Y    + C+FT E  SD C+ A++     ++ +ID Y+IY P C+          
Sbjct: 237  ISDKSYKSILKYCNFTVERVSDDCDNAVNYAMNHEFGDIDQYSIYTPTCV---------- 286

Query: 786  RGVLDLALTNKERTYAYRRMK------RIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRA 625
                  A   K  T  + RMK      R+  GYDPC   YAE+YFNR DVQ+A HAN+  
Sbjct: 287  -----AAQQKKNTTGFFVRMKNTLLRRRLVSGYDPCTESYAEKYFNRPDVQRAMHANV-- 339

Query: 624  PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIE 445
             G    W  CSD + + +K +  ++LP+Y++L   GL+IWI+SGD D  VPV  +R+ + 
Sbjct: 340  TGIRYKWTACSDVLIKTWKDSDKTMLPIYKELAASGLRIWIFSGDTDSVVPVTATRFSLS 399

Query: 444  ALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             L LP+K+ W  W+ ++QVGG    Y GLTF TVRGAGH VPL +P  AL L  SFL+G+
Sbjct: 400  HLNLPVKTRWYPWYTDNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRALILFRSFLAGK 459

Query: 264  ELP 256
            ELP
Sbjct: 460  ELP 462



>gb:OSJN00221_1696957 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0038O10, complete sequence.
          Length = 506

 Score =  438 bits (1126), Expect = e-121
 Identities = 229/475 (48%), Positives = 296/475 (62%), Gaps = 29/475 (6%)
 Frame = -2

Query: 1590 ESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGC 1411
            E D +  LPGQP      H++GY+ V   +G+ALFYWFFEA+  P  KPL+LWLNGGPGC
Sbjct: 34   EEDLVAGLPGQPDVRF-RHYAGYVGVG--NGKALFYWFFEAEKEPEKKPLLLWLNGGPGC 90

Query: 1410 SSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXX 1231
            SS+ YGAA ELGP  V+  G  L  N YSWNK  NLLF+E+PVGVGFSYTN         
Sbjct: 91   SSVAYGAAQELGPFLVRSYGENLTLNAYSWNKAVNLLFLEAPVGVGFSYTNRTSDLRRLG 150

Query: 1230 DKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRIN 1051
            D+  AQD+Y+FL+NWL +FP+FK  DF+IAGESYAGHYVPQLAE+++D N+       IN
Sbjct: 151  DRVTAQDSYSFLLNWLNKFPEFKNRDFYIAGESYAGHYVPQLAELIYDGNKGASRDRVIN 210

Query: 1050 LKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD-FTQENWSDK----CNE 886
            +KGF++GN   ND  D  G++EYAWSHAIISD+ Y   +  CD F +E    K    C+ 
Sbjct: 211  IKGFMIGNAVLNDATDQMGMVEYAWSHAIISDELYSAVRRECDSFKEEEDGGKPSKGCSP 270

Query: 885  AMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRG-------VLDLALTNKERTYAYRRM 727
            A+      Y++IDIY+IY P CL + SSS             V    L +K    A+RRM
Sbjct: 271  AVRAFLRAYDDIDIYSIYTPTCLSSSSSSPASASPRRSSPGLVAAPRLFSKHVKEAWRRM 330

Query: 726  KRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLL 547
            +R+P GYDPC   Y + YFNR DVQ+A HAN    G +  +  CS+ + + +  +  ++L
Sbjct: 331  QRVPAGYDPCTEEYVKGYFNREDVQRALHAN--RTGLSYPYSPCSEAISK-WNDSPSTVL 387

Query: 546  PVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLK----------------SPW 415
            P+ +KL+  GL+IW+YSGD DGRVPV  +RY +  +KL  +                  W
Sbjct: 388  PILKKLMGAGLRIWVYSGDTDGRVPVTSTRYSLNTMKLRPRLMRKTAGDGAGEESEWGGW 447

Query: 414  RSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPA 253
            R+W+   QVGG  VEY  GLT VTVRGAGH VPL  P  +LA+++ FL G  LPA
Sbjct: 448  RAWYDRQQVGGWAVEYEEGLTLVTVRGAGHQVPLFAPRRSLAMLYHFLRGSSLPA 502



>gb:AP004094_1837601 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1695_H09.>gb:AP005115_1848140 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0700F06.
          Length = 473

 Score =  436 bits (1122), Expect = e-121
 Identities = 230/480 (47%), Positives = 299/480 (62%), Gaps = 5/480 (1%)
 Frame = -2

Query: 1680 MAPPNRTFLLVGFLVI-WVLCAESSSPKAAQ-ESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            MA   R    V  +V+ W+  A   +    + E D++  LPGQP       ++GY+ V++
Sbjct: 1    MATRGRIVAAVASVVVAWLAVAVGVNGGGCEAERDRVEALPGQPPVAF-AQYAGYVAVSE 59

Query: 1506 SHGRALFYWFFEAKSHPS--NKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFN 1333
            + GRALFYW  EA +  +   KPLVLWLNGGPGCSSI YGA+ E+GP R+K NG GL+ N
Sbjct: 60   ASGRALFYWLTEAAAAAAAATKPLVLWLNGGPGCSSIAYGASEEIGPFRIKTNGTGLYLN 119

Query: 1332 KYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHD 1153
            KYSWN+EANLLF+ESP GVGFSY+N         D+  AQD   FL++W+ RFPQ++  D
Sbjct: 120  KYSWNREANLLFLESPAGVGFSYSNTTSDLKTSGDERTAQDALQFLISWMSRFPQYRHRD 179

Query: 1152 FFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWS 973
            F+IAGESYAGHYVPQLA  + + N+    YP INLKG +VGN  T++YYD  G + Y W+
Sbjct: 180  FYIAGESYAGHYVPQLARKIVEFNK-ASPYPFINLKGILVGNGVTDNYYDNIGTVTYWWT 238

Query: 972  HAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFT-KYEEIDIYNIYGPRCLLNGSSSA 796
            HA+ISD  Y      C+FT  N S  CN AMS     ++ +ID Y+IY P C    +++A
Sbjct: 239  HAMISDTTYKAIMSSCNFTSANVSRLCNRAMSYAMNHEFGDIDQYSIYTPSCAAAAAANA 298

Query: 795  TGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGS 616
            TG R      L  K+ T+  RR      GYDPC   YAE+Y+NR DVQKA HANI   G 
Sbjct: 299  TGRRRGKAAVLRFKD-TFLRRR----SFGYDPCTETYAEKYYNRPDVQKAMHANI--TGI 351

Query: 615  TVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALK 436
               W  CSD + + ++ + FS+LP Y+ L+K GL+IW++SGD D  VPV  +R+ +  L 
Sbjct: 352  PYRWTACSDVLIKTWRDSEFSMLPTYKLLMKAGLRIWVFSGDTDSVVPVTATRFALSHLG 411

Query: 435  LPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            L  K  W  W+   QVGG    Y GLTF +VRGAGH VPL +P  A  +  SFL+GE LP
Sbjct: 412  LKTKIRWYPWYSAGQVGGWSEVYEGLTFASVRGAGHEVPLFQPRRAFRMFQSFLAGEPLP 471



>pir|B96637|B96637 hypothetical protein F11P17.14 [imported] -
            Arabidopsis thaliana>gb:AE005173_893784 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC002294_1530174 Arabidopsis thaliana
            chromosome I BAC F11P17 genomic sequence, complete
            sequence.
          Length = 470

 Score =  431 bits (1107), Expect = e-119
 Identities = 223/473 (47%), Positives = 295/473 (62%), Gaps = 20/473 (4%)
 Frame = -2

Query: 1614 SSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVL 1435
            S SP+A +  D +   PGQP      H++GY+TVN   GRALFYWFFEA +HP+ KPLVL
Sbjct: 22   SDSPEAMR--DLVTNFPGQPKVSF-RHYAGYVTVNIISGRALFYWFFEAMTHPNVKPLVL 78

Query: 1434 WLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX 1255
            WLNGGPGCSS+GYGA  E+GP  V   G  L FN Y+WNKEAN+LF+ESP GVGFSY+N 
Sbjct: 79   WLNGGPGCSSVGYGATQEIGPFLVDNKGNSLKFNPYAWNKEANILFLESPAGVGFSYSNT 138

Query: 1254 XXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD 1075
                    D F A+D+Y FL  W  RFP +K  DFFIAGESYAG YVP+LAEV++D+N+D
Sbjct: 139  SSDYRKLGDDFTARDSYTFLQKWFLRFPAYKEKDFFIAGESYAGKYVPELAEVIYDKNKD 198

Query: 1074 -RGIYPRINLKGFIV-------------GNPETNDYYDYKGLLEYAWSHAIISDQQYDKA 937
               +   INLKG +V             GNP T+   D+ G ++YAW+HA++SD+ Y   
Sbjct: 199  NENLSLHINLKGILVLNTFDLNFKDIFLGNPLTSYAEDWTGWVDYAWNHAVVSDETYRVI 258

Query: 936  KEVCDFTQE-NWSDK-CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLAL 763
            K+ C+F+ +  W  K C E +  +  +Y+EID +++Y P C+ + S              
Sbjct: 259  KQSCNFSSDTTWDVKDCKEGVDEILKQYKEIDQFSLYTPICMHHSS-------------- 304

Query: 762  TNKERTYAYRR--MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSD 589
              K  +YA  +  + R+  G+DPC   YA+ ++NR DVQKA HA         NW  C+D
Sbjct: 305  --KVDSYANYKTTIPRLFDGFDPCLDDYAKVFYNRADVQKALHATDGV--HLKNWTICND 360

Query: 588  PVFRAYKYTTF--SLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPW 415
             +   + +T    S+LP+Y+KLI GG ++W+YSGD DGRVPV+ +RYCI  L+LP+K+ W
Sbjct: 361  DILNHWNWTDSKRSVLPIYKKLIAGGFRVWVYSGDTDGRVPVLSTRYCINKLELPIKTAW 420

Query: 414  RSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            R W+H  Q      EY GLTF T RGAGH VP  KPSE+LA   +FL+G   P
Sbjct: 421  RPWYHETQ------EYEGLTFATFRGAGHDVPSFKPSESLAFFSAFLNGVPPP 467



>pir|D84631|D84631 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC005170_1532300 Arabidopsis
            thaliana chromosome 2 clone T29E15 map CIC06C07, complete
            sequence.
          Length = 474

 Score =  430 bits (1105), Expect = e-119
 Identities = 226/483 (46%), Positives = 301/483 (62%), Gaps = 14/483 (2%)
 Frame = -2

Query: 1665 RTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALF 1486
            RT LL    V+  L   S+S K  QE D+I  LPGQP     + FSGY+TVN+SHGR+LF
Sbjct: 3    RTHLLFLLFVLLSLATSSTSTKE-QEEDRIKALPGQPKVGF-SQFSGYVTVNESHGRSLF 60

Query: 1485 YWFFEAKSH-PSNKPLVLWLNGG----------PGCSSIGYGAAAELGPLRVKRNGVGLH 1339
            YW  E+ SH P  KPL+LWLNGG          PGCSSI YGA+ E+GP R+ + G  L+
Sbjct: 61   YWLTESSSHSPHTKPLLLWLNGGWIFFLPTFPRPGCSSIAYGASEEIGPFRISKTGCNLY 120

Query: 1338 FNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKG 1159
             N +SWN EANLLF+ESPVGVGFSYTN         D+  AQ+   FL++W+ RFPQ++ 
Sbjct: 121  LNNFSWNTEANLLFLESPVGVGFSYTNTSSDFEESGDERTAQENLIFLISWMSRFPQYRY 180

Query: 1158 HDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYA 979
             DF+I GESYAGHYVPQLA+ + + N +    P INLKGF+VGNPE +   D  G + Y 
Sbjct: 181  RDFYIVGESYAGHYVPQLAQKIHEYN-NAYKNPVINLKGFMVGNPEMDKNNDRLGTITYW 239

Query: 978  WSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCL-LNGSS 802
            WSHA+ISD  Y++  + CDFT + +S +C+ A+ +    + +ID Y+IY P+C+     +
Sbjct: 240  WSHAMISDASYNRILKNCDFTADRFSKECDSAIYVAAADFGDIDQYSIYTPKCVPPQDQT 299

Query: 801  SATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAP 622
            + T    ++ +  T           + +   YDPC   YAE Y+NR +VQ+A HAN  A 
Sbjct: 300  NQTKFEQMMQMHTTK----------RFLEDQYDPCTENYAEIYYNRPEVQRAMHANHTA- 348

Query: 621  GSTVNWKTCSDPVFRAYKY--TTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI 448
                 W  CSD VF  + +  +  S+LP+Y++LI  GL+IW+YSGD D  +PV  +RY +
Sbjct: 349  -IPYKWTACSDSVFNNWNWRDSDNSMLPIYKELIAAGLRIWVYSGDTDSVIPVTATRYSL 407

Query: 447  EALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
              L L +K+ W  W+  +QVGGR   Y GLTFVTVRGAGH VP  +P  AL L+ SFL+G
Sbjct: 408  GKLNLRVKTRWYPWYSGNQVGGRTEVYEGLTFVTVRGAGHEVPFFQPQSALILLRSFLAG 467

Query: 267  EEL 259
             EL
Sbjct: 468  NEL 470



>gb:AP005750_1857143 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0069C14.
          Length = 500

 Score =  429 bits (1103), Expect = e-119
 Identities = 227/459 (49%), Positives = 289/459 (62%), Gaps = 12/459 (2%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            QE+D++  LPGQP+      F+GY+TVN++HGRALFYWFFEA S  + KPLVLWLNGGPG
Sbjct: 47   QEADRVQRLPGQPAELGFRQFAGYVTVNETHGRALFYWFFEAASDVATKPLVLWLNGGPG 106

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
            CSS+GYGA  ELGPL V  N   L  N  SWNKEANLLFVESP GVGFSYTN        
Sbjct: 107  CSSLGYGALEELGPLLVNNNDT-LIINPESWNKEANLLFVESPAGVGFSYTNTTTDLAHF 165

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR- 1057
             D   A D + FLVNWLERFPQFKGHD +IAGESYAGHYVPQLA  +   N+ +  +   
Sbjct: 166  GDNLTAHDAHAFLVNWLERFPQFKGHDLYIAGESYAGHYVPQLATKILHFNKKKKEHDDD 225

Query: 1056 ---INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE-NWSDKCN 889
               INLKG ++GN   +   D +GL+EYAW HA+ISD+ Y   K  C F  + N +DKCN
Sbjct: 226  DRIINLKGIMIGNAAIDSSSDDRGLVEYAWDHAVISDEIYAAIKGNCTFPDDGNETDKCN 285

Query: 888  EAMSIVFTKYEEIDIYNIYGPRC--LLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP 715
             A +  FT   +IDIY++Y P C   LNG+++           +TN  R+    ++ R+ 
Sbjct: 286  TAWNGFFTAMGDIDIYSLYTPSCTAALNGTTT-----------ITNGTRSRFADKVLRLR 334

Query: 714  GG-----YDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
             G     Y+PC      +Y NR DVQ A HAN+ + G   +W  CSD +   +     S 
Sbjct: 335  RGLPYNTYNPCVDYRVIDYLNRGDVQAALHANV-SGGIPYSWAPCSDALTN-WTDAPPST 392

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVE 370
            LP    L++ GL++W++SGD D RVPV  +RY +  LKL    PW+ WF + QVGG  V 
Sbjct: 393  LPDIAALVRAGLRVWVFSGDTDDRVPVTSTRYALRKLKLKTVRPWKQWFTSDQVGGYTVL 452

Query: 369  YHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPA 253
            Y GLTFVT+RGAGH+VP+  P +A  L   FL+G+++PA
Sbjct: 453  YDGLTFVTIRGAGHMVPMITPVQARQLFAHFLAGDDMPA 491



>pir|H84772|H84772 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC006068_1533348 Arabidopsis
            thaliana chromosome 2 clone T20F21 map ve016, complete
            sequence.>gb:AC007017_1534976 Arabidopsis thaliana
            chromosome 2 clone F11F19 map g6825, complete
            sequence.>gb:AY088044_1573068 Arabidopsis thaliana clone
            40628 mRNA, complete sequence.
          Length = 452

 Score =  427 bits (1097), Expect = e-118
 Identities = 224/470 (47%), Positives = 287/470 (61%), Gaps = 3/470 (0%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            LL+ F    +L   +S  +  QE D+I +LPG+P+    +HFSGYITVN+S GRALFYW 
Sbjct: 4    LLLLFFFFLILLHYASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWL 63

Query: 1476 FEA--KSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANL 1303
             E+    +P +KPLVLWLNGGPGCSS+ YGAA E+GP R+  +G  L+ N YSWNK ANL
Sbjct: 64   TESPPSENPESKPLVLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANL 123

Query: 1302 LFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAG 1123
            LF+ESP GVGFSY+N         D+  A+D Y FLV W ERFPQ+K  +F+IAGESYAG
Sbjct: 124  LFLESPAGVGFSYSNTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAG 183

Query: 1122 HYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYD 943
            HYVPQL+++V+++       P IN KGFIVGN   +DY+DY GL EY W+H +ISD  Y 
Sbjct: 184  HYVPQLSQIVYEKRN-----PAINFKGFIVGNAVIDDYHDYVGLFEYWWAHGLISDLTYH 238

Query: 942  KAKEVCDF-TQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLA 766
              +  C+F + E+ S KC +AM     +   ID Y+IY   C       A  +R      
Sbjct: 239  NLRITCEFGSSEHPSSKCTKAMEAADLEQGNIDPYSIYTVTC----KKEAAALRS----R 290

Query: 765  LTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDP 586
             +     + +R        YDPC   Y+  YFN  +VQKA HANI   G    WK CSD 
Sbjct: 291  FSRVRHPWMWR-------AYDPCTEKYSGMYFNSPEVQKAMHANI--TGLAYPWKGCSDI 341

Query: 585  VFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSW 406
            V   +  +  S+LP+Y++LI  GL+IW++SGD D  VP+ G+RY I ALKL   S W  W
Sbjct: 342  VGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRALKLQPLSKWYPW 401

Query: 405  FHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
              + QVGG    Y GLT VT+ GAGH VPL +P  A  L  SFL  + LP
Sbjct: 402  NDDGQVGGWSQVYKGLTLVTIHGAGHEVPLFRPRRAFLLFQSFLDNKPLP 451



>pir|E84631|E84631 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC005170_1532301 Arabidopsis
            thaliana chromosome 2 clone T29E15 map CIC06C07, complete
            sequence.
          Length = 425

 Score =  427 bits (1097), Expect = e-118
 Identities = 209/438 (47%), Positives = 281/438 (64%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            LPGQP     + FSGY+TVN+SHGR+LFYW  E+ S    KPL+LWLNGGPGCSSIGYGA
Sbjct: 5    LPGQPQVGF-SQFSGYVTVNESHGRSLFYWLTESPSSSHTKPLLLWLNGGPGCSSIGYGA 63

Query: 1389 AAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQD 1210
            + E+GP R+ + G  L+ NK++WN EAN+LF+ESP GVGFSYTN         D+  AQ+
Sbjct: 64   SEEIGPFRINKTGSNLYLNKFTWNTEANILFLESPAGVGFSYTNTSSDLKDSGDERTAQE 123

Query: 1209 TYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVG 1030
               FL+ W+ RFPQ++  DF+I GESYAGHYVPQLA+ +   N+     P INLKGF+VG
Sbjct: 124  NLIFLIKWMSRFPQYQYRDFYIVGESYAGHYVPQLAKKIHLYNKAFNNTPIINLKGFMVG 183

Query: 1029 NPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI 850
            N + + +YD  G   YAWSHA+ISD+ Y    + C FT +  SDKCN A+   + ++ ++
Sbjct: 184  NGDMDKHYDRLGAAMYAWSHAMISDKTYKSILKHCSFTADKTSDKCNWALYFAYREFGKV 243

Query: 849  DIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYF 670
            + Y+IY P C+                  TN+ + + + R+      YDPC   YAE Y+
Sbjct: 244  NGYSIYSPSCVHQ----------------TNQTK-FLHGRLLVEEYEYDPCTESYAEIYY 286

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGD 490
            NR DVQ+A HAN+ +      W  C+  V   +K + FS+LP+Y++L   GL+IW++SGD
Sbjct: 287  NRPDVQRAMHANLTS--IPYKWTLCNMVVNNNWKDSEFSMLPIYKELTAAGLRIWVFSGD 344

Query: 489  ADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNK 310
             D  VPV G+R  +  L LP+K+PW  W+   QVGG    Y GLTF T+RGAGH VP+ +
Sbjct: 345  TDAVVPVTGTRLALSKLNLPVKTPWYPWYSEKQVGGWTEVYEGLTFATIRGAGHEVPVLQ 404

Query: 309  PSEALALIHSFLSGEELP 256
            P  AL L+ SFL+G+ELP
Sbjct: 405  PERALTLLRSFLAGKELP 422



>gb:AE016959_1023668 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC073166_1540984 Oryza sativa
            chromosome 10 BAC OSJNBb0064P21 genomic sequence,
            complete sequence.>gb:AE017116_1753487 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 70 of 77
            of the complete sequence.
          Length = 482

 Score =  426 bits (1094), Expect = e-117
 Identities = 218/463 (47%), Positives = 290/463 (62%), Gaps = 4/463 (0%)
 Frame = -2

Query: 1626 LCAESSSPKAAQESDKIGYLPGQPS-APLLTHFSGYITVNQSHGRALFYWFFEAKSHPSN 1450
            L A +++    QE D++  LPGQP+ +P    +SGY+T ++  G+ALFYWF EA   P  
Sbjct: 38   LDASATAAMELQELDRVMSLPGQPAYSPEFRQYSGYVTTDEYLGKALFYWFLEATDKPDE 97

Query: 1449 KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGF 1270
            KPLVLWLNGGPGCSSIG+G A ELGP  VK++   L  N Y+WN+ ANLLF++SP GVGF
Sbjct: 98   KPLVLWLNGGPGCSSIGFGQAQELGPFLVKKDVAELELNPYAWNQVANLLFLDSPAGVGF 157

Query: 1269 SYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVF 1090
            SYTN         D   A  +Y FL+ W +RFPQ K  +F+IAGESYAGHYVPQLA V+ 
Sbjct: 158  SYTNTSFGKDPPGDNSTAYGSYTFLIRWFQRFPQHKMKEFYIAGESYAGHYVPQLANVIV 217

Query: 1089 DRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE 910
            D+N+       INLKG ++GN   +   D  G+++ AW HA+ISD+ Y   ++ C+F+  
Sbjct: 218  DQNKIAPKENYINLKGIMIGNAYMDGDTDLLGIVDSAWHHALISDKLYSDFQKFCNFSLV 277

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAY-- 736
            + S +CN A+      Y  IDIY++Y PRC               +L   N   ++A   
Sbjct: 278  DLSKECNAAIDQFNALYSIIDIYSLYTPRC---------------ELGYPNFNSSFAAQI 322

Query: 735  -RRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTT 559
             R   RIP GYDPC   YA EYFNR DVQKA HANI  PG+   +  C + + RA+  + 
Sbjct: 323  GRTSSRIPMGYDPCSQTYATEYFNRKDVQKALHANI--PGA---YSLCHNSINRAWNDSD 377

Query: 558  FSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGR 379
             ++LP+ +KL + GL+IWIYSGD D R+P   +RY ++ L LP+K  W  WFH+ QVGG 
Sbjct: 378  MTVLPIVKKLTQSGLRIWIYSGDTDARIPTTSTRYTLKKLGLPIKEDWSPWFHHKQVGGW 437

Query: 378  IVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
             V + GLTFVTVRGAGH+VP   P +AL L   FL+ + LP++
Sbjct: 438  SVVFDGLTFVTVRGAGHMVPSIMPEQALELFKYFLANQNLPSK 480



>gb:AC051633_1540157 Oryza sativa chromosome 10 BAC OSJNBb0015I11
            genomic sequence, complete sequence.
          Length = 437

 Score =  424 bits (1090), Expect = e-117
 Identities = 216/452 (47%), Positives = 285/452 (63%), Gaps = 4/452 (0%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPS-APLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            QE D++  LPGQP+ +P    +SGY+T ++  G+ALFYWF EA   P  KPLVLWLNGGP
Sbjct: 4    QELDRVMSLPGQPAYSPEFRQYSGYVTTDEYLGKALFYWFLEATDKPDEKPLVLWLNGGP 63

Query: 1416 GCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXX 1237
            GCSSIG+G A ELGP  VK++   L  N Y+WN+ ANLLF++SP GVGFSYTN       
Sbjct: 64   GCSSIGFGQAQELGPFLVKKDVAELELNPYAWNQVANLLFLDSPAGVGFSYTNTSFGKDP 123

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              D   A  +Y FL+ W +RFPQ K  +F+IAGESYAGHYVPQLA V+ D+N+       
Sbjct: 124  PGDNSTAYGSYTFLIRWFQRFPQHKMKEFYIAGESYAGHYVPQLANVIVDQNKIAPKENY 183

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMS 877
            INLKG ++GN   +   D  G+++ AW HA+ISD+ Y   ++ C+F+  + S +CN A+ 
Sbjct: 184  INLKGIMIGNAYMDGDTDLLGIVDSAWHHALISDKLYSDFQKFCNFSLVDLSKECNAAID 243

Query: 876  IVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAY---RRMKRIPGGY 706
                 Y  IDIY++Y PRC               +L   N   ++A    R   RIP GY
Sbjct: 244  QFNALYSIIDIYSLYTPRC---------------ELGYPNFNSSFAAQIGRTSSRIPMGY 288

Query: 705  DPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI 526
            DPC   YA EYFNR DVQKA HANI  PG+   +  C + + RA+  +  ++LP+ +KL 
Sbjct: 289  DPCSQTYATEYFNRKDVQKALHANI--PGA---YSLCHNSINRAWNDSDMTVLPIVKKLT 343

Query: 525  KGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVT 346
            + GL+IWIYSGD D R+P   +RY ++ L LP+K  W  WFH+ QVGG  V + GLTFVT
Sbjct: 344  QSGLRIWIYSGDTDARIPTTSTRYTLKKLGLPIKEDWSPWFHHKQVGGWSVVFDGLTFVT 403

Query: 345  VRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            VRGAGH+VP   P +AL L   FL+ + LP++
Sbjct: 404  VRGAGHMVPSIMPEQALELFKYFLANQNLPSK 435



>gb:AP004366_1840850 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0460C04.
          Length = 454

 Score =  418 bits (1075), Expect = e-115
 Identities = 219/467 (46%), Positives = 294/467 (62%), Gaps = 3/467 (0%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            +++ V  + +++    QESD+I  LPGQP+    + +SGY+TVNQ+HGRALFYW  EA  
Sbjct: 9    VLLLVSVSVAAAASGDQESDRIRELPGQPAKVRFSQYSGYVTVNQAHGRALFYWLVEAVP 68

Query: 1461 HPSN-KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESP 1285
                  PLVLWLNGGPGCSS+GYGA+ E+GP R++ +G  L+ N  SWNK ANLLF+ESP
Sbjct: 69   AAGPIAPLVLWLNGGPGCSSVGYGASEEVGPFRIRPDGKTLYLNPNSWNKAANLLFLESP 128

Query: 1284 VGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQL 1105
             GVGFSY+N         D   A D Y FLVNWLERFPQ+K  +F+IAGESYAGHYVPQL
Sbjct: 129  AGVGFSYSNKTLDLYVAGDAKTASDAYAFLVNWLERFPQYKYREFYIAGESYAGHYVPQL 188

Query: 1104 AEVVFDRNRDRGIY-PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEV 928
            A++++++N  +GI  P INLKGF+VGN  T+DY+DY G  EY W+H +ISD  Y   K+ 
Sbjct: 189  AQLIYEQN--KGIQNPIINLKGFMVGNAVTDDYHDYLGTFEYWWTHGLISDNTYHNLKKT 246

Query: 927  CDF-TQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKE 751
            C   + E+ S +C + +++  ++   ID Y++Y   C  N +S   G+ G          
Sbjct: 247  CLLESSEHPSPECLKNLNLASSEEGNIDPYSLYTKPC-NNTASLKLGLGG---------- 295

Query: 750  RTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAY 571
                  R   +   YDPC   Y+  Y+NR +VQ A HAN    G   +WKTCSD V   +
Sbjct: 296  ------RYPWLSRAYDPCTERYSSIYYNRPEVQIAMHAN--TTGIQYSWKTCSDIVGSYW 347

Query: 570  KYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQ 391
              +  S+LP+Y++LI  G++IW++SGD D  VPV  +RY I+ALKLP    W  W+ + +
Sbjct: 348  ADSPKSMLPIYQELIAAGIRIWVFSGDTDAVVPVTATRYSIDALKLPTMVNWYPWYDHGK 407

Query: 390  VGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            VGG    Y GLT VT+ GAGH VPL++P EAL L   FL    +P Q
Sbjct: 408  VGGWSQVYKGLTLVTIAGAGHEVPLHRPREALILFRHFLQNTPMPTQ 454



>gb:AP003225_1825630 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0011G08.
          Length = 471

 Score =  417 bits (1073), Expect = e-115
 Identities = 210/454 (46%), Positives = 285/454 (62%), Gaps = 6/454 (1%)
 Frame = -2

Query: 1599 AAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGG 1420
            A   +D+I  LPGQP     + +SGY+TV+ + GRALFYW  EA + P++ PLVLWLNGG
Sbjct: 35   AEAAADRITALPGQPRVNF-SMYSGYVTVDAAAGRALFYWLIEA-ADPASAPLVLWLNGG 92

Query: 1419 PGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXX 1240
            PGCSS+GYGA+ ELG  R+  +G  L+ N Y WN+ AN+LF++SP GVG+SY+N      
Sbjct: 93   PGCSSVGYGASEELGAFRINPDGRSLYLNPYPWNRVANMLFLDSPAGVGYSYSNTTSDLF 152

Query: 1239 XXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYP 1060
               D   A D+Y FLVNWLERFPQ+K  DF+IAGESY GHYVPQL+++V+  N+D    P
Sbjct: 153  TAGDNKTAHDSYAFLVNWLERFPQYKYRDFYIAGESYGGHYVPQLSQLVYRNNKDVE-KP 211

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDF-TQENWSDKCNEA 883
             +N KGF+VGN   +DY+DY G  EY W+H +ISD  Y K +  CDF +  + S+ CN+ 
Sbjct: 212  ILNFKGFMVGNAVIDDYHDYVGTFEYWWTHGLISDDTYQKLQVACDFESSAHASEACNKI 271

Query: 882  MSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKR-----I 718
              +   +   ID Y+IY P C                     K+ ++  RR+ R     +
Sbjct: 272  YEVAEAEQGNIDAYSIYTPTC---------------------KKTSFLKRRLIRGNSPWL 310

Query: 717  PGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVY 538
            P GYDPC   Y+ +Y+N  +VQKAFHAN+   G    W TCSD +F  +K +  S+LP+Y
Sbjct: 311  PRGYDPCTEKYSTKYYNLPEVQKAFHANV--TGIPYAWTTCSDDLFYYWKDSPRSMLPIY 368

Query: 537  EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGL 358
             +LI  GL+IW++SGDAD  VP+  +RY I+AL LP  + W  W+ + +V G    Y GL
Sbjct: 369  RELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGL 428

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            T VT+RGAGH VPL++P +AL L   FL  + +P
Sbjct: 429  TLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP 462



>gb:AP002539_1822533 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0433F09.
          Length = 490

 Score =  417 bits (1073), Expect = e-115
 Identities = 210/454 (46%), Positives = 285/454 (62%), Gaps = 6/454 (1%)
 Frame = -2

Query: 1599 AAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGG 1420
            A   +D+I  LPGQP     + +SGY+TV+ + GRALFYW  EA + P++ PLVLWLNGG
Sbjct: 35   AEAAADRITALPGQPRVNF-SMYSGYVTVDAAAGRALFYWLIEA-ADPASAPLVLWLNGG 92

Query: 1419 PGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXX 1240
            PGCSS+GYGA+ ELG  R+  +G  L+ N Y WN+ AN+LF++SP GVG+SY+N      
Sbjct: 93   PGCSSVGYGASEELGAFRINPDGRSLYLNPYPWNRVANMLFLDSPAGVGYSYSNTTSDLF 152

Query: 1239 XXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYP 1060
               D   A D+Y FLVNWLERFPQ+K  DF+IAGESY GHYVPQL+++V+  N+D    P
Sbjct: 153  TAGDNKTAHDSYAFLVNWLERFPQYKYRDFYIAGESYGGHYVPQLSQLVYRNNKDVE-KP 211

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDF-TQENWSDKCNEA 883
             +N KGF+VGN   +DY+DY G  EY W+H +ISD  Y K +  CDF +  + S+ CN+ 
Sbjct: 212  ILNFKGFMVGNAVIDDYHDYVGTFEYWWTHGLISDDTYQKLQVACDFESSAHASEACNKI 271

Query: 882  MSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKR-----I 718
              +   +   ID Y+IY P C                     K+ ++  RR+ R     +
Sbjct: 272  YEVAEAEQGNIDAYSIYTPTC---------------------KKTSFLKRRLIRGNSPWL 310

Query: 717  PGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVY 538
            P GYDPC   Y+ +Y+N  +VQKAFHAN+   G    W TCSD +F  +K +  S+LP+Y
Sbjct: 311  PRGYDPCTEKYSTKYYNLPEVQKAFHANV--TGIPYAWTTCSDDLFYYWKDSPRSMLPIY 368

Query: 537  EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGL 358
             +LI  GL+IW++SGDAD  VP+  +RY I+AL LP  + W  W+ + +V G    Y GL
Sbjct: 369  RELIAAGLRIWVFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDDEEVAGWCQVYQGL 428

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            T VT+RGAGH VPL++P +AL L   FL  + +P
Sbjct: 429  TLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPMP 462



>pir|T50511|T50511 serine-type carboxypeptidase II-like protein -
            Arabidopsis thaliana>gb:ATT22D6_1555237 Arabidopsis
            thaliana DNA chromosome 5, BAC clone T22D6 (ESSA
            project).>gb:AY062969_1565558 Arabidopsis thaliana
            putative serine-type carboxypeptidase II (At5g08260)
            mRNA, complete cds.>gb:AF370244_1792129 Arabidopsis
            thaliana putative serine-type carboxypeptidase II
            (At5g08260) mRNA, complete cds.
          Length = 480

 Score =  417 bits (1071), Expect = e-115
 Identities = 218/458 (47%), Positives = 289/458 (63%), Gaps = 5/458 (1%)
 Frame = -2

Query: 1608 SPKAAQESDKIGYLPGQPSAPLLTHFSGYITVN-QSHGRALFYWFFEAKSHPSNKPLVLW 1432
            S    +E D +  LPGQP      H++GY+ +  +   +ALFYWFFEA+ + S +PLVLW
Sbjct: 30   SSSGRKEDDLVTGLPGQPPVNF-KHYAGYVNLGPEQKQKALFYWFFEAQQNSSRRPLVLW 88

Query: 1431 LNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            LNGGPGCSSI YGAA ELGP  V  NG  L +N +SWNKEAN+LF+E+PVGVGFSYTN  
Sbjct: 89   LNGGPGCSSIAYGAAQELGPFLVHDNGGKLTYNHFSWNKEANMLFLEAPVGVGFSYTNNS 148

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                   D+  A D+  FL+NW  +FP+F+  +F+I+GESYAGHYVPQLAEV++DRN+  
Sbjct: 149  MDLQKLGDEVTASDSLAFLINWFMKFPEFRSSEFYISGESYAGHYVPQLAEVIYDRNKKV 208

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE--NWSD 898
                 INLKGF++GN   N+  D  GL++YAWSHAIISD+ +      C F ++  N ++
Sbjct: 209  TKDSSINLKGFMIGNAVINEATDMAGLVDYAWSHAIISDEVHTSIHGSCSFEEDTTNKTE 268

Query: 897  KCNEAMSIVFTKYEEIDIYNIYGPRCLLN-GSSSATGIRGVLDLALTNKERTYAYRRMKR 721
            +C          Y +IDIY+IY P CL +  SSS    + V+   L   +  +      +
Sbjct: 269  QCYNNFKGFMDAYNDIDIYSIYTPVCLSSLLSSSPRKPKIVVSPRLLTFDDLW-----DK 323

Query: 720  IPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV 541
             P GYDPC   YAE YFNR DVQ A HAN+        +  CS  V + +     +++P+
Sbjct: 324  FPAGYDPCTESYAENYFNRKDVQVALHANV--TNLPYPYSPCSG-VIKRWSDAPSTMIPI 380

Query: 540  YEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-H 364
             +KL+ GGL+IWIYSGD DGRVPV  +RY I+ + L ++SPWRSWFH  QV G +  Y  
Sbjct: 381  IQKLLTGGLRIWIYSGDTDGRVPVTSTRYSIKKMGLKVESPWRSWFHKSQVAGWVETYAG 440

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            GL FVTVRGAGH VP   P+++L L   F+S   LP++
Sbjct: 441  GLNFVTVRGAGHQVPALAPAQSLTLFSHFISSVPLPSK 478



>gb:AY088154_1573176 Arabidopsis thaliana clone 42069 mRNA, complete
            sequence.
          Length = 471

 Score =  408 bits (1048), Expect = e-112
 Identities = 208/448 (46%), Positives = 278/448 (62%), Gaps = 3/448 (0%)
 Frame = -2

Query: 1590 ESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGC 1411
            E+D+I  LPGQP+      FSGY+TV++  GR+LFYW  EA   P +KPLV+WLNGGPGC
Sbjct: 32   EADRITSLPGQPNVTF-EQFSGYVTVDKLSGRSLFYWLTEASDLPLSKPLVIWLNGGPGC 90

Query: 1410 SSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXX 1231
            SS+ YGA+ E+GP R+ + G GL+ NK++WN  +NLLF+E+P GVGFSYTN         
Sbjct: 91   SSVAYGASEEIGPFRISKGGSGLYLNKFAWNSISNLLFLEAPAGVGFSYTNRSSDLFNTG 150

Query: 1230 DKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRIN 1051
            D+  A+D+  FL+ WL RFP++   + +I GESYAGHYVPQLA+ + + N+ R   P +N
Sbjct: 151  DRRTAKDSLQFLIQWLHRFPRYNHREIYITGESYAGHYVPQLAKEIMNYNK-RSKNP-LN 208

Query: 1050 LKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIV 871
            LKG +VGN  T+++YD  G + Y WSHA+ISD+ Y +    CDF+++  SD+C    S  
Sbjct: 209  LKGIMVGNAVTDNHYDNLGTVSYWWSHAMISDRTYHQLISTCDFSRQKESDECETLYSYA 268

Query: 870  F-TKYEEIDIYNIYGPRC--LLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDP 700
               ++  ID YNIY P C    +G  S  G  G   + L +   +     + R   GYDP
Sbjct: 269  MEQEFGNIDQYNIYAPPCNKSSDGGGSYNGSSGRRSMRLPHLPHS-----VLRKISGYDP 323

Query: 699  CYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG 520
            C   YAE Y+NR DVQKA HAN         W  CS+ + R +  T  ++LP+Y ++I G
Sbjct: 324  CTERYAEIYYNRPDVQKALHAN--TTKIPYKWTACSEVLNRNWNDTDSTVLPIYREMIAG 381

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVR 340
            G+++W++SGD D  VPV  +RY +  L L  K PW  W+   QVGG    Y GLTFVTVR
Sbjct: 382  GIRVWVFSGDVDSVVPVTATRYSLARLSLSTKLPWYPWYVKKQVGGWTEVYEGLTFVTVR 441

Query: 339  GAGHLVPLNKPSEALALIHSFLSGEELP 256
            GAGH VPL KP  A  L   FL G+ LP
Sbjct: 442  GAGHEVPLFKPRAAFELFKYFLRGKPLP 469



>gb:ATAC011664_1543341 Arabidopsis thaliana chromosome III BAC F1C9
            genomic sequence, complete sequence.>gb:AY037210_1560104
            Arabidopsis thaliana AT3g02110/F1C9_10 mRNA, complete
            cds.>gb:BT002657_1636260 Arabidopsis thaliana
            At3g02110/F1C9_10 gene, complete cds.
          Length = 473

 Score =  408 bits (1048), Expect = e-112
 Identities = 208/448 (46%), Positives = 278/448 (62%), Gaps = 3/448 (0%)
 Frame = -2

Query: 1590 ESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGC 1411
            E+D+I  LPGQP+      FSGY+TV++  GR+LFYW  EA   P +KPLV+WLNGGPGC
Sbjct: 34   EADRITSLPGQPNVTF-EQFSGYVTVDKLSGRSLFYWLTEASDLPLSKPLVIWLNGGPGC 92

Query: 1410 SSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXX 1231
            SS+ YGA+ E+GP R+ + G GL+ NK++WN  +NLLF+E+P GVGFSYTN         
Sbjct: 93   SSVAYGASEEIGPFRISKGGSGLYLNKFAWNSISNLLFLEAPAGVGFSYTNRSSDLFNTG 152

Query: 1230 DKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRIN 1051
            D+  A+D+  FL+ WL RFP++   + +I GESYAGHYVPQLA+ + + N+ R   P +N
Sbjct: 153  DRRTAKDSLQFLIQWLHRFPRYNHREIYITGESYAGHYVPQLAKEIMNYNK-RSKNP-LN 210

Query: 1050 LKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIV 871
            LKG +VGN  T+++YD  G + Y WSHA+ISD+ Y +    CDF+++  SD+C    S  
Sbjct: 211  LKGIMVGNAVTDNHYDNLGTVSYWWSHAMISDRTYHQLISTCDFSRQKESDECETLYSYA 270

Query: 870  F-TKYEEIDIYNIYGPRC--LLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDP 700
               ++  ID YNIY P C    +G  S  G  G   + L +   +     + R   GYDP
Sbjct: 271  MEQEFGNIDQYNIYAPPCNKSSDGGGSYNGSSGRRSMRLPHLPHS-----VLRKISGYDP 325

Query: 699  CYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG 520
            C   YAE Y+NR DVQKA HAN         W  CS+ + R +  T  ++LP+Y ++I G
Sbjct: 326  CTERYAEIYYNRPDVQKALHAN--TTKIPYKWTACSEVLNRNWNDTDSTVLPIYREMIAG 383

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVR 340
            G+++W++SGD D  VPV  +RY +  L L  K PW  W+   QVGG    Y GLTFVTVR
Sbjct: 384  GIRVWVFSGDVDSVVPVTATRYSLARLSLSTKLPWYPWYVKKQVGGWTEVYEGLTFVTVR 443

Query: 339  GAGHLVPLNKPSEALALIHSFLSGEELP 256
            GAGH VPL KP  A  L   FL G+ LP
Sbjct: 444  GAGHEVPLFKPRAAFELFKYFLRGKPLP 471



>gb:ATAC013483_1543561 Arabidopsis thaliana chromosome III BAC F17A17
            genomic sequence, complete sequence.>gb:BT015083_1642053
            Arabidopsis thaliana At3g07990 gene, complete
            cds.>gb:BT015904_1642522 Arabidopsis thaliana At3g07990
            gene, complete cds.
          Length = 459

 Score =  407 bits (1045), Expect = e-112
 Identities = 220/474 (46%), Positives = 291/474 (61%), Gaps = 5/474 (1%)
 Frame = -2

Query: 1662 TFLLVGFL--VIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRAL 1489
            +FLL+  L  +    CA  SS    Q  D+I  LPGQPS      +SGY+TV++  GRAL
Sbjct: 4    SFLLIILLLTISTSCCAAPSSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRAL 63

Query: 1488 FYWFFEAK--SHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNK 1315
            FYW  E+     P ++PLVLWLNGGPGCSS+ YGAA E+GP RV  +G  LH   Y+WNK
Sbjct: 64   FYWLVESPLARDPKSRPLVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHSKLYAWNK 123

Query: 1314 EANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGE 1135
             ANLLF+ESP GVGFSY+N         D+  A+D+Y FLVNW ERFPQ+K  +F+I GE
Sbjct: 124  LANLLFLESPAGVGFSYSNTTSDLYTTGDQRTAEDSYIFLVNWFERFPQYKHREFYIVGE 183

Query: 1134 SYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD 955
            SYAGH+VPQL+++V +RN+     P INLKGF+VGN  T+DY+DY G  EY W+H +ISD
Sbjct: 184  SYAGHFVPQLSKLVHERNKGFK-NPAINLKGFMVGNAVTDDYHDYIGTFEYWWNHGLISD 242

Query: 954  QQYDKAKEVC-DFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGV 778
              Y + K  C   + ++ S +C  A+     +   ID Y+I+   C     +S   ++  
Sbjct: 243  STYHQLKTACYSVSSQHPSMQCMVALRNAELEQGNIDPYSIFTKPC-----NSTVALKRF 297

Query: 777  LDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKT 598
            L      K R   Y  M R    YDPC   Y+  YFNR+DVQKA HAN+     +  WK 
Sbjct: 298  L------KGR---YPWMSR---AYDPCTERYSNVYFNRLDVQKALHANVTR--LSYPWKA 343

Query: 597  CSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSP 418
            CSD V   +  +  S+LP+Y++LI  GLKIW++SGD D  VP+  +RY ++ALKL   + 
Sbjct: 344  CSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSGDTDAVVPITATRYSVDALKLATITN 403

Query: 417  WRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            W  W+ + +VGG    Y GLT VTV GAGH VPL++P +A  L  SFL  + +P
Sbjct: 404  WYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLESKPMP 457



>gb:AC136522_1743266 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0037H03, complete sequence.
          Length = 483

 Score =  400 bits (1029), Expect = e-110
 Identities = 210/458 (45%), Positives = 279/458 (60%), Gaps = 5/458 (1%)
 Frame = -2

Query: 1614 SSSPKAAQES----DKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNK 1447
            SSS  AA  S    +++ YLPGQP       +SGY+TV++  GR+LFYW  EA +     
Sbjct: 31   SSSAAAAAASGLAGERVTYLPGQPPVDF-DMYSGYVTVDKRAGRSLFYWLQEAPAAAQPA 89

Query: 1446 PLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFS 1267
            PLVLWLNGGPGCSS+ YGA+ ELG  R++ +G  L  N Y WNK AN+LF++SP GVGFS
Sbjct: 90   PLVLWLNGGPGCSSVAYGASEELGAFRIRPDGATLFLNDYRWNKVANILFLDSPAGVGFS 149

Query: 1266 YTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFD 1087
            YTN         DK  A D+Y FLV W E+FPQ+K  DF+IAGESYAGHYVPQL+++V+ 
Sbjct: 150  YTNTTSDLYDSGDKRTAHDSYKFLVKWFEKFPQYKYRDFYIAGESYAGHYVPQLSQLVY- 208

Query: 1086 RNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-DFTQE 910
            RN      P IN KGF+VGN  T+DY+DY G  EY W+H IISD  Y      C   + E
Sbjct: 209  RNNKGVKEPLINFKGFMVGNAVTDDYHDYIGTFEYWWNHGIISDGTYRLLNASCVHDSGE 268

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
            + +  C  A++    +  +ID+Y++Y P C    +SSA             ++R      
Sbjct: 269  HPAPACLAALNASTVEQGDIDMYSLYTPTCNETSTSSAAA-----------RQRRLKQGH 317

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
               + G YDPC   Y+ EY+NR +VQ+A HAN+   G    W TCSD +   ++ +  S+
Sbjct: 318  YPWMTGSYDPCTERYSTEYYNRPEVQRALHANV--TGINYTWATCSDILNDNWRDSPRSV 375

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVE 370
            LP+Y +LI  GL+IW++SGD D  VP+  +RY I+AL LP    W  W+   +VGG    
Sbjct: 376  LPIYHELIAAGLRIWVFSGDTDAVVPLTATRYSIDALGLPTTVSWYPWYDAMKVGGWSQV 435

Query: 369  YHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            Y GL+ VTVRGAGH VPL++P +AL L   FL G+ +P
Sbjct: 436  YKGLSLVTVRGAGHEVPLHRPRQALILFKHFLQGKPMP 473



>gb:AY308957_1597860 Medicago truncatula putative serine
            carboxypeptidase mRNA, complete cds.
          Length = 495

 Score =  398 bits (1023), Expect = e-109
 Identities = 210/446 (47%), Positives = 267/446 (59%), Gaps = 6/446 (1%)
 Frame = -2

Query: 1587 SDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCS 1408
            +DKI  LPGQP       +SGY+TV+   GR LFY+F E+  +   KPL+LWLNGGPGCS
Sbjct: 75   ADKIVTLPGQPYGVNFDQYSGYVTVDPEAGRELFYYFVESPHNSYTKPLILWLNGGPGCS 134

Query: 1407 SIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXD 1228
            S+GYGA  ELGP RV  +G  L+ N Y+WN+ AN+LF+ESP GVGFSY+N         D
Sbjct: 135  SLGYGAFEELGPFRVNSDGKTLYRNPYAWNEVANVLFLESPAGVGFSYSNTSSDYDNSGD 194

Query: 1227 KFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR--I 1054
            K  A+D Y FL+NWLERFPQ+K  DF+I GESYAGHYVPQLA  +   N+   +Y    I
Sbjct: 195  KSTAKDAYVFLINWLERFPQYKTRDFYITGESYAGHYVPQLASTILYNNK---LYNNTII 251

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NLKG  +GN   +D  + KG+ +  W+HA+ SDQ ++  ++ CDFT+EN S  CN A   
Sbjct: 252  NLKGISIGNAWIDDATNLKGIYDNLWTHALNSDQTHELIEKYCDFTKENVSAICNNATDK 311

Query: 873  VFTKYEEIDIYNIYGPRC----LLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGY 706
             F +  +IDIYNI+ P C    L NGSS+                          +   +
Sbjct: 312  AFVETGKIDIYNIHAPLCHDSSLKNGSSTG------------------------YVSNDF 347

Query: 705  DPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI 526
            DPC   Y   Y NR +VQKA HA         NW  C+  +   +K +  ++LP  + LI
Sbjct: 348  DPCSDYYVTAYLNRPEVQKALHA------KPTNWTHCTH-LLTTWKDSPATVLPTVKYLI 400

Query: 525  KGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVT 346
              G+K+WIYSGD D  VP   SRY I  LKLP+ S WR W+   ++GG +V Y GLTFVT
Sbjct: 401  DSGIKLWIYSGDTDVVVPTTSSRYLINTLKLPINSAWRPWYSGKEIGGYVVGYKGLTFVT 460

Query: 345  VRGAGHLVPLNKPSEALALIHSFLSG 268
            VRGAGHLVP  +P  AL LI SFL G
Sbjct: 461  VRGAGHLVPSWQPERALTLISSFLYG 486



>gb:AP005184_1848974 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0047B07.
          Length = 524

 Score =  398 bits (1022), Expect = e-109
 Identities = 207/468 (44%), Positives = 284/468 (60%), Gaps = 13/468 (2%)
 Frame = -2

Query: 1620 AESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAK---SHPSN 1450
            A +++   ++E+D++  LPGQP+      ++GY+TV+ + GRALFY+  EA    +  S 
Sbjct: 72   APAAAAVGSKEADRVAGLPGQPAGVGFAQYAGYVTVDAAAGRALFYYLAEADGGAAASSK 131

Query: 1449 KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGF 1270
             PL+LWLNGGPGCSS+GYGA  ELGP RVK +GV L+ N YSWN  AN++F+ESP+GVGF
Sbjct: 132  APLLLWLNGGPGCSSLGYGAMEELGPFRVKSDGVSLYRNPYSWNNVANVMFLESPIGVGF 191

Query: 1269 SYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVF 1090
            SY+N         D   A+D Y FLVNW+ERFP++KG DF++AGESYAGHYVPQLA  + 
Sbjct: 192  SYSNTTADYSRMGDNSTAEDAYKFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAIL 251

Query: 1089 DRNR----DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD 922
              +      +     INLKG ++GN   ND+ D KG+ ++ W+HA+ISD+  D   + C+
Sbjct: 252  RHSSAAAGGKPSSSPINLKGIMIGNAVINDWTDTKGMYDFFWTHALISDEANDGITKHCN 311

Query: 921  FTQ-ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERT 745
            FT   + +  C++A S+     ++IDIYNIY P C   G   +  +   ++         
Sbjct: 312  FTDGADANSLCDDATSLADDCLQDIDIYNIYAPNCQSPGLVVSPPVTPSIE--------- 362

Query: 744  YAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKY 565
                        +DPC   Y E Y N  DVQKA HANI        W  CS  V R +  
Sbjct: 363  -----------SFDPCTDYYVEAYLNNPDVQKALHANITRLDHP--WSACSG-VLRRWVD 408

Query: 564  TTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQ-- 391
            +  ++LP+ ++L+K  +++W+YSGD DGRVPV  SRY +  L LP+ + WR WF N Q  
Sbjct: 409  SASTVLPIIKELLKNNIRVWVYSGDTDGRVPVTSSRYSVNQLNLPVAAKWRPWFSNTQGV 468

Query: 390  --VGGRIVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
              VGG IV+Y G L+ VTVRGAGH VP  +P  AL L+  FL G+ LP
Sbjct: 469  GDVGGYIVQYKGNLSLVTVRGAGHEVPSYQPQRALVLVQYFLEGKTLP 516



>gb:AY050958_1562441 Arabidopsis thaliana putative serine
            carboxypeptidase II (At4g30810) mRNA, complete
            cds.>gb:AY133774_1581594 Arabidopsis thaliana clone
            U10970 putative serine carboxypeptidase II (At4g30810)
            mRNA, complete cds.
          Length = 479

 Score =  396 bits (1017), Expect = e-109
 Identities = 208/468 (44%), Positives = 280/468 (59%), Gaps = 2/468 (0%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            + + FL    LC    S K   E DK+  LPGQ       H+SG++  N+  GRALFYW 
Sbjct: 15   IAIAFLATAHLCEAGLSQK---EQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFYWL 71

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLF 1297
            FEA     +KPLVLWLNGGPGCSS+ YG A E+GP  +K +G  L+ N+YSWN+ AN+LF
Sbjct: 72   FEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQYSWNQAANILF 131

Query: 1296 VESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHY 1117
            +++PVGVG+SY+N         DK  A+D+  FL+ W+ERFP++KG DF+I GESYAGHY
Sbjct: 132  LDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDFYIVGESYAGHY 191

Query: 1116 VPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKA 937
            +PQL+E +   N+       INLKG++VGN   +D++D  GL +Y WS   ISDQ Y   
Sbjct: 192  IPQLSEAIVKHNQGSD-KNSINLKGYMVGNGLMDDFHDRLGLFQYIWSLGFISDQTYSLL 250

Query: 936  KEVCDFTQENWSDK-CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALT 760
            +  C F     S K CN+ + I   +   ID Y+++ P C+ N S S        ++ L 
Sbjct: 251  QLQCGFESFIHSSKQCNKILEIADKEIGNIDQYSVFTPACVANASQS--------NMLLK 302

Query: 759  NKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPG-STVNWKTCSDPV 583
             +  T       R+   YDPC   +   YFN  +VQKA H     PG +   W TCSD V
Sbjct: 303  KRPMT------SRVSEQYDPCTEKHTTVYFNLPEVQKALHV---PPGLAPSKWDTCSDVV 353

Query: 582  FRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWF 403
               +  +  S+L +Y +LI  GL+IW++SGDAD  VPV  +RY I+AL L   S +  W+
Sbjct: 354  SEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWY 413

Query: 402  HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
             + QVGG   +Y GL FVTVRGAGH VPL++P +ALAL  +F+SG  L
Sbjct: 414  LDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL 461



>gb:AP003489_1829915 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0568D10.>gb:AP003508_1830060 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0470C02.
          Length = 484

 Score =  394 bits (1013), Expect = e-108
 Identities = 198/452 (43%), Positives = 282/452 (62%), Gaps = 2/452 (0%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNG 1423
            +A QE D++  +PGQ        ++GY+ V++  G +LFYWFFEA   P++KPLVLWLNG
Sbjct: 41   RAEQERDRVARVPGQDFDVGFAQYAGYVAVSEERGASLFYWFFEAADDPASKPLVLWLNG 100

Query: 1422 GPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXX 1243
            GPGCSSI YG A E+GP  V  +G G+H N YSWN+ AN+LF++SPVGVG+SY+N     
Sbjct: 101  GPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYSYSNASDDI 160

Query: 1242 XXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY 1063
                D   A D+  FL  W+ERFPQ+KG +F++ GESYAGHYVPQLA+ +  R+ +    
Sbjct: 161  LNNGDARTANDSLTFLTKWIERFPQYKGREFYVTGESYAGHYVPQLAQAI-KRHHEATGD 219

Query: 1062 PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ-ENWSDKCNE 886
              INLKG++ GN   +D++D+ G+ ++ W++ +ISDQ Y      CD+    + S +CN+
Sbjct: 220  KSINLKGYMAGNALFDDFHDHLGIFQFMWTNGLISDQTYRLLNVFCDYESFVHTSSQCNK 279

Query: 885  AMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGY 706
             + I   +   ID Y+I+ P C  + +SS   +           +R ++  +M      Y
Sbjct: 280  ILDIASDEAGNIDSYSIFTPTCHASFASSRNKV----------MKRLHSVGKMGE---RY 326

Query: 705  DPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI 526
            DPC   ++  YFN  +VQKA H +     S   W+TCSD V   +K    S+L +Y +LI
Sbjct: 327  DPCTEKHSTVYFNLAEVQKALHVSPIINKS--KWETCSDVVNTNWKDCERSVLHIYHELI 384

Query: 525  KGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNH-QVGGRIVEYHGLTFV 349
            + GL+IW++SGD D  +PV  +RY I ALKLP  +PW +W+ +  +VGG    Y GL FV
Sbjct: 385  QYGLRIWVFSGDTDAVLPVTSTRYSINALKLPTVTPWNAWYDDDGEVGGWTQGYKGLNFV 444

Query: 348  TVRGAGHLVPLNKPSEALALIHSFLSGEELPA 253
            TVRGAGH VPL++P +AL LI SFL+G  +P+
Sbjct: 445  TVRGAGHEVPLHRPKQALILIKSFLAGSPMPS 476



>sp|P55748|CP22_HORVU Serine carboxypeptidase II-2 precursor (EC
            3.4.16.6) (CP-MII.2) (Fragment).>gb:HVACXPII2_1682226
            Hordeum vulgare L. (Alexis) mRNA for serine
            carboxypeptidase II-2.
          Length = 436

 Score =  391 bits (1004), Expect = e-107
 Identities = 196/440 (44%), Positives = 277/440 (62%), Gaps = 2/440 (0%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            +PGQ       H++GY+TV++  G ALFYWFFEA   P++KPL+LWLNGGPGCSSI +G 
Sbjct: 4    VPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIAFGV 63

Query: 1389 AAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQD 1210
              E+GP  V  +G G+H N YSWN+ AN+LF++SPVGVG+SY+N         D+  A+D
Sbjct: 64   GEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILSNGDERTAKD 123

Query: 1209 TYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVG 1030
            +  FL  WLERFPQ+K  +F++ GESYAGHYVPQLA+ +  R+ +      INLKG++VG
Sbjct: 124  SLVFLTKWLERFPQYKEREFYLTGESYAGHYVPQLAQAI-KRHHEATGDKSINLKGYMVG 182

Query: 1029 NPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ-ENWSDKCNEAMSIVFTKYEE 853
            N  T+D++D+ G+ +Y W+  +ISDQ Y      CDF    + S +C++ + I  T+   
Sbjct: 183  NALTDDFHDHYGIFQYMWTTGLISDQTYKLLNIFCDFESFVHTSPQCDKILDIASTEAGN 242

Query: 852  IDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEY 673
            ID Y+I+ P C  + +SS   +                 R + ++   YDPC   ++  Y
Sbjct: 243  IDSYSIFTPTCHSSFASSRNKV-------------VKRLRSVGKMGEQYDPCTEKHSIVY 289

Query: 672  FNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSG 493
            FN  +VQKA H N     S   W+TCS+ +   +K    S+L +Y +LI+ GL+IW++SG
Sbjct: 290  FNLHEVQKALHVNPVIGKS--KWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSG 347

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRSWFHNH-QVGGRIVEYHGLTFVTVRGAGHLVPL 316
            D D  +PV  +RY I+ALKLP  +PW +W+ +  +VGG    Y GL FVTVRGAGH VPL
Sbjct: 348  DTDAVIPVTSTRYSIDALKLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPL 407

Query: 315  NKPSEALALIHSFLSGEELP 256
            ++P +AL LI SFL+G  +P
Sbjct: 408  HRPKQALTLIKSFLAGRPMP 427



>pir|A29639|A29639 carboxypeptidase D (EC 3.4.16.6) - wheat
          Length = 423

 Score =  387 bits (994), Expect = e-106
 Identities = 202/449 (44%), Positives = 260/449 (57%), Gaps = 3/449 (0%)
 Frame = -2

Query: 1587 SDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCS 1408
            +D+I  LPGQP+      +SGYITV++  GR+LFY   EA       PLVLWLNGGPGCS
Sbjct: 8    ADRIARLPGQPAVDF-DMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCS 66

Query: 1407 SIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXD 1228
            S+ YGA+ ELG  RVK  G GL  N+Y WNK AN+LF++SP GVGFSYTN         D
Sbjct: 67   SVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGD 126

Query: 1227 KFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINL 1048
               A D+Y FL  W ERFP +K  DF+IAGESYAGHYVP+L+++V      R   P INL
Sbjct: 127  NRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLV-----HRSKNPVINL 181

Query: 1047 KGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC---DFTQENWSDKCNEAMS 877
            KGF+VGN   +DY+DY G  E+ W+H I+SD  Y + KE C    F     S  C+ A  
Sbjct: 182  KGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHP--SPACDAATD 239

Query: 876  IVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPC 697
            +   +   ID+Y++Y P C +  S+                             G YDPC
Sbjct: 240  VATAEQGNIDMYSLYTPVCNITSST-----------------------------GSYDPC 270

Query: 696  YSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGG 517
               Y+  Y+NR DVQ A HAN+        W TCSD +   +     S+LP+Y +LI  G
Sbjct: 271  TERYSTAYYNRRDVQMALHANVTG-AMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAG 329

Query: 516  LKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRG 337
            L+IW++SGD D  VP+  +RY I AL LP  + W  W+ + +VGG    Y GLT V+VRG
Sbjct: 330  LRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRG 389

Query: 336  AGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            AGH VPL++P +AL L   FL G+ +P Q
Sbjct: 390  AGHEVPLHRPRQALVLFQYFLQGKPMPGQ 418



>sp|P08819|CBP2_WHEAT Serine carboxypeptidase II chains A and B (EC
            3.4.16.6) (Carboxypeptidase D) (CPDW-II) (CP-WII).
          Length = 423

 Score =  387 bits (994), Expect = e-106
 Identities = 202/449 (44%), Positives = 260/449 (57%), Gaps = 3/449 (0%)
 Frame = -2

Query: 1587 SDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCS 1408
            +D+I  LPGQP+      +SGYITV++  GR+LFY   EA       PLVLWLNGGPGCS
Sbjct: 8    ADRIARLPGQPAVDF-DMYSGYITVDEGAGRSLFYLLQEAPEDAQPAPLVLWLNGGPGCS 66

Query: 1407 SIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXD 1228
            S+ YGA+ ELG  RVK  G GL  N+Y WNK AN+LF++SP GVGFSYTN         D
Sbjct: 67   SVAYGASEELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGD 126

Query: 1227 KFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINL 1048
               A D+Y FL  W ERFP +K  DF+IAGESYAGHYVP+L+++V      R   P INL
Sbjct: 127  NRTAHDSYAFLAKWFERFPHYKYRDFYIAGESYAGHYVPELSQLV-----HRSKNPVINL 181

Query: 1047 KGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC---DFTQENWSDKCNEAMS 877
            KGF+VGN   +DY+DY G  E+ W+H I+SD  Y + KE C    F     S  C+ A  
Sbjct: 182  KGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHP--SPACDAATD 239

Query: 876  IVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPC 697
            +   +   ID+Y++Y P C +  S+                             G YDPC
Sbjct: 240  VATAEQGNIDMYSLYTPVCNITSST-----------------------------GSYDPC 270

Query: 696  YSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGG 517
               Y+  Y+NR DVQ A HAN+        W TCSD +   +     S+LP+Y +LI  G
Sbjct: 271  TERYSTAYYNRRDVQMALHANVTG-AMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAG 329

Query: 516  LKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRG 337
            L+IW++SGD D  VP+  +RY I AL LP  + W  W+ + +VGG    Y GLT V+VRG
Sbjct: 330  LRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRG 389

Query: 336  AGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            AGH VPL++P +AL L   FL G+ +P Q
Sbjct: 390  AGHEVPLHRPRQALVLFQYFLQGKPMPGQ 418



>pir|G71414|G71414 hydroxymandelonitrile lyase (EC 4.1.2.11) chain A -
            Arabidopsis thaliana>gb:ATCHRIV40_1545312 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            40.>gb:ATFCA2_1551560 Arabidopsis thaliana DNA chromosome
            4, ESSA I FCA contig fragment No. 2.
          Length = 407

 Score =  385 bits (988), Expect = e-105
 Identities = 188/393 (47%), Positives = 260/393 (66%), Gaps = 7/393 (1%)
 Frame = -2

Query: 1416 GCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXX 1237
            GCSS+GYGA  E+GP     N  GL FN Y+WNKE N+LF+ESPVGVGFSY+N       
Sbjct: 17   GCSSVGYGATQEIGPFLADTNEKGLIFNPYAWNKEVNMLFLESPVGVGFSYSNTSSDYLN 76

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRN-RDRGIYP 1060
              D F  +D Y FL NW E+FP+ KG++F+IAGESYAG YVP+LAE+V+D N ++  +  
Sbjct: 77   LDDHFAKKDAYTFLCNWFEKFPEHKGNEFYIAGESYAGIYVPELAELVYDNNEKNNDLSL 136

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQEN-W-SDKCNE 886
             INLKGF++GNP+ ++  D++G ++YAWSHA+ISD+ +     +C+F+ ++ W +DKCNE
Sbjct: 137  HINLKGFLLGNPDISNPDDWRGWVDYAWSHAVISDETHRNINRLCNFSSDDVWNNDKCNE 196

Query: 885  AMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP--- 715
            A++ V  +Y EIDIY++Y   C  + + S+           + + +T  +   KR+P   
Sbjct: 197  AIAEVDKQYNEIDIYSLYTSACKGDSAKSS--------YFASAQFKTNYHISSKRMPPRR 248

Query: 714  -GGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVY 538
              GYDPC   Y + Y+NR DVQKA HA+     +  NW  C+  +F  + Y   S+LP+Y
Sbjct: 249  LAGYDPCLDDYVKVYYNRADVQKALHASDGV--NLKNWSICNMEIFHNWTYVVQSVLPIY 306

Query: 537  EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGL 358
            +KLI GGL+IW+YSGD DG +PV+G+RY + AL LP+K+ WR W+H  QV G + EY GL
Sbjct: 307  QKLIAGGLRIWVYSGDTDGCIPVLGTRYSLNALGLPIKTAWRPWYHEKQVSGWVQEYDGL 366

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            TF T RGAGH VP  KPS +LA I +F+ G  L
Sbjct: 367  TFATFRGAGHTVPSFKPSSSLAFISAFVKGVPL 399



>pir|T05701|T05701 carboxypeptidase D (EC 3.4.16.6) precursor -
            barley>gb:HVCPMII_1682323 H.vulgare gene encoding serine
            carboxypeptidase II, CP-MII.
          Length = 476

 Score =  384 bits (987), Expect = e-105
 Identities = 205/478 (42%), Positives = 278/478 (58%), Gaps = 4/478 (0%)
 Frame = -2

Query: 1671 PNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRA 1492
            P    +L+  L   +L   + +      +D+I  LPGQP       +SGYITV+++ GR+
Sbjct: 12   PAAAAVLLAALTCLLLRPAAVAAAGGHAADRIVRLPGQPEVDF-DMYSGYITVDEAAGRS 70

Query: 1491 LFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKE 1312
            LFY   EA       PLVLWLNGGPGCSS+ YGA+ ELG  RV   G GL  N+Y WNK 
Sbjct: 71   LFYLLQEAPEEAQPAPLVLWLNGGPGCSSVAYGASEELGAFRVMPRGAGLVLNEYRWNKV 130

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            AN+LF++SP GVGFSYTN         D   A D+Y FL  W ERFP +K  +F++AGES
Sbjct: 131  ANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAAWFERFPHYKYREFYVAGES 190

Query: 1131 YAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQ 952
            YAGHYVP+L+++V      R   P INLKGF+VGN   +DY+DY G  E+ W+H I+SD 
Sbjct: 191  YAGHYVPELSQLV-----HRSGNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDD 245

Query: 951  QYDKAKEVC---DFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRG 781
             Y + K+ C    F     S  C+ A  +   +   ID+Y++Y P C ++ SSS++ +  
Sbjct: 246  TYRRLKDACLHDSFIHP--SPACDAATDVATAEQGNIDMYSLYTPVCNISSSSSSSSL-- 301

Query: 780  VLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWK 601
                   ++ RT    R   + G YDPC   Y+  Y+NR DVQ A HAN+        W 
Sbjct: 302  -------SRRRTRG--RYPWLTGSYDPCTERYSTAYYNRRDVQTALHANVTG-AMNYTWA 351

Query: 600  TCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKS 421
            TCSD +   +     S+LP+Y +LI  GL+IW++SGD D  VP+  +RY I AL L   +
Sbjct: 352  TCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTT 411

Query: 420  PWRSWFHN-HQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
             W  W+ +  +VGG    Y GLT V+VRGAGH VPL++P +AL L   FL G+ +P +
Sbjct: 412  SWYPWYDDLQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALILFQQFLQGKPMPGR 469



>sp|P08818|CBP2_HORVU Serine carboxypeptidase II precursor (EC
            3.4.16.6) (Carboxypeptidase D) (CP-MII) [Contains: Serine
            carboxypeptidase II chain A; Serine carboxypeptidase II
            chain B].
          Length = 476

 Score =  382 bits (982), Expect = e-105
 Identities = 204/478 (42%), Positives = 277/478 (57%), Gaps = 4/478 (0%)
 Frame = -2

Query: 1671 PNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRA 1492
            P    +L+  L   +L   + +      +D+I  LPGQP       +SGYITV+++ GR+
Sbjct: 12   PAAAAVLLAALTCLLLRPAAVAAAGGHAADRIVRLPGQPEVDF-DMYSGYITVDEAAGRS 70

Query: 1491 LFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKE 1312
            LFY   EA       PLVLWLNGGPGCSS+ YGA+ ELG  RV   G GL  N+Y WNK 
Sbjct: 71   LFYLLQEAPEEAQPAPLVLWLNGGPGCSSVAYGASEELGAFRVMPRGAGLVLNEYRWNKV 130

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            AN+LF++SP GVGFSYTN         D   A D+Y FL  W ERFP +K  +F++AGES
Sbjct: 131  ANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDSYAFLAAWFERFPHYKYREFYVAGES 190

Query: 1131 YAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQ 952
            YAGHYVP+L+++V      R   P INLKGF+VGN   +DY+DY G  E+ W+H I+SD 
Sbjct: 191  YAGHYVPELSQLV-----HRSGNPVINLKGFMVGNGLIDDYHDYVGTFEFWWNHGIVSDD 245

Query: 951  QYDKAKEVC---DFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRG 781
             Y + K+ C    F     S  C+ A  +   +   ID+Y++Y P C ++ SSS++ +  
Sbjct: 246  TYRRLKDACLHDSFIHP--SPACDAATDVATAEQGNIDMYSLYTPVCNISSSSSSSSL-- 301

Query: 780  VLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWK 601
                   ++ RT    R   + G YDPC   Y+  Y+NR DVQ A HAN+        W 
Sbjct: 302  -------SRRRTRG--RYPWLTGSYDPCTERYSTAYYNRRDVQTALHANVTG-AMNYTWT 351

Query: 600  TCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKS 421
             CSD +   +     S+LP+Y +LI  GL+IW++SGD D  VP+  +RY I AL L   +
Sbjct: 352  NCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTT 411

Query: 420  PWRSWFHN-HQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
             W  W+ +  +VGG    Y GLT V+VRGAGH VPL++P +AL L   FL G+ +P +
Sbjct: 412  SWYPWYDDLQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALILFQQFLQGKPMPGR 469



>gb:AP004094_1837603 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1695_H09.>gb:AP005115_1848142 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0700F06.
          Length = 386

 Score =  380 bits (975), Expect = e-104
 Identities = 194/389 (49%), Positives = 248/389 (63%), Gaps = 1/389 (0%)
 Frame = -2

Query: 1419 PGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXX 1240
            PGCSSI YGA+ E+GP R+K NG GL+ NKYSWN+EANLLF+ESP GVGFSY+N      
Sbjct: 4    PGCSSIAYGASEEIGPFRIKTNGTGLYLNKYSWNREANLLFLESPAGVGFSYSNTTSDLK 63

Query: 1239 XXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYP 1060
               D+  AQD   FL++W+ RFPQ++  DF+IAGESYAGHYVPQLA  + + N+    YP
Sbjct: 64   TSGDERTAQDALQFLISWMSRFPQYRHRDFYIAGESYAGHYVPQLARKIVEFNK-ASPYP 122

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAM 880
             INLKG +VGN  T++YYD  G + Y W+HA+ISD  Y      C+FT  N S  CN AM
Sbjct: 123  FINLKGILVGNGVTDNYYDNIGTVTYWWTHAMISDTTYKAIMSSCNFTSANVSRLCNRAM 182

Query: 879  SIVFT-KYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYD 703
            S     ++ +ID Y+IY P C    +++ATG R      L  K+ T+  RR      GYD
Sbjct: 183  SYAMNHEFGDIDQYSIYTPSCAAAAAANATGRRRGKAAVLRFKD-TFLRRR----SFGYD 237

Query: 702  PCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIK 523
            PC   YAE+Y+NR DVQKA HANI   G    W  CSD + + ++ + FS+LP Y+ L+K
Sbjct: 238  PCTETYAEKYYNRPDVQKAMHANI--TGIPYRWTACSDVLIKTWRDSEFSMLPTYKLLMK 295

Query: 522  GGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTV 343
             GL+IW++SGD D  VPV  +R+ +  L L  K  W  W+   QVGG    Y GLTF +V
Sbjct: 296  AGLRIWVFSGDTDSVVPVTATRFALSHLGLKTKIRWYPWYSAGQVGGWSEVYEGLTFASV 355

Query: 342  RGAGHLVPLNKPSEALALIHSFLSGEELP 256
            RGAGH VPL +P  A  +  SFL+GE LP
Sbjct: 356  RGAGHEVPLFQPRRAFRMFQSFLAGEPLP 384



>sp|P52711|CP23_HORVU Serine carboxypeptidase II-3 precursor (EC
            3.4.16.6) (CP-MII.3).>pir|S44191|S44191 carboxypeptidase
            D (EC 3.4.16.6) II-3 precursor -
            barley>gb:HVACXPII3_1682227 Hordeum vulgare L. (Alexis)
            mRNA for serine carboxypeptidase II-3.
          Length = 516

 Score =  377 bits (969), Expect = e-103
 Identities = 202/457 (44%), Positives = 273/457 (59%), Gaps = 11/457 (2%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAK--SHPSNKPLVLWLNGG 1420
            +E+D++  LPG P       ++GY+TV+ + GRALFY+  EA   +    KPL+LWLNGG
Sbjct: 81   KEADRVEALPGHPRGVDFAQYAGYVTVDAAAGRALFYYLAEAVGGNGDKTKPLLLWLNGG 140

Query: 1419 PGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXX 1240
            PGCSS+GYGA  ELGP RV  +G  L+ N YSWN  AN+LF+ESP GVG+SY+N      
Sbjct: 141  PGCSSLGYGAMEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTTADYG 200

Query: 1239 XXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYP 1060
               D   A+D Y FL NWLERFP++KG +F+I GESYAGHYVPQLA  +      R   P
Sbjct: 201  RSGDNGTAEDAYQFLDNWLERFPEYKGREFYITGESYAGHYVPQLAHAIL-----RHASP 255

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENW----SDKC 892
             INLKG ++GN   ND+ D KG+ ++ W+HA+ISD+  D   + C+FT        +  C
Sbjct: 256  DINLKGIMIGNAVINDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASNALC 315

Query: 891  NEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPG 712
            + A   V     +IDIYNIY P C      S   +   +  ++ N               
Sbjct: 316  DAASDEVGESLADIDIYNIYAPNC-----QSEKLVTPPIAPSIDN--------------- 355

Query: 711  GYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEK 532
             +DPC   Y E Y NR DVQKA HAN+        W  CSD + R +  +  ++LP+ ++
Sbjct: 356  -FDPCTDYYVEAYLNRPDVQKALHANVTRLDHP--WSACSDVLTR-WVDSAKTVLPIIQE 411

Query: 531  LIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHN----HQVGGRIVEYH 364
            L+K  +++W+YSGD DGRVPV  SR  +  L+LP+ + WR WF +     +VGG IV+Y 
Sbjct: 412  LMKNSIRVWVYSGDTDGRVPVTSSRLSVNQLQLPVAAKWRPWFSSTKGAGEVGGYIVQYK 471

Query: 363  G-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            G L+ VTVRGAGH VP  +P  AL L+ +FL+G+ LP
Sbjct: 472  GDLSLVTVRGAGHEVPSYQPRRALVLVQNFLAGKALP 508



>gb:PSA251969_1701942 Pisum sativum mRNA for putative serine
            carboxypeptidase CP-A protein, (cp-a gene).
          Length = 494

 Score =  374 bits (961), Expect = e-102
 Identities = 204/464 (43%), Positives = 272/464 (58%), Gaps = 2/464 (0%)
 Frame = -2

Query: 1638 VIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSH 1459
            +++ + A + S K  +E+D+I  LPGQP     + F GY+T+++  G A +Y+F EA   
Sbjct: 53   IVYDIDAIADSQKGVKENDRIKKLPGQPFVKF-SQFGGYVTLDKLSGSAFYYYFVEAHQS 111

Query: 1458 PSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVG 1279
                PL+LWLNGGPGCSS+ YGA  ELGP RV  +G  LH N+YSWN  AN+LF+ESPVG
Sbjct: 112  KETPPLLLWLNGGPGCSSLAYGAMQELGPFRVNSDGKTLHQNRYSWNYAANVLFLESPVG 171

Query: 1278 VGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAE 1099
            VGFSY+N         DK  A D Y FLVNWLERFP++K  DF+I+GESYAGHYVPQLA 
Sbjct: 172  VGFSYSNKSTEYSSNGDKKTAIDNYLFLVNWLERFPEYKNRDFYISGESYAGHYVPQLAH 231

Query: 1098 VVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDF 919
             +   N+ +     INLKG ++GN   +D  D  G+ ++  +HAIISD+      +VCDF
Sbjct: 232  TILYHNK-KANKTIINLKGILIGNAVIHDTTDSTGMYDFLATHAIISDKAAYDVNKVCDF 290

Query: 918  -TQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTY 742
             + +N + +CN A   V      ID+YNIY P C     +S              K+ T 
Sbjct: 291  SSSDNLTAECNSAADEVNEDIAFIDLYNIYAPLCKNENLTSKP------------KKNTI 338

Query: 741  AYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYT 562
                        DPC   Y   Y NR DVQ+A HAN+        W  CS  V R +  +
Sbjct: 339  V----------TDPCSKNYVYAYLNRQDVQEAIHANVTK--LKYEWSPCSG-VIRKWVDS 385

Query: 561  TFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGG 382
            + ++LP+  + +  GL++WI+SGD DGRVPV  ++Y I+ + LP+K+ W  WF   +VGG
Sbjct: 386  SPTVLPLLHEFLNNGLRVWIFSGDTDGRVPVTSTKYSIKKMNLPVKTVWHPWFAYGEVGG 445

Query: 381  RIVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPA 253
                Y G LTFVTVR AGH VP  +P+ AL LI  FL G  LP+
Sbjct: 446  YTEVYKGDLTFVTVREAGHQVPSYQPARALTLIKHFLDGTPLPS 489



>pir|G84772|G84772 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC006068_1533349 Arabidopsis
            thaliana chromosome 2 clone T20F21 map ve016, complete
            sequence.
          Length = 447

 Score =  372 bits (954), Expect = e-101
 Identities = 203/462 (43%), Positives = 276/462 (59%), Gaps = 8/462 (1%)
 Frame = -2

Query: 1614 SSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVL 1435
            S   K  +  DKI  LPGQP     + FSGY+TV+ + GRALFYW  EA      KPLVL
Sbjct: 11   SDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFYWLTEAPRPSGTKPLVL 70

Query: 1434 WLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX 1255
            WLNGGPGCSSI YGA+ E+GP RV  +G  L  N Y+WNK AN+LF++SP GVGFSYTN 
Sbjct: 71   WLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANVLFLDSPAGVGFSYTNT 130

Query: 1254 XXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD 1075
                    DK   +D Y FLV WLERFP++K   F+IAGESYAGHY+P+LA+++ +RN+ 
Sbjct: 131  SSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYAGHYIPELAQLIVNRNKG 190

Query: 1074 RGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-----DFTQE 910
                P INLKG ++GNP  +DY D KG+ +Y W+H +ISD+ Y+   + C      F + 
Sbjct: 191  -AKNPTINLKGILMGNPLVDDYNDNKGMRDYWWNHGLISDESYNDLTKWCLNDSILFPKL 249

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
            N    CN A++   +++ +ID YNI  P C  + SS+                + + YR 
Sbjct: 250  N----CNAALNQALSEFGDIDPYNINSPACTTHASSN-------------EWMQAWRYR- 291

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
                  G D C   Y  +Y N  +V K+FHA  R  GST  W  CS  + + +K +  S+
Sbjct: 292  ------GNDECVVGYTRKYMNDPNVHKSFHA--RLNGST-PWTPCSRVIRKNWKDSPKSM 342

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNH-QVGG--R 379
            LP+ + L++  L+IWI+SGD+D  +P+ G+R+ I A+KL     W  W+H+H  VGG  +
Sbjct: 343  LPIIKNLLQAHLRIWIFSGDSDAVLPLSGTRHSINAMKLKSSKRWYPWYHSHGLVGGWSQ 402

Query: 378  IVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPA 253
            + E   LT+ TVR AGH VPL++P  AL L   FL+   LP+
Sbjct: 403  VYEDGLLTYTTVRAAGHEVPLSQPRLALFLFTHFLANHSLPS 444



>gb:AY224473_1590675 Oryza sativa (japonica cultivar-group) isolate
            29039 serine carboxypepsidase mRNA, partial cds.
          Length = 445

 Score =  369 bits (947), Expect = e-100
 Identities = 197/463 (42%), Positives = 268/463 (57%), Gaps = 17/463 (3%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAK---SHPSNKPLVLWLNG 1423
            Q    +  LPGQP+      ++GY+TV+ + GRALFY+  EA    +  S  PL+LWLNG
Sbjct: 2    QGGGPVAGLPGQPAGVGFAQYAGYVTVDAAAGRALFYYLAEADGXAAXSSKAPLLLWLNG 61

Query: 1422 GPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXX 1243
            GPGCSS+GYGA  ELGP RVK +GV L+ N YSWN  AN++F+ESP+GVGFSY+N     
Sbjct: 62   GPGCSSLGYGAMEELGPFRVKSDGVSLYRNPYSWNNVANVMFLESPIGVGFSYSNTTADY 121

Query: 1242 XXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY 1063
                D   A+D Y FLVNW+ERFP++KG DF++AGESYAGHYVPQLA  +   +      
Sbjct: 122  SRMGDNSTAEDAYKFLVNWMERFPEYKGRDFYLAGESYAGHYVPQLAHAILRHSSAAAXR 181

Query: 1062 PRINLKGFIVGNPETNDYY--------DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ-E 910
              +     +   P+ +  +        D KG+ ++ W+HA+ISD+  D   + C+FT   
Sbjct: 182  QAL----LLADQPQRHHDWERGDQRLDDTKGMYDFFWTHALISDEANDGITKHCNFTDGA 237

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
            + +  C++A S+     ++IDIYNIY P C   G   +  +   ++              
Sbjct: 238  DANSLCDDATSLADDCLQDIDIYNIYAPNCQSPGLVVSPPVTPSIE-------------- 283

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
                   +DPC   Y E Y N  DVQKA HANI        W  CS  V R +  +  ++
Sbjct: 284  ------SFDPCTDYYVEAYLNNPDVQKALHANITRLDHP--WSACSG-VLRRWVDSASTV 334

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQ----VGG 382
            LP+ ++L+K  +++W+YSGD DGRVPV  SRY +  L LP+ + WR WF N Q    VGG
Sbjct: 335  LPIIKELLKNNIRVWVYSGDTDGRVPVTSSRYSVNQLNLPVAAKWRPWFSNTQGVGDVGG 394

Query: 381  RIVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
             IV+Y G L+ VTVRGAGH VP  +P  AL L+  FL G+ LP
Sbjct: 395  YIVQYKGNLSLVTVRGAGHEVPSYQPQRALVLVQYFLEGKTLP 437



>gb:AP004094_1837602 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1695_H09.>gb:AP005115_1848141 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0700F06.
          Length = 391

 Score =  361 bits (927), Expect = 2e-98
 Identities = 190/399 (47%), Positives = 251/399 (62%), Gaps = 5/399 (1%)
 Frame = -2

Query: 1680 MAPPNRTFLLVGFLVI-WVLCAESSSPKAAQ-ESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            MA   R    V  +V+ W+  A   +    + E D++  LPGQP       ++GY+ V++
Sbjct: 1    MATRGRIVAAVASVVVAWLAVAVGVNGGGCEAERDRVEALPGQPPVAF-AQYAGYVAVSE 59

Query: 1506 SHGRALFYWFFEAKSHPS--NKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFN 1333
            + GRALFYW  EA +  +   KPLVLWLNGGPGCSSI YGA+ E+GP R+K NG GL+ N
Sbjct: 60   ASGRALFYWLTEAAAAAAAATKPLVLWLNGGPGCSSIAYGASEEIGPFRIKTNGTGLYLN 119

Query: 1332 KYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHD 1153
            KYSWN+EANLLF+ESP GVGFSY+N         D+  AQD   FL++W+ RFPQ++  D
Sbjct: 120  KYSWNREANLLFLESPAGVGFSYSNTTSDLKTSGDERTAQDALQFLISWMSRFPQYRHRD 179

Query: 1152 FFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWS 973
            F+IAGESYAGHYVPQLA  + + N+    YP INLKG +VGN  T++YYD  G + Y W+
Sbjct: 180  FYIAGESYAGHYVPQLARKIVEFNK-ASPYPFINLKGILVGNGVTDNYYDNIGTVTYWWT 238

Query: 972  HAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFT-KYEEIDIYNIYGPRCLLNGSSSA 796
            HA+ISD  Y      C+FT  N S  CN AMS     ++ +ID Y+IY P C    +++A
Sbjct: 239  HAMISDTTYKAIMSSCNFTSANVSRLCNRAMSYAMNHEFGDIDQYSIYTPSCAAAAAANA 298

Query: 795  TGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGS 616
            TG R      L  K+ T+  RR      GYDPC   YAE+Y+NR DVQKA HANI   G 
Sbjct: 299  TGRRRGKAAVLRFKD-TFLRRR----SFGYDPCTETYAEKYYNRPDVQKAMHANI--TGI 351

Query: 615  TVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIY 499
               W  CSD + + ++ + FS+LP Y+ L+K GL+IW++
Sbjct: 352  PYRWTACSDVLIKTWRDSEFSMLPTYKLLMKAGLRIWVF 390



>gb:AC103551_1737295 Oryza sativa chromosome 3 BAC OSJNBb0058G04
            genomic sequence, complete sequence.
          Length = 478

 Score =  357 bits (916), Expect = 4e-97
 Identities = 180/446 (40%), Positives = 255/446 (57%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +E D++  +PGQ        ++GY+TV+   GRALFY+F EA   P  KPLVLWLNGGPG
Sbjct: 56   REKDRVRAMPGQMEEAEFNQYAGYVTVDAKAGRALFYYFVEAPHDPLKKPLVLWLNGGPG 115

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
            CSS G GA  ELGP  V+ +   L+  +++WN  AN+LFV+ P GVG+SY+N        
Sbjct: 116  CSSFGAGAMLELGPFSVRSDNKTLYNKQHAWNTVANMLFVDVPAGVGYSYSNTTSDYYNI 175

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
             DK    D Y FL+NW+++FP+++GHDFFI GESYAGHY+P+LA ++   NR       I
Sbjct: 176  GDKKTTDDAYIFLINWMKKFPEYQGHDFFITGESYAGHYIPELANLIVSNNRAIN-STNI 234

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
             LKG  +GN + +D    +   +Y W HA+ISD+ Y   +  C F  E +++ C  AM++
Sbjct: 235  KLKGVAIGNADLHDNVTLRASFDYYWRHAMISDRVYRAIQTSCGF-NETYTNDCQNAMNL 293

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
               +   +D YNIY P+C    + S +G    +                       DPC 
Sbjct: 294  ANKEKGNVDDYNIYAPQCHDASNPSPSGSSDSVAFG--------------------DPCT 333

Query: 693  SPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGL 514
            + Y   Y N  +VQ+A HAN    G    W  CS  +F  +K +  ++LP  + LI  G 
Sbjct: 334  NHYVSSYLNNPEVQRALHAN--TTGLNYPWMDCSGLIFDNWKDSPETMLPSIKTLISSGT 391

Query: 513  KIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGA 334
            +IW+YSGD D    V  ++Y ++ L LP+++ WR W  +++V G +V Y GL F TVRGA
Sbjct: 392  RIWLYSGDMDAVCSVTSTQYALDILGLPVETSWRPWRIDNEVAGYVVGYRGLVFATVRGA 451

Query: 333  GHLVPLNKPSEALALIHSFLSGEELP 256
            GH+VP  +P  ALAL+ SFL G+  P
Sbjct: 452  GHMVPYYQPRRALALLSSFLEGKLPP 477



>gb:AP005755_1857275 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC clone:OSJNBb0019B14.
          Length = 502

 Score =  357 bits (915), Expect = 6e-97
 Identities = 192/455 (42%), Positives = 264/455 (58%), Gaps = 2/455 (0%)
 Frame = -2

Query: 1611 SSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLW 1432
            SSP++ +E D+I  LPGQP       F+GY+TV++ +GR LFY+F E+    S KPL+LW
Sbjct: 75   SSPESTKEDDRIAALPGQPCGVNFAQFAGYVTVDRKNGRELFYYFVESPYDASTKPLILW 134

Query: 1431 LNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            LNGGPGCSS+G+GA  ELGP RV  +G  L  NK++WN  AN++F+ESP GVGFSY+   
Sbjct: 135  LNGGPGCSSLGFGAMKELGPFRVNPDGKTLSRNKHAWNNVANVIFLESPAGVGFSYSMNS 194

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                   D+  A+DTY FL+NW  RFP++KG DF+IAGESY GHYVPQ+A +V   N   
Sbjct: 195  SDYSDVGDQITAEDTYVFLLNWFNRFPEYKGRDFYIAGESYGGHYVPQIATIVTFINHLF 254

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKC 892
                  NL+G  VGNP  ++Y + +G LE+ WSH +ISD+ + K    C FT    SD  
Sbjct: 255  DGNTPFNLRGIFVGNPLLDEYKNGEGNLEFLWSHGVISDEVWGKILANCTFTS---SDDW 311

Query: 891  NEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPG 712
               ++    +   ID YNIY P CL                     E+   +R    +P 
Sbjct: 312  PCFVAAHSFQRVNIDRYNIYAPVCL--------------------HEQDGTFRSSGYLP- 350

Query: 711  GYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEK 532
            GYDPC   Y   Y N  DVQKA HA      +  NW  C+  +  A+  +  S++   ++
Sbjct: 351  GYDPCIDYYIPRYLNNPDVQKALHAR-----ADTNWSGCN--LDLAWNDSPDSMVRTIKR 403

Query: 531  LIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWF-HNHQVGGRIVEYH-GL 358
            L++ GL +WIYSGD D    +  +RY ++ L L +   WR W+  +++VGG + +Y  G 
Sbjct: 404  LVENGLSVWIYSGDMDSICSLTATRYSVKDLNLTITHKWRPWYTPDNEVGGYVQQYEGGF 463

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPA 253
            T  +VRGAGHLVP  +P  +L L++SFL G   PA
Sbjct: 464  TLASVRGAGHLVPSFQPKRSLVLLYSFLKGMLPPA 498



>gb:AC103551_1737296 Oryza sativa chromosome 3 BAC OSJNBb0058G04
            genomic sequence, complete sequence.
          Length = 486

 Score =  356 bits (914), Expect = 7e-97
 Identities = 189/450 (42%), Positives = 252/450 (56%), Gaps = 2/450 (0%)
 Frame = -2

Query: 1611 SSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLW 1432
            SS    +E+DK+  LPGQP       ++GY+TVN + G+ALFY+F EA   PS KPLVLW
Sbjct: 58   SSQDGLKEADKVSELPGQPGRAGFDQYAGYVTVNATSGKALFYYFAEATDDPSTKPLVLW 117

Query: 1431 LNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            LNGGPGCSS+G GA  E+GP  V  +   L  N+Y+WN  AN+LF+ESP GVGFSY+N  
Sbjct: 118  LNGGPGCSSLGDGAMLEIGPFLVNGDNRTLSINRYAWNNVANMLFLESPAGVGFSYSNTT 177

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                   D   A D Y FL NWLERFP++KG DFFI GESY GHY+PQLA  +   N   
Sbjct: 178  SDYDNTGDTSTAADAYTFLTNWLERFPEYKGRDFFITGESYGGHYIPQLANAILSNNNIT 237

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKC 892
             +   INLKG  +GN   +D  + +  ++Y W+HA+IS + +   +  C F    +  +C
Sbjct: 238  NV-TIINLKGVAIGNAYLDDSTNTRATIDYYWTHALISKETHLAVQRNCSF-NGTYMAQC 295

Query: 891  NEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPG 712
              A++   T+   ID YNIY P C  N S+                      R++     
Sbjct: 296  RNALAEADTEKGVIDPYNIYAPLC-WNASNP---------------------RQLHGSAI 333

Query: 711  GYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVF-RAYKYTTFSLLPVYE 535
              DPC   Y E Y NR +VQ+  HAN    G    W  CS+ +    +K    S+LP  +
Sbjct: 334  NVDPCSRYYVESYLNRPEVQRTLHAN--TTGLKQPWSGCSNIITPENWKDAPVSMLPSIQ 391

Query: 534  KLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWF-HNHQVGGRIVEYHGL 358
             LI  G+  W+YSGD D   PV  + Y ++ L+LP+ S WR W+  +++V G +V Y GL
Sbjct: 392  GLISSGVSTWLYSGDIDAVCPVTSTLYSLDILELPINSSWRPWYSDDNEVAGYVVGYKGL 451

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
             F TVR +GH+VP  +P  AL L  SFL G
Sbjct: 452  VFATVRESGHMVPTYQPQRALTLFSSFLQG 481



>gb:SBI421152_1704871 Sorghum bicolor mRNA for hydroxynitrile lyase
            (hnl gene).
          Length = 510

 Score =  356 bits (913), Expect = 9e-97
 Identities = 195/458 (42%), Positives = 266/458 (58%), Gaps = 10/458 (2%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS-HPSNKPLVLWLNGGP 1417
            QE D+I  LPGQP+      + GY+T++ ++GRAL+YWF EA +  P+  PLVLWLNGGP
Sbjct: 60   QEDDRIPGLPGQPNGVAFGMYGGYVTIDDNNGRALYYWFQEADTADPAAAPLVLWLNGGP 119

Query: 1416 GCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXX 1237
            GCSSIG GA  ELGP RV  NG  L  N+Y+WNK AN+LF ESP GV FSY+N       
Sbjct: 120  GCSSIGLGAMQELGPFRVHTNGESLLLNEYAWNKAANILFAESPAGVVFSYSNTSSDLSM 179

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              DK +AQDTY FLV W ERFP +   +F+IAGES  GH++PQL++VV+   R+R   P 
Sbjct: 180  GDDK-MAQDTYTFLVKWFERFPHYNYREFYIAGES--GHFIPQLSQVVY---RNRNNSPF 233

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ-ENWSDKCNEAM 880
            IN +G +V +  TND+ D  G+ E  W H +ISD+  D   +VC  T   + + +C E  
Sbjct: 234  INFQGLLVSSGLTNDHEDMIGMFELWWHHGLISDETRDSGLKVCPGTSFMHPTPECTEVW 293

Query: 879  SIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP----- 715
            +    +   I+ Y IY P C               D   +  +R +     +  P     
Sbjct: 294  NKALAEQGNINPYTIYTPTC---------------DREPSPYQRRFWAPHGRAAPPPLML 338

Query: 714  GGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE 535
              YDPC    +  Y N  +VQ A HAN+        W  CS+ +F  +      LLPVY 
Sbjct: 339  PPYDPCAVFNSINYLNLPEVQTALHANVSGI-VEYPWTVCSNTIFDQWGQAADDLLPVYR 397

Query: 534  KLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWF---HNHQVGGRIVEYH 364
            +LI+ GL++W+YSGD D  VPV  +R  + AL+LP+K+ W  W+      +VGG  V+Y 
Sbjct: 398  ELIQAGLRVWVYSGDTDSVVPVSSTRRSLAALELPVKTSWYPWYMAPTEREVGGWSVQYE 457

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            GLT+V+  GAGHLVP+++P++A  L   FL GE +PA+
Sbjct: 458  GLTYVSPSGAGHLVPVHRPAQAFLLFKQFLKGEPMPAE 495



>gb:AC136522_1743265 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0037H03, complete sequence.
          Length = 474

 Score =  355 bits (910), Expect = 2e-96
 Identities = 185/409 (45%), Positives = 247/409 (60%), Gaps = 5/409 (1%)
 Frame = -2

Query: 1614 SSSPKAAQES----DKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNK 1447
            SSS  AA  S    +++ YLPGQP       +SGY+TV++  GR+LFYW  EA +     
Sbjct: 31   SSSAAAAAASGLAGERVTYLPGQPPVDF-DMYSGYVTVDKRAGRSLFYWLQEAPAAAQPA 89

Query: 1446 PLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFS 1267
            PLVLWLNGGPGCSS+ YGA+ ELG  R++ +G  L  N Y WNK AN+LF++SP GVGFS
Sbjct: 90   PLVLWLNGGPGCSSVAYGASEELGAFRIRPDGATLFLNDYRWNKVANILFLDSPAGVGFS 149

Query: 1266 YTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFD 1087
            YTN         DK  A D+Y FLV W E+FPQ+K  DF+IAGESYAGHYVPQL+++V+ 
Sbjct: 150  YTNTTSDLYDSGDKRTAHDSYKFLVKWFEKFPQYKYRDFYIAGESYAGHYVPQLSQLVY- 208

Query: 1086 RNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-DFTQE 910
            RN      P IN KGF+VGN  T+DY+DY G  EY W+H IISD  Y      C   + E
Sbjct: 209  RNNKGVKEPLINFKGFMVGNAVTDDYHDYIGTFEYWWNHGIISDGTYRLLNASCVHDSGE 268

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
            + +  C  A++    +  +ID+Y++Y P C    +SSA             ++R      
Sbjct: 269  HPAPACLAALNASTVEQGDIDMYSLYTPTCNETSTSSAAA-----------RQRRLKQGH 317

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
               + G YDPC   Y+ EY+NR +VQ+A HAN+   G    W TCSD +   ++ +  S+
Sbjct: 318  YPWMTGSYDPCTERYSTEYYNRPEVQRALHANV--TGINYTWATCSDILNDNWRDSPRSV 375

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWF 403
            LP+Y +LI  GL+IW++SGD D  VP+  +RY I+AL LP    W  W+
Sbjct: 376  LPIYHELIAAGLRIWVFSGDTDAVVPLTATRYSIDALGLPTTVSWYPWY 424



>pir|T49188|T49188 serin carboxypeptidase-like protein - Arabidopsis
            thaliana>gb:ATMAA21_1553707 Arabidopsis thaliana DNA
            chromosome 3, P1 clone MAA21 (ESSA
            project).>gb:AY087589_1572619 Arabidopsis thaliana clone
            36847 mRNA, complete sequence.
          Length = 502

 Score =  353 bits (907), Expect = 5e-96
 Identities = 191/457 (41%), Positives = 264/457 (57%), Gaps = 4/457 (0%)
 Frame = -2

Query: 1614 SSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVL 1435
            +++ +  ++ D I  LPGQP       + GY+TVN+S GR+ FY+F EA     + PL+L
Sbjct: 70   AANQEGLRKRDLIRRLPGQPPVSF-DQYGGYVTVNESAGRSFFYYFVEASKSKDSSPLLL 128

Query: 1434 WLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX 1255
            WLNGGPGCSS+ YGA  ELGP RV  +G  L  N+Y+WN  AN+LF+ESP GVGFSYTN 
Sbjct: 129  WLNGGPGCSSLAYGALQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNT 188

Query: 1254 XXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD 1075
                    D+  A D Y FLVNWLERFP++KG D +IAGESYAGHYVPQLA  +   +R 
Sbjct: 189  TSDLEKHGDRNTAADNYIFLVNWLERFPEYKGRDLYIAGESYAGHYVPQLAHTILLHHRS 248

Query: 1074 RGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWS-- 901
                   NLKG ++GN   ND  D  G+ ++  SHA+IS+    + K  CD   E+ S  
Sbjct: 249  -----FFNLKGILIGNAVINDETDLMGMYDFFESHALISEDSLARLKSNCDLKTESASVM 303

Query: 900  -DKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMK 724
             ++C      +      +DIYNIY P C LN + +    RG      T +E         
Sbjct: 304  TEECAVVSDQIDMDTYYLDIYNIYAPLC-LNSTLTRRPKRGT-----TIRE--------- 348

Query: 723  RIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLP 544
                 +DPC   Y + Y NR +VQ A HAN  A      W+ CS  V + +  +  +++P
Sbjct: 349  -----FDPCSDHYVQAYLNRPEVQAALHAN--ATKLPYEWQPCSS-VIKKWNDSPTTVIP 400

Query: 543  VYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYH 364
            + ++L+  G+++W++SGD DGR+PV  ++Y ++ + L  K+ W  W+   +VGG   EY 
Sbjct: 401  LIKELMGQGVRVWVFSGDTDGRIPVTSTKYSLKKMNLTAKTAWHPWYLGGEVGGYTEEYK 460

Query: 363  G-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            G LTF TVRGAGH VP  +P  +L+L   FL+   LP
Sbjct: 461  GKLTFATVRGAGHQVPSFQPKRSLSLFIHFLNDTPLP 497



>gb:AP005755_1857272 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OSJNBb0019B14.>gb:AP006849_1863095 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, BAC
            clone:OSJNBa0054F02.
          Length = 494

 Score =  344 bits (882), Expect = 4e-93
 Identities = 191/455 (41%), Positives = 261/455 (57%), Gaps = 4/455 (0%)
 Frame = -2

Query: 1620 AESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPL 1441
            ++ S+ KAA   DKI  LPGQP       + GY+TV++ +GRALFY+F EA +  + KPL
Sbjct: 70   SDQSNLKAA---DKITALPGQPKGVGFNQYGGYVTVDEMNGRALFYYFVEATTDAAAKPL 126

Query: 1440 VLWLNGG-PGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSY 1264
            +LWLNGG PGCSS+GYGA  ELGP R+  +   L  N+Y+WN  AN+LF+ESP GVGFSY
Sbjct: 127  LLWLNGGGPGCSSVGYGAMIELGPFRINSDNKTLSRNEYAWNNVANVLFLESPAGVGFSY 186

Query: 1263 TNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDR 1084
            +N         D+  A D+Y FLVNWLERFP++KG  F+I+GESYAGHY PQLA  +   
Sbjct: 187  SNTSSDYDKSGDQRTANDSYIFLVNWLERFPEYKGRAFYISGESYAGHYAPQLAATILTH 246

Query: 1083 NRD--RGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE 910
            N +  R I   INL+G +VGNP  +++ + KG ++Y WSH +ISD+      + C F+  
Sbjct: 247  NMESKRMI---INLQGILVGNPCLDEFKNLKGQIDYLWSHGVISDEVLANITKNCRFSPS 303

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
            +    C++AM    +     D Y+IYGP C+                             
Sbjct: 304  D-GKACSDAMDAFDS--GNTDPYDIYGPVCINAPDGKFF--------------------- 339

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
              RI  GYDPC + Y   Y N   VQKA HA +        W  C +     +K    S+
Sbjct: 340  PSRIVPGYDPCSNYYIHAYLNNPVVQKALHARV------TTWLGCKN---LHWKDAPVSM 390

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVE 370
            +P  + L++ GL +W+YSGD D   P+  +RY +  L L +  PWR W  N +VGG + +
Sbjct: 391  VPTLKWLMEHGLPVWLYSGDLDSVCPLTATRYSVGDLGLAVTEPWRPWTANREVGGYVQQ 450

Query: 369  Y-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
            Y  GL F++VRGAGH VP  +P +AL ++ SFL G
Sbjct: 451  YTGGLVFISVRGAGHQVPYFQPEKALIVVSSFLRG 485



>pir|F85360|F85360 SERINE CARBOXYPEPTIDASE II-like protein [imported]
            - Arabidopsis thaliana>gb:ATCHRIV73_1547002 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            73.>gb:ATF6I18_1550892 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F6I18 (ESSA project).
          Length = 425

 Score =  336 bits (862), Expect = 8e-91
 Identities = 187/467 (40%), Positives = 248/467 (53%), Gaps = 1/467 (0%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            + + FL    LC    S K   E DK+  LPGQ       H+SG++  N+  GRALFYW 
Sbjct: 15   IAIAFLATAHLCEAGLSQK---EQDKVSKLPGQNFNVSFAHYSGFVATNEQLGRALFYWL 71

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLF 1297
            FEA     +KPLVLWLNGGPGCSS+ YG A E+GP  +K +G  L+ N+YSWN+ AN+LF
Sbjct: 72   FEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQYSWNQAANILF 131

Query: 1296 VESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHY 1117
            +++PVGVG+SY+N         DK  A+D+  FL+ W+ERFP++KG DF+I GESYA   
Sbjct: 132  LDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDFYIVGESYA--- 188

Query: 1116 VPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKA 937
                                        GN   +D++D  GL +Y WS   ISDQ Y   
Sbjct: 189  ----------------------------GNGLMDDFHDRLGLFQYIWSLGFISDQTYSLL 220

Query: 936  KEVCDFTQENWSDK-CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALT 760
            +  C F     S K CN+ + I   +   ID Y+++ P C+ N S               
Sbjct: 221  QLQCGFESFIHSSKQCNKILEIADKEIGNIDQYSVFTPACVANASHEQ------------ 268

Query: 759  NKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVF 580
                             YDPC   +   YFN  +VQKA H           W  CSD V 
Sbjct: 269  -----------------YDPCTEKHTTVYFNLPEVQKALHL----------W-LCSDVVS 300

Query: 579  RAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFH 400
              +  +  S+L +Y +LI  GL+IW++SGDAD  VPV  +RY I+AL L   S +  W+ 
Sbjct: 301  EHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDALNLRPLSAYGPWYL 360

Query: 399  NHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            + QVGG   +Y GL FVTVRGAGH VPL++P +ALAL  +F+SG  L
Sbjct: 361  DGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL 407



>gb:AP004069_1837210 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1626_B09.>gb:AP004192_1838820 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OJ1643_A10.
          Length = 350

 Score =  334 bits (857), Expect = 3e-90
 Identities = 166/349 (47%), Positives = 221/349 (63%)
 Frame = -2

Query: 1302 LFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAG 1123
            +F+ESPVGVGFSYTN         DK  A D Y FL+NW +RFPQ+K HDF+IAGESYAG
Sbjct: 1    MFLESPVGVGFSYTNTSSDLQQLGDKITADDAYIFLLNWFKRFPQYKSHDFYIAGESYAG 60

Query: 1122 HYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYD 943
            HYVPQL+E +FD N+       IN KGF++GN   +D  D  G+++YAW HA+ISD+ Y 
Sbjct: 61   HYVPQLSEKIFDGNKQGPKENYINFKGFMIGNALMDDETDQTGMIDYAWDHAVISDRVYA 120

Query: 942  KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLAL 763
              K+ C+F+ EN +D C+ A++  F  Y  ID+Y++Y P C    SS+A G R V     
Sbjct: 121  DVKKYCNFSMENVTDACDSALTEYFAVYRLIDMYSLYTPVCTEVSSSAAFGQRQVAVHGA 180

Query: 762  TNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPV 583
              K  +  Y      P GYDPC S +AE YFNR DVQ+A HAN+   G   NW  CSD V
Sbjct: 181  APKIFS-KYHGWYMRPAGYDPCTSDHAEVYFNRADVQEALHANVTNIG--YNWTHCSD-V 236

Query: 582  FRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWF 403
               ++   FS LP+  KL+ GG+++W++SGD DGR+PV  +R  +  L L     W  W+
Sbjct: 237  IGKWRDAPFSTLPIIRKLVAGGIRVWVFSGDTDGRIPVTSTRLTLNKLGLKTVQEWTPWY 296

Query: 402  HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
             + QVGG  + Y GLTFVT+RGAGH VPL+ P +AL+L   FL+ +++P
Sbjct: 297  DHQQVGGWTILYEGLTFVTIRGAGHEVPLHAPRQALSLFSHFLADKKMP 345



>gb:AC136522_1743268 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0037H03, complete sequence.
          Length = 439

 Score =  323 bits (828), Expect = 7e-87
 Identities = 170/377 (45%), Positives = 228/377 (60%), Gaps = 5/377 (1%)
 Frame = -2

Query: 1614 SSSPKAAQES----DKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNK 1447
            SSS  AA  S    +++ YLPGQP       +SGY+TV++  GR+LFYW  EA +     
Sbjct: 31   SSSAAAAAASGLAGERVTYLPGQPPVDF-DMYSGYVTVDKRAGRSLFYWLQEAPAAAQPA 89

Query: 1446 PLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFS 1267
            PLVLWLNGGPGCSS+ YGA+ ELG  R++ +G  L  N Y WNK AN+LF++SP GVGFS
Sbjct: 90   PLVLWLNGGPGCSSVAYGASEELGAFRIRPDGATLFLNDYRWNKVANILFLDSPAGVGFS 149

Query: 1266 YTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFD 1087
            YTN         DK  A D+Y FLV W E+FPQ+K  DF+IAGESYAGHYVPQL+++V+ 
Sbjct: 150  YTNTTSDLYDSGDKRTAHDSYKFLVKWFEKFPQYKYRDFYIAGESYAGHYVPQLSQLVY- 208

Query: 1086 RNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-DFTQE 910
            RN      P IN KGF+VGN  T+DY+DY G  EY W+H IISD  Y      C   + E
Sbjct: 209  RNNKGVKEPLINFKGFMVGNAVTDDYHDYIGTFEYWWNHGIISDGTYRLLNASCVHDSGE 268

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
            + +  C  A++    +  +ID+Y++Y P C    +SSA             ++R      
Sbjct: 269  HPAPACLAALNASTVEQGDIDMYSLYTPTCNETSTSSAAA-----------RQRRLKQGH 317

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
               + G YDPC   Y+ EY+NR +VQ+A HAN+   G    W TCSD +   ++ +  S+
Sbjct: 318  YPWMTGSYDPCTERYSTEYYNRPEVQRALHANV--TGINYTWATCSDILNDNWRDSPRSV 375

Query: 549  LPVYEKLIKGGLKIWIY 499
            LP+Y +LI  GL+IW++
Sbjct: 376  LPIYHELIAAGLRIWVF 392



>pir|T49081|T49081 serine-type carboxypeptidase like protein -
            Arabidopsis thaliana>gb:ATF4F15_1550668 Arabidopsis
            thaliana DNA chromosome 3, BAC clone F4F15.
          Length = 501

 Score =  322 bits (825), Expect = 2e-86
 Identities = 183/450 (40%), Positives = 252/450 (56%), Gaps = 4/450 (0%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +E D I  LPGQPS      + GY+TVN+S GR+L+Y+F EA     + PLVLWLNGGPG
Sbjct: 75   KERDLIENLPGQPSVSF-RQYGGYVTVNESAGRSLYYYFVEATKTKKSLPLVLWLNGGPG 133

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
            CSS+ YGA  ELGP R+  +G  L+ N YSWN  AN+LF+ESPVG GFSYTN        
Sbjct: 134  CSSL-YGAFQELGPFRIYGDGKTLYTNPYSWNNVANILFLESPVGTGFSYTNTESDLENP 192

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
             D   A D Y FLV WLERFP++KG +F+IAGESYAGHYVPQLA+ +   N+++     I
Sbjct: 193  GDMKAAADKYIFLVKWLERFPEYKGREFYIAGESYAGHYVPQLAQTILVHNKNQNF---I 249

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NL+G ++GNP  ND  +  G  +Y  SHA++S       KE C          C      
Sbjct: 250  NLRGILIGNPTLNDIVETTGSFDYLVSHALLSQDSLLSYKENCATDTPKMEVDCIALSMK 309

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
            +    +++++YNI  P C+     +AT    +  L   +KE T   +        Y+PC 
Sbjct: 310  IDDDIKKMNLYNILTPTCI-----NAT----LTPLTNQSKECTTVLQ--------YEPCG 352

Query: 693  SPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTF--SLLPVYEKLIK- 523
              Y   Y NR DVQ++ H   + P +   W  C++     +  T +  S+LP+ ++L+K 
Sbjct: 353  MQYIAAYLNREDVQRSMHVT-KLPHT---WMLCNEATGFNWNQTDYSASMLPILKELMKH 408

Query: 522  GGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHG-LTFVT 346
              L++W+Y+GD D  +P+  + + ++ + L   + W  WF   QVGG   EY G   + T
Sbjct: 409  DQLRVWVYTGDTDTVIPLTVTMHALKMMNLTAVTDWLPWFSEGQVGGFTEEYKGNFRYAT 468

Query: 345  VRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            V GAGH VPL KP  AL L   F+    LP
Sbjct: 469  VIGAGHEVPLYKPKAALTLFKHFIRNSPLP 498



>pir|T49079|T49079 serine-type carboxypeptidase like protein -
            Arabidopsis thaliana>gb:ATF4F15_1550666 Arabidopsis
            thaliana DNA chromosome 3, BAC clone F4F15.
          Length = 482

 Score =  322 bits (825), Expect = 2e-86
 Identities = 186/462 (40%), Positives = 255/462 (55%), Gaps = 8/462 (1%)
 Frame = -2

Query: 1617 ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLV 1438
            +  S  + ++ D I  LPGQPS      + GY+ VN+  GR L+Y+F E     +  PLV
Sbjct: 51   QRESVPSPKDKDLIQQLPGQPSDVTFKQYGGYVAVNKPAGRFLYYYFVETIKPGNTTPLV 110

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            +W NGGPGCSS+G GA  ELGP RV  +G  L  N YSWN EAN+LF+E+PVG GFSY+N
Sbjct: 111  IWFNGGPGCSSLG-GAFKELGPFRVHSDGKTLFRNPYSWNNEANVLFLETPVGTGFSYSN 169

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                      K  A+D Y FLVNWLERFP++KG D +IAG+SYAGHYVPQLA+++  RN 
Sbjct: 170  SPINGKQGD-KATAEDNYMFLVNWLERFPEYKGRDIYIAGQSYAGHYVPQLAQIILHRNN 228

Query: 1077 DRGIYPRINLKGFIVGNPETN----DYYDYKGLLEYAWSHAIISDQQYDKAKEVC-DFTQ 913
                   INL+G ++GNP  N    D + YK    + +SH +IS QQ D   + C D   
Sbjct: 229  Q----TLINLRGILIGNPSLNREIQDDFGYK----FMFSHGLISQQQMDNYNKFCTDSDL 280

Query: 912  ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYR 733
             +W DKC+ A   +  +   +DIYNIY P CL +  SS              K+ T   +
Sbjct: 281  YDW-DKCHLASQKIEAQKTHLDIYNIYAPLCLNSTLSSEP------------KKCTTIMK 327

Query: 732  RMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAY--KYTT 559
                     DPC   Y + Y N  +VQ+A HAN         W +C+  +   +  K   
Sbjct: 328  A--------DPCSGNYLKAYLNIKEVQEAIHAN--TTKIPYEWTSCNTKLLWEWNEKDRY 377

Query: 558  FSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGR 379
             SL P+ ++L+  G+++ +Y+GD D  +P   +   ++ + L +   WR WF    VGG 
Sbjct: 378  VSLTPILQELMGKGVRVMLYNGDVDLVIPFTSTLAVVKTMNLTVVKEWRPWFTGGHVGGF 437

Query: 378  IVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
              +Y G LTFVTV+GAGH VP ++P  AL +  SF+    LP
Sbjct: 438  TEDYKGNLTFVTVKGAGHSVPTDQPIHALNIFTSFIRNTPLP 479



>gb:AF061282_1765198 Sorghum bicolor 22 kDa kafirin cluster.
          Length = 483

 Score =  316 bits (810), Expect = 8e-85
 Identities = 173/428 (40%), Positives = 241/428 (56%), Gaps = 11/428 (2%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPL-LTHFSGYITVNQSHGRALFYW 1480
            L  G  ++    A  SS  ++ E D+I  LPGQP+  +    + GY+TV++  GRA +YW
Sbjct: 22   LAAGSFLLLPALARGSSSSSSFEEDRISALPGQPNDGVAFDMYGGYVTVDEHAGRAFYYW 81

Query: 1479 FFEAK----SHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKE 1312
              EA       P   PL+LWLNG PGCSS+GYGA  ELG  RV  +G  L  N+Y+WNK 
Sbjct: 82   LQEADRGEVEDPDTAPLLLWLNGRPGCSSVGYGAMEELGAFRVHTDGHRLLLNEYAWNKV 141

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            AN+LF+++P G GFSY+N         D   A D+Y FLV W ERFPQ+K  DF+IAGES
Sbjct: 142  ANVLFLDAPAGAGFSYSNTSSDLLVAGDISTAHDSYTFLVKWFERFPQYKYRDFYIAGES 201

Query: 1131 YAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQ 952
            Y GHYVPQL+++V+ RN      P INLKGF+VGN  T+D  D  G+ E+ W H +I+D+
Sbjct: 202  YGGHYVPQLSQLVY-RNNIGVEKPVINLKGFMVGNGLTDDRADMVGMFEFWWHHGLIADE 260

Query: 951  QYDKAKEVCDFTQ-ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVL 775
              D   +VC  +   + + +C +       +   ID Y+IY P C               
Sbjct: 261  TLDTGLKVCPGSSFIHVTPECRKIWDKALEEQGHIDGYSIYTPPC--------------- 305

Query: 774  DLALTNKERTYAYRRMKR-----IPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTV 610
                 +K   YA+R   R     +   YDPC + Y+ +Y N  +VQ A HAN+ +     
Sbjct: 306  -----DKGSPYAHRLQSRPHPLMMLPAYDPCTAFYSTKYLNLPEVQTAMHANV-SGSMEY 359

Query: 609  NWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLP 430
             W  CS+ +F  +     S+LP+Y +LI+GGLK+W++SGD D  VP+  +R  + AL LP
Sbjct: 360  PWVVCSNLLFDNWTDAATSMLPIYRELIEGGLKVWVFSGDTDTVVPLSATRRSLAALSLP 419

Query: 429  LKSPWRSW 406
            +K+ W  W
Sbjct: 420  VKTSWYPW 427



>pir|B84472|B84472 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC005970_1533287 Arabidopsis
            thaliana chromosome 2 clone T6P5 map mi310, complete
            sequence.>gb:AY065440_1566546 Arabidopsis thaliana
            putative serine carboxypeptidase II (At2g05850) mRNA,
            complete cds.>gb:BT000980_1635235 Arabidopsis thaliana
            clone U18740 putative serine carboxypeptidase II
            (At2g05850) mRNA, complete cds.
          Length = 487

 Score =  316 bits (809), Expect = 1e-84
 Identities = 177/455 (38%), Positives = 252/455 (55%), Gaps = 9/455 (1%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +E D I  LPGQPS      + GY+ VN+   R L+Y+F EA     + PLVLW NGGPG
Sbjct: 59   KEKDLIEKLPGQPSGISFRQYGGYVAVNEPATRFLYYYFVEAIKPSKSTPLVLWFNGGPG 118

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX---XXXX 1243
            CSS+G+GA  ELGP RV  +G  L+ N YSWN EAN+LF E P+ VGFSY++        
Sbjct: 119  CSSVGFGAFEELGPFRVHSDGKTLYRNPYSWNNEANMLFFEGPISVGFSYSSTPFDWEIF 178

Query: 1242 XXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY 1063
                DK  A+D Y FLVNWLERFP++KG D +I+G+SYAGHY+PQLA+++  RN      
Sbjct: 179  GEQADKLTAEDNYMFLVNWLERFPEYKGRDVYISGQSYAGHYIPQLAQIILHRNNQ---- 234

Query: 1062 PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEA 883
              INL+G  +GNP  +   +     ++  SH ++S + +++  +VCDF   +  D+C + 
Sbjct: 235  TFINLRGISIGNPGLDLLIEADNENKFILSHGLVSQKDFEEYSKVCDFANYD-MDECPKI 293

Query: 882  M---SIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPG 712
            M   SI   K+  +D+YNIY P CL +  SS              K+ T           
Sbjct: 294  MPKFSIEHNKH--LDVYNIYAPVCLNSTLSSEP------------KKCTTIME------- 332

Query: 711  GYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAY--KYTTFSLLPVY 538
              DPC S Y + Y N  +VQ+A HAN         WK C+  +   +       S++P+ 
Sbjct: 333  -VDPCRSNYVKAYLNSENVQEAMHAN--TTKLPYEWKACNHYLNSVWIDADKDASMVPIL 389

Query: 537  EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HG 361
              L+  G+++ +YSGD D  +P   +   ++ + L + + WR WF   Q+GG   +Y   
Sbjct: 390  HDLMGEGVRVLVYSGDVDAAIPFTATMAVLKTMNLTVVNEWRPWFTGGQLGGFTEDYERN 449

Query: 360  LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            LT+ TV+G+GH VPL++P  AL L  SF+    LP
Sbjct: 450  LTYATVKGSGHSVPLDQPVHALNLFTSFIRNTPLP 484



>pir|G96501|G96501 probable serine carboxypeptidases [imported] -
            Arabidopsis thaliana>gb:AE005173_892571 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC006423_1534163 Arabidopsis thaliana
            chromosome I BAC F28H19 genomic sequence, complete
            sequence.
          Length = 479

 Score =  312 bits (799), Expect = 2e-83
 Identities = 186/462 (40%), Positives = 259/462 (56%), Gaps = 19/462 (4%)
 Frame = -2

Query: 1584 DKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSS 1405
            D +  LPGQP       F+GY+ ++   GR+LFY+F EA+  P +KPL LWLNGGPGCSS
Sbjct: 36   DLVTKLPGQPEVAF-RQFAGYVDIDVKAGRSLFYYFVEAEKQPHSKPLTLWLNGGPGCSS 94

Query: 1404 IGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDK 1225
            IG GA  ELGP     +  GL  N  SWNK +NLLFV+SP GVG+SY+N         D+
Sbjct: 95   IGGGAFTELGPFYPTGDARGLRRNPKSWNKASNLLFVDSPAGVGWSYSN-TTSDYTTGDE 153

Query: 1224 FVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLK 1045
              A+D   F++ WLE+FPQFK  + F+AGESYAGHYVPQLA+V+ + N  R    + NLK
Sbjct: 154  STAKDMLVFMLRWLEKFPQFKTRNLFLAGESYAGHYVPQLADVILEYNAQRSNRFKFNLK 213

Query: 1044 GFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDK------CNEA 883
            G  +GNP      D   + E+ WSH +ISD+        CDF    ++D       C  A
Sbjct: 214  GIAIGNPLLKLDRDVPAIYEFFWSHGMISDELGLTIMNQCDFEDYTFTDSHNISKLCEAA 273

Query: 882  MS---IVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNK-ERTYAYRRM-KRI 718
            ++    + T+Y  ++ Y+I                  +LD+   +  E+    ++M  R+
Sbjct: 274  VNQAGTIITQY--VNYYDI------------------LLDVCYPSLFEQELRLKKMGTRM 313

Query: 717  PGGYDPCYSPYAEEYFNRIDVQKAFHAN-IRAPGSTVNWKTCSDPVFRAYKYT--TFSLL 547
              G D C S   + Y N  +VQKA HAN  + P     W  CS      YKYT    ++L
Sbjct: 314  SFGVDVCMSFEEQLYLNLPEVQKALHANRTKLP---YEWSMCSS--LLNYKYTDGNANML 368

Query: 546  PVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLK----SPWRSWFHNHQVGGR 379
            P+ ++++K  + +W++SGD D  +P++GSR  ++ L   L      P+ +WF   QVGG 
Sbjct: 369  PILKRIVKSKVPVWVFSGDEDSVIPLLGSRTLVKELADDLNFNTTVPYGAWFDKGQVGGW 428

Query: 378  IVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            +VEY   LTF TVRGA H+VP ++PS AL L  SF+ G +LP
Sbjct: 429  VVEYGNLLTFATVRGAAHMVPYSQPSRALHLFTSFVLGRKLP 470



>gb:BT003902_1637028 Arabidopsis thaliana clone RAFL15-18-D10 (R20646)
            putative serine-type carboxypeptidase (At3g52010) mRNA,
            partial cds.
          Length = 447

 Score =  305 bits (781), Expect = 2e-81
 Identities = 179/461 (38%), Positives = 249/461 (54%), Gaps = 10/461 (2%)
 Frame = -2

Query: 1608 SPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWL 1429
            SPK   E D I  LPGQPS      + GY+ VN+   R L+Y+F EA    ++ PLV+W 
Sbjct: 18   SPK---EKDLIKKLPGQPSGVSFRQYGGYVPVNEPSSRFLYYYFVEAIKPNTSTPLVIWF 74

Query: 1428 NGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX-- 1255
            NGGP CSS+G GA  ELGP RV   G  L  N YSWN EAN+LF+ESPV  GFSY++   
Sbjct: 75   NGGPACSSLG-GAFLELGPFRVHSGGRKLFRNPYSWNNEANVLFLESPVTTGFSYSSNPI 133

Query: 1254 -XXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     DK  A+D Y FL+NWLERFP++KG D +IAG+SYAGHYVPQLA+++  RN+
Sbjct: 134  DLEELGEKGDKATAEDNYIFLMNWLERFPEYKGRDIYIAGQSYAGHYVPQLAQIIIHRNK 193

Query: 1077 DRGIYPRINLKGFIVGNP----ETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE 910
                   +NL+G ++GNP       D Y Y    E+  SH ++S QQ D   + C     
Sbjct: 194  K----TLVNLRGILIGNPSLLTSIQDPYGY----EFMLSHGLMSQQQMDNYNQFCLRDDL 245

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
              +DKC  ++  +    + +D YNIY P CL +             L+  +K+ T     
Sbjct: 246  YDNDKCALSVKTIDDAKKHLDTYNIYAPVCLNS------------TLSRISKKCTTVLE- 292

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYT--TF 556
                    DPC   Y + Y NR  VQKA HAN         W +C++ +   +       
Sbjct: 293  -------VDPCSKDYLKAYLNRKKVQKAIHAN--TTKLPYEWTSCNNELTENWSENDRDT 343

Query: 555  SLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRI 376
             ++P+  +L+  G+++ IY+GD D  +P   +   ++ + L +   +R WF   Q+GG  
Sbjct: 344  PMIPILHELMGEGVRVMIYNGDVDLEIPFASTLAVVKEMNLTVVKEFRPWFTGGQLGGFT 403

Query: 375  VEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
             +Y G LTFVTV+GAGH VP ++P  AL +  SF+    LP
Sbjct: 404  EDYKGNLTFVTVKGAGHSVPTDQPIHALNIFTSFIRNTPLP 444



>pir|T49080|T49080 serine-type carboxypeptidase like protein -
            Arabidopsis thaliana>gb:ATF4F15_1550667 Arabidopsis
            thaliana DNA chromosome 3, BAC clone F4F15.
          Length = 487

 Score =  305 bits (781), Expect = 2e-81
 Identities = 179/461 (38%), Positives = 249/461 (54%), Gaps = 10/461 (2%)
 Frame = -2

Query: 1608 SPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWL 1429
            SPK   E D I  LPGQPS      + GY+ VN+   R L+Y+F EA    ++ PLV+W 
Sbjct: 58   SPK---EKDLIKKLPGQPSGVSFRQYGGYVPVNEPSSRFLYYYFVEAIKPNTSTPLVIWF 114

Query: 1428 NGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX-- 1255
            NGGP CSS+G GA  ELGP RV   G  L  N YSWN EAN+LF+ESPV  GFSY++   
Sbjct: 115  NGGPACSSLG-GAFLELGPFRVHSGGRKLFRNPYSWNNEANVLFLESPVTTGFSYSSNPI 173

Query: 1254 -XXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     DK  A+D Y FL+NWLERFP++KG D +IAG+SYAGHYVPQLA+++  RN+
Sbjct: 174  DLEELGEKGDKATAEDNYIFLMNWLERFPEYKGRDIYIAGQSYAGHYVPQLAQIIIHRNK 233

Query: 1077 DRGIYPRINLKGFIVGNP----ETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE 910
                   +NL+G ++GNP       D Y Y    E+  SH ++S QQ D   + C     
Sbjct: 234  K----TLVNLRGILIGNPSLLTSIQDPYGY----EFMLSHGLMSQQQMDNYNQFCLRDDL 285

Query: 909  NWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRR 730
              +DKC  ++  +    + +D YNIY P CL +             L+  +K+ T     
Sbjct: 286  YDNDKCALSVKTIDDAKKHLDTYNIYAPVCLNS------------TLSRISKKCTTVLE- 332

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYT--TF 556
                    DPC   Y + Y NR  VQKA HAN         W +C++ +   +       
Sbjct: 333  -------VDPCSKDYLKAYLNRKKVQKAIHAN--TTKLPYEWTSCNNELTENWSENDRDT 383

Query: 555  SLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRI 376
             ++P+  +L+  G+++ IY+GD D  +P   +   ++ + L +   +R WF   Q+GG  
Sbjct: 384  PMIPILHELMGEGVRVMIYNGDVDLEIPFASTLAVVKEMNLTVVKEFRPWFTGGQLGGFT 443

Query: 375  VEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
             +Y G LTFVTV+GAGH VP ++P  AL +  SF+    LP
Sbjct: 444  EDYKGNLTFVTVKGAGHSVPTDQPIHALNIFTSFIRNTPLP 484



>pir|D84503|D84503 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC007268_1535754 Arabidopsis
            thaliana chromosome 2 clone T27D6 map PR1, complete
            sequence.
          Length = 468

 Score =  302 bits (773), Expect = 2e-80
 Identities = 186/479 (38%), Positives = 253/479 (52%), Gaps = 12/479 (2%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            ++V   V W++ AE        E D +  LPGQP+      F+GY+ V+  +GR+LFY++
Sbjct: 11   IMVLVTVQWLVFAEGYP-----EEDLVARLPGQPNVGF-RQFAGYVDVDSENGRSLFYYY 64

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLF 1297
             EA   P  KPL LWLNGGPGCSS+G GA  ELGP     +G GL  N  SWNK +NLLF
Sbjct: 65   VEAVKEPDTKPLTLWLNGGPGCSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLF 124

Query: 1296 VESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHY 1117
            VESP GVG+SY+N         DK    D   FL+ W  +FP+ K  D F+ GESYAGHY
Sbjct: 125  VESPAGVGWSYSN-RSSDYNTGDKSTVNDMLVFLLRWFNKFPELKSRDLFLTGESYAGHY 183

Query: 1116 VPQLAEVVFDRN-RDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDK 940
            +PQLA+V+   N R  G   + N+KG  +GNP      D+    EY WSH +ISD+    
Sbjct: 184  IPQLADVILSYNSRSSGF--KFNVKGIAIGNPLLKLDRDFAAAYEYFWSHGMISDEVRLT 241

Query: 939  AKEVCDFTQ-ENWSDKCNEAM--SIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDL 769
                CDF   +N S+ C  A+  S V T+Y  I+ Y+I                  +LD+
Sbjct: 242  IMNQCDFANPKNMSNACIYAIVESSVLTEY--INSYHI------------------LLDV 281

Query: 768  ALTN--KERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHAN-IRAPGSTVNWKT 598
               +  ++     + + +I    D C +     YFN   VQ A HAN  R P     W  
Sbjct: 282  CYPSIVQQELRLKKMVTKISMVVDVCITYERSFYFNLPKVQNALHANRTRLP---YEWTM 338

Query: 597  CSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI----EALKLP 430
            CS+ +  +       +LP  +++I+    +WI+SGD D  +P+  SR  +    E L   
Sbjct: 339  CSNRLNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDSVIPLQSSRTLVRELAEDLNFK 398

Query: 429  LKSPWRSWFHNHQVGGRIVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
               P+ +WFH  QVGG + EY   LTF TVRGA H+VP  +PS AL +  SF++G  LP
Sbjct: 399  TTIPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVPYAEPSRALHMFSSFMNGRRLP 457



>gb:AB023032_1515330 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K5J14.>gb:AY143899_1583356 Arabidopsis thaliana
            At5g42240/K5J14_4 mRNA, complete cds.>gb:AF361604_1791350
            Arabidopsis thaliana AT5g42240/K5J14_4 mRNA, complete
            cds.
          Length = 473

 Score =  300 bits (768), Expect = 6e-80
 Identities = 185/481 (38%), Positives = 251/481 (52%), Gaps = 16/481 (3%)
 Frame = -2

Query: 1650 VGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFE 1471
            V   ++ VL +     K   E D +  LPGQP+      ++GY+ V+   GR+LFY++ E
Sbjct: 9    VAVAMVVVLLSLQWFAKGYPEEDLVVRLPGQPTVGF-KQYAGYVDVDVKAGRSLFYYYVE 67

Query: 1470 AKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVE 1291
            A   P +KPL LWLNGGPGCSSIG GA  ELGP     +G GL  N  SWNK ++LLFVE
Sbjct: 68   AVKQPDSKPLTLWLNGGPGCSSIGGGAFTELGPFYPTGDGRGLRVNSMSWNKASHLLFVE 127

Query: 1290 SPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVP 1111
            SP GVG+SY+N         DK  A D   FL+ W E+FP+ K  D F+ GESYAGHY+P
Sbjct: 128  SPAGVGWSYSN-KSSDYNTGDKSTANDMLVFLLRWFEKFPKLKSRDLFLTGESYAGHYIP 186

Query: 1110 QLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKE 931
            QLA+ +   N     + + N+KG  +GNP      D     E+ WSH +ISD+       
Sbjct: 187  QLADAILSYNSHSSGF-KFNIKGVAIGNPLLKLDRDSPATYEFFWSHGMISDELKLTITS 245

Query: 930  VCDF------TQENWSDKCNEAMS---IVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGV 778
             CDF      +  N S  CNEA+S    + T+Y  ++ Y++                  +
Sbjct: 246  QCDFDDYTFASPHNVSTACNEAISETENIITEY--VNNYDV------------------L 285

Query: 777  LDLALTN--KERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNW 604
            LD+   +  ++     +   ++  G D C +     YFN  +VQKA HAN        +W
Sbjct: 286  LDVCYPSIVQQELRLKKMATKMSMGVDVCMTYERRFYFNLPEVQKALHAN--RTHLPYSW 343

Query: 603  KTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLK 424
              CS  +  +       +LP+ +++I     IWI+SGD D  VP  GSR  +  L   L 
Sbjct: 344  SMCSGVLNYSDIDGNIDMLPILKRIILNKTPIWIFSGDQDSVVPFGGSRTLVRELAQDLN 403

Query: 423  ----SPWRSWFHNHQVGGRIVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
                 P+ +WFH  QVGG  +EY   LTF TVRGA H+VP  +PS AL L  SF+SG  L
Sbjct: 404  FKTTVPYGAWFHKSQVGGWAIEYGKLLTFATVRGAAHMVPYAQPSRALHLFSSFVSGRRL 463

Query: 258  P 256
            P
Sbjct: 464  P 464



>pir|H86406|H86406 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AE005172_891694 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC069471_1540857 Arabidopsis thaliana
            chromosome 1 BAC F13K9 genomic sequence, complete
            sequence.
          Length = 456

 Score =  298 bits (762), Expect = 3e-79
 Identities = 178/483 (36%), Positives = 257/483 (53%), Gaps = 13/483 (2%)
 Frame = -2

Query: 1659 FLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYW 1480
            +L + F +I +  + + S      SD++  LPGQP       +SGY+TV+    RALFY+
Sbjct: 6    WLTISFALI-IFHSLTVSSSVLSHSDRVTRLPGQPRVGF-QQYSGYVTVDDKKQRALFYY 63

Query: 1479 FFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLL 1300
            F EA+++PS+KPLVLWLNGGPGCSS+G GA +E GP R K  G  L  N++SWN+EAN+L
Sbjct: 64   FAEAETNPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPK--GPILVKNQHSWNQEANML 121

Query: 1299 FVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGH 1120
            ++E+PVGVGFSY+          DK  A+D   FL  W  +FP +     FI GESYAGH
Sbjct: 122  YLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGH 181

Query: 1119 YVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDK 940
            YVPQLAE++   N+   ++   NL+G  +GNP      D+    EY WSH +ISD  Y  
Sbjct: 182  YVPQLAELMIQYNKKHHLF---NLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDSTYKM 238

Query: 939  AKEVCDFT-------QENWSDKCNEAMSIVFTKYEE-IDIYNIYGPRCLLNGSSSATGIR 784
                C+++       + + S  C++ MS V T+    +D Y++                 
Sbjct: 239  FTSYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDV----------------- 281

Query: 783  GVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNW 604
              LD+ + +        + K++    D C       Y NR DVQ+A HA +        W
Sbjct: 282  -TLDVCIPS-----VLSQSKQVGESVDVCVEDETVNYLNRRDVQEALHARLI---GVREW 332

Query: 603  KTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL--KLP 430
              CS+ +           + +   L+K G+ + +YSGD D  +P+ GSR  +  L  +L 
Sbjct: 333  TVCSNVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLG 392

Query: 429  LKS--PWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            L++  P+R WF   QVGG    Y + L+F TVRGA H VP ++P  +L L  +FL G  L
Sbjct: 393  LRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGASHEVPFSQPERSLVLFKAFLDGHPL 452

Query: 258  PAQ 250
            P +
Sbjct: 453  PEE 455



>pir|F84746|F84746 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC002332_1530325 Arabidopsis
            thaliana chromosome 2 clone F4P9 map ve015, complete
            sequence.
          Length = 458

 Score =  298 bits (762), Expect = 3e-79
 Identities = 178/477 (37%), Positives = 248/477 (51%), Gaps = 13/477 (2%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            L++ +      S      +D+I  LPGQP       +SGY+T+++   RALFY+  EA++
Sbjct: 13   LILLLQALSLVSSTILSRADRITRLPGQPRVGF-QQYSGYVTIDEKKQRALFYYLAEAET 71

Query: 1461 HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
             P +KPLVLWLNGGPGCSS+G GA +E GP R K  G  L  N++SWN+EAN+L++E+PV
Sbjct: 72   KPISKPLVLWLNGGPGCSSLGVGAFSENGPFRPK--GSILVRNQHSWNQEANMLYLETPV 129

Query: 1281 GVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA 1102
            GVGFSY N         DK  A+D   FL  W  +FPQ+     FI GESYAGHYVPQLA
Sbjct: 130  GVGFSYANESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLA 189

Query: 1101 EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD 922
            +++   N+   ++   NLKG  +GNP      D+    EY WSH +ISD  Y      C+
Sbjct: 190  QLMIQYNKKHNLF---NLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCN 246

Query: 921  FT-------QENWSDKCNEAMSIVFTKYEE-IDIYNIYGPRCLLNGSSSATGIRGVLDLA 766
            ++       + + S  C + +S V  +    ID Y++                   LD+ 
Sbjct: 247  YSRFLSEYHRGSVSSMCTKVLSQVGIETSRFIDKYDV------------------TLDVC 288

Query: 765  LTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDP 586
            + +        + K++    D C       Y NR DVQKA HA +     T  W  CSD 
Sbjct: 289  IPS-----VLSQSKQVGETVDVCLEDETVNYLNRRDVQKALHARL---VGTRKWTVCSDV 340

Query: 585  VFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI----EALKLPLKSP 418
            +           + +   L+K G+ +++YSGD D  +P+ GSR  +    E L L    P
Sbjct: 341  LDYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVP 400

Query: 417  WRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            +R WF   QVGG    Y + L F TVRGA H VP ++P+ AL L  +FL G  LP +
Sbjct: 401  YRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLPEE 457



>gb:AY074317_1567474 Arabidopsis thaliana putative serine
            carboxypeptidase II (At2g33530) mRNA, complete cds.
          Length = 465

 Score =  296 bits (759), Expect = 7e-79
 Identities = 177/477 (37%), Positives = 249/477 (52%), Gaps = 13/477 (2%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            L++ +      S      +D+I  LPGQP       +SGY+T+++   RALFY+  EA++
Sbjct: 13   LILLLQALSLVSSTILSRADRITRLPGQPRVGF-QQYSGYVTIDEKKQRALFYYLAEAET 71

Query: 1461 HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
             P +KPLVLWLNGGPGCSS+G GA +E GP R K  G  L  N++SWN+EAN+L++E+PV
Sbjct: 72   KPISKPLVLWLNGGPGCSSLGVGAFSENGPFRPK--GSILVRNQHSWNQEANMLYLETPV 129

Query: 1281 GVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA 1102
            GVGFSY N         DK  A+D   FL  W  +FPQ+     FI GESYAGHYVPQLA
Sbjct: 130  GVGFSYANESSSYEGVNDKITAKDNLVFLQKWFLKFPQYLNRSLFITGESYAGHYVPQLA 189

Query: 1101 EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD 922
            +++   N+   ++   NLKG  +GNP      D+    EY WSH +ISD  Y      C+
Sbjct: 190  QLMIQYNKKHNLF---NLKGIAIGNPVMEFATDFNSRAEYFWSHGLISDPTYKLFTSSCN 246

Query: 921  FT-------QENWSDKCNEAMSIVFTKYEE-IDIYNIYGPRCLLNGSSSATGIRGVLDLA 766
            ++       + + S  C + +S V  +    ID Y++    C+ +  S +  +       
Sbjct: 247  YSRFLSEYHRGSVSSMCTKVLSQVGIETSRFIDKYDVTLDVCIPSVLSQSKVVS------ 300

Query: 765  LTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDP 586
                       + +++    D C       Y NR DVQKA HA +     T  W  CSD 
Sbjct: 301  ----------PQPQQVGETVDVCLEDETVNYLNRRDVQKALHARL---VGTRKWTVCSDV 347

Query: 585  VFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI----EALKLPLKSP 418
            +           + +   L+K G+ +++YSGD D  +P+ GSR  +    E L L    P
Sbjct: 348  LDYEVLDVEVPTINIVGSLVKAGVPVFVYSGDQDSVIPLTGSRTLVKRLAEELGLRTTVP 407

Query: 417  WRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
            +R WF   QVGG    Y + L F TVRGA H VP ++P+ AL L  +FL G  LP +
Sbjct: 408  YRVWFAGQQVGGWTQVYGNTLAFATVRGAAHEVPFSQPARALVLFKAFLGGRPLPEE 464



>gb:AY059854_1564698 Arabidopsis thaliana serine carboxypeptidase II,
            putative (At1g28110; F13K9.20) mRNA, complete
            cds.>gb:BT008763_1639959 Arabidopsis thaliana At1g28110
            mRNA, complete cds.
          Length = 461

 Score =  296 bits (758), Expect = 9e-79
 Identities = 177/483 (36%), Positives = 255/483 (52%), Gaps = 13/483 (2%)
 Frame = -2

Query: 1659 FLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYW 1480
            +L + F +I +  + + S      SD++  LPGQP       +SGY+TV+    RALFY+
Sbjct: 6    WLTISFALI-IFHSLTVSSSVLSHSDRVTRLPGQPRVGF-QQYSGYVTVDDKKQRALFYY 63

Query: 1479 FFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLL 1300
            F EA+++PS+KPLVLWLNGGPGCSS+G GA +E GP R K  G  L  N++SWN+EAN+L
Sbjct: 64   FAEAETNPSSKPLVLWLNGGPGCSSLGVGAFSENGPFRPK--GPILVKNQHSWNQEANML 121

Query: 1299 FVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGH 1120
            ++E+PVGVGFSY+          DK  A+D   FL  W  +FP +     FI GESYAGH
Sbjct: 122  YLETPVGVGFSYSTQSSHYEGVNDKITARDNLVFLQRWFLKFPHYLNRSLFITGESYAGH 181

Query: 1119 YVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDK 940
            YVPQLAE++   N+   ++   NL+G  +GNP      D+    EY WSH +ISD  Y  
Sbjct: 182  YVPQLAELMIQYNKKHHLF---NLRGIAIGNPVLEFATDFNSRAEYFWSHGLISDSTYKM 238

Query: 939  AKEVCDFT-------QENWSDKCNEAMSIVFTKYEE-IDIYNIYGPRCLLNGSSSATGIR 784
                C+++       + + S  C++ MS V T+    +D Y++                 
Sbjct: 239  FTSYCNYSRYVSEYYRGSMSSMCSKVMSQVSTETSRFVDKYDV----------------- 281

Query: 783  GVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNW 604
              LD+ + +           ++    D C       Y NR DVQ+A HA +        W
Sbjct: 282  -TLDVCIPSVLSQSKVVSPNQVGESVDVCVEDETVNYLNRRDVQEALHARLI---GVREW 337

Query: 603  KTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL--KLP 430
              CS+ +           + +   L+K G+ + +YSGD D  +P+ GSR  +  L  +L 
Sbjct: 338  TVCSNVLDYQLLDVEIPTINIVGSLVKAGVPVLVYSGDQDSVIPLTGSRTLVSRLAKQLG 397

Query: 429  LKS--PWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            L++  P+R WF   QVGG    Y + L+F TVRGA H VP ++P  +L L  +FL G  L
Sbjct: 398  LRTSVPYRVWFAGQQVGGWTQVYGNVLSFATVRGASHEVPFSQPERSLVLFKAFLDGHPL 457

Query: 258  PAQ 250
            P +
Sbjct: 458  PEE 460



>gb:OSJN00240_1697235 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0039C07, complete sequence.
          Length = 470

 Score =  296 bits (757), Expect = 1e-78
 Identities = 179/471 (38%), Positives = 244/471 (51%), Gaps = 18/471 (3%)
 Frame = -2

Query: 1614 SSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVL 1435
            S+   A  E D+I  LPGQP+      +SGY+TV+ +  R LFY+F EA+  P+ KPLVL
Sbjct: 25   SAMAAATMEEDRIVALPGQPNVSF-AQYSGYVTVDAARRRELFYYFAEAELDPATKPLVL 83

Query: 1434 WLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX 1255
            WLNGGPGCSS+G GA +E GP R   N   L  N+YSWNKEAN+L++ESP GVGFSY+  
Sbjct: 84   WLNGGPGCSSVGVGAFSENGPFRPSGNV--LVRNEYSWNKEANMLYLESPAGVGFSYSTD 141

Query: 1254 XXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD 1075
                    D   A+D   FL  W  +FPQ+KG D +I GESYAGHYVPQLA+ + + N+ 
Sbjct: 142  PSFYGGVGDSRTARDNLRFLQGWFAKFPQYKGRDLYITGESYAGHYVPQLAQRMVEFNKK 201

Query: 1074 RGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ---ENW 904
              ++   NLKG  +GNP      D+    E+ WSH +ISD  Y     VC++++   E +
Sbjct: 202  EKLF---NLKGIALGNPVLEFATDFNSRAEFFWSHGLISDSTYHSFTTVCNYSRYVSEYY 258

Query: 903  SDKCNEAMSIVFTKYEE-----IDIYNIYGPRC---LLNGSSSATGIRGVLDLALTNKER 748
                + A   V T+        +D Y++    C   +L  S S    RG  +L       
Sbjct: 259  HGSLSSACDTVMTQVARETSRFVDKYDVTLDVCVSSVLMQSKSLAPQRGSREL------- 311

Query: 747  TYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYK 568
                          D C       Y NR DVQ+A HA  R  G    W  CS  +     
Sbjct: 312  --------------DVCVEDETMGYLNRKDVQEAMHA--RLEGGVPKWTVCSSVLEYKQL 355

Query: 567  YTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLK-----SPWRSWF 403
                  + +   L+K G+ + +YSGD D  +P+ GSR  ++ L   L+     + +R WF
Sbjct: 356  DLQIPTINIVGGLVKSGVPVLVYSGDQDSVIPLTGSRTVVQRLAGWLRLGTTAAGYRVWF 415

Query: 402  HNHQVGGRIVEYHG--LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
               QVGG    + G  L+F TVRGA H  P ++P  +L L  +FL+G  LP
Sbjct: 416  EGRQVGGWTQSFGGGALSFATVRGASHEAPFSQPERSLVLFAAFLAGRPLP 466



>gb:AB023032_1515329 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K5J14.>gb:BT002948_1636535 Arabidopsis thaliana
            clone RAFL15-03-J21 (R20319) putative serine
            carboxypeptidase-II (At5g42230) mRNA, complete
            cds.>gb:BT004386_1637458 Arabidopsis thaliana clone
            U20319 putative serine carboxypeptidase-II (At5g42230)
            mRNA, complete cds.
          Length = 469

 Score =  295 bits (754), Expect = 3e-78
 Identities = 176/460 (38%), Positives = 245/460 (53%), Gaps = 15/460 (3%)
 Frame = -2

Query: 1590 ESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGC 1411
            E+D +  LPGQP   +   ++GY+ ++ + GR+LFY+F EA+ HP  KPL LWLNGGPGC
Sbjct: 25   ETDLVVRLPGQPKV-VFRQYAGYVDLDLNAGRSLFYYFVEAEKHPDTKPLTLWLNGGPGC 83

Query: 1410 SSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXX 1231
            SS+G GA  ELGP      G GL  N  SWNK +NLLFV+SP GVG+SY+N         
Sbjct: 84   SSVGGGAFTELGPFYPTGYGRGLRINSMSWNKASNLLFVDSPAGVGWSYSN-RSSDYNAG 142

Query: 1230 DKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRN-RDRGIYPRI 1054
            DK  A D   FL+ W ++FP+ K HD F+ GESYAGHY+PQLA+ +   N R  G   + 
Sbjct: 143  DKSAASDMLVFLLRWFDKFPELKSHDLFLTGESYAGHYIPQLADAILSYNSRSSGF--KF 200

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ------ENWSDKC 892
            N+KG  +GNP      D   + E+ WSH +IS+      K  CDF+        N SD C
Sbjct: 201  NIKGIAIGNPLLKLDRDIPAVYEFFWSHGMISEVVGRTIKIQCDFSHYTYAYPHNVSDAC 260

Query: 891  NEAM---SIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKR 721
            N+A+     + T+Y  ++ +++    C  +             +AL          +M  
Sbjct: 261  NDAIREAGDITTEY--VNTFDVLPDLCYPS-------------IALQELRLKQMATKMSM 305

Query: 720  IPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV 541
               G D C +   + Y N  +VQ A HAN        +W  CS+ +  +      ++LP 
Sbjct: 306  ---GVDVCMNYERQFYLNIPEVQMALHAN--RTNLPYSWSLCSNLLNYSAIDVNTNMLPT 360

Query: 540  YEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLK----SPWRSWFHNHQVGGRIV 373
             +++I+  + + I+SGD D  VP +G+R  +  L   L      P+  WFH  QVGG  +
Sbjct: 361  LKRIIQNKIPVRIFSGDQDSVVPFLGTRTIVGELANDLNFKTTVPYGVWFHKRQVGGWAI 420

Query: 372  EYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
            EY   LTF TVRGA H V   +PS AL L  +FL G+ LP
Sbjct: 421  EYGNLLTFATVRGAAHAVAYTQPSRALHLFSTFLRGQRLP 460



>gb:BT004306_1637382 Arabidopsis thaliana clone RAFL15-29-H20 (R20958)
            putative serine carboxypeptidase II (At2g12480) mRNA,
            complete cds.
          Length = 442

 Score =  289 bits (739), Expect = 1e-76
 Identities = 180/477 (37%), Positives = 241/477 (50%), Gaps = 10/477 (2%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            ++V   V W++ AE        E D +  LPGQP+      F+GY+ V+  +GR+LFY++
Sbjct: 11   IMVLVTVQWLVFAEGYP-----EEDLVARLPGQPNVGF-RQFAGYVDVDSENGRSLFYYY 64

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLF 1297
             EA   P  KPL LWLNGGPGCSS+G GA  ELGP     +G GL  N  SWNK +NLLF
Sbjct: 65   VEAVKEPDTKPLTLWLNGGPGCSSVGGGAFTELGPFYPTGDGRGLRLNSMSWNKASNLLF 124

Query: 1296 VESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHY 1117
            VESP GVG+SY+N         DK    D   FL+ W  +FP+ K  D F+ GESYAGHY
Sbjct: 125  VESPAGVGWSYSN-RSSDYNTGDKSTVNDMLVFLLRWFNKFPELKSRDLFLTGESYAGHY 183

Query: 1116 VPQLAEVVFDRN-RDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDK 940
            +PQLA+V+   N R  G   + N+KG  +GNP      D+    EY WSH +ISD+    
Sbjct: 184  IPQLADVILSYNSRSSGF--KFNVKGIAIGNPLLKLDRDFAAAYEYFWSHGMISDEVRLT 241

Query: 939  AKEVCDFTQ-ENWSDKCNEAM--SIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDL 769
                CDF   +N S+ C  A+  S V T+Y  I+ Y+I                      
Sbjct: 242  IMNQCDFANPKNMSNACIYAIVESSVLTEY--INSYHIL--------------------- 278

Query: 768  ALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHAN-IRAPGSTVNWKTCS 592
                                 D CY    ++   R+    A HAN  R P     W  CS
Sbjct: 279  --------------------LDVCYPSIVQQEL-RLKKMNALHANRTRLP---YEWTMCS 314

Query: 591  DPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI----EALKLPLK 424
            + +  +       +LP  +++I+    +WI+SGD D  +P+  SR  +    E L     
Sbjct: 315  NRLNYSGIDGYIDMLPSLKRIIQNQTPVWIFSGDQDSVIPLQSSRTLVRELAEDLNFKTT 374

Query: 423  SPWRSWFHNHQVGGRIVEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
             P+ +WFH  QVGG + EY   LTF TVRGA H+VP  +PS AL +  SF++G  LP
Sbjct: 375  IPYGAWFHKEQVGGWVTEYGNLLTFATVRGAAHMVPYAEPSRALHMFSSFMNGRRLP 431



>sp|P55747|CP21_HORVU Serine carboxypeptidase II-1 precursor (EC
            3.4.16.6) (CP-MII.1) (Fragment).>gb:HVACXPII1_1682225
            Hordeum vulgare L. (Alexis) mRNA for serine
            carboxypeptidase II-1.
          Length = 324

 Score =  275 bits (704), Expect = 2e-72
 Identities = 141/323 (43%), Positives = 196/323 (60%), Gaps = 2/323 (0%)
 Frame = -2

Query: 1218 AQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY-PRINLKG 1042
            A D+Y FLVNWLERFPQ+K  DF+IAGESYAGHYVPQL+++V   N+  G+  P +N KG
Sbjct: 13   AHDSYAFLVNWLERFPQYKYRDFYIAGESYAGHYVPQLSQLVHRNNK--GVRKPILNFKG 70

Query: 1041 FIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDF-TQENWSDKCNEAMSIVFT 865
            F+VGN   +DY+D+ G  EY W+H +ISD  Y K +  C+F + E+ S+ CN+  ++   
Sbjct: 71   FMVGNAVIDDYHDFVGTFEYWWTHGLISDDTYQKLQLACEFDSAEHESEACNKINNVAEA 130

Query: 864  KYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPY 685
            +   ID Y+IY P C          I+G                R   +P GYDPC   Y
Sbjct: 131  EEGLIDAYSIYTPTCKKTSLHRRRLIKG----------------RRPWLPRGYDPCTEQY 174

Query: 684  AEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIW 505
            + +Y+N  +VQKAF AN+   G   +W  CSD +   +K +  S+LP+Y +LI  G++IW
Sbjct: 175  STKYYNLPEVQKAFRANVT--GIPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIW 232

Query: 504  IYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHL 325
            ++SGDAD  VP+  +RY I+AL LP  + W  W+   +V G    Y GLT VT+RGAGH 
Sbjct: 233  VFSGDADSVVPLTATRYSIDALYLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHE 292

Query: 324  VPLNKPSEALALIHSFLSGEELP 256
            VPL++P +AL L   FL  + +P
Sbjct: 293  VPLHRPQQALKLFEHFLQDKPMP 315



>gb:AF061282_1765201 Sorghum bicolor 22 kDa kafirin cluster.
          Length = 657

 Score =  271 bits (693), Expect = 3e-71
 Identities = 159/410 (38%), Positives = 217/410 (52%), Gaps = 13/410 (3%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTH--FSGYITVNQSHGRALFYWFFEAK----SHPSNKPLVLW 1432
            +E D I  LPG P    +    + GYITV++  GRAL+YWF EA       P   PL+LW
Sbjct: 235  REDDLIRGLPGLPPNDDVPFDMYGGYITVDEQAGRALYYWFQEADRTEVEDPDAAPLLLW 294

Query: 1431 LNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            LNGGPGCSSIG GA  ELG  RV  +G  L  N+++WN+                     
Sbjct: 295  LNGGPGCSSIGGGALEELGAFRVHTDGERLLRNEFAWNR--------------------- 333

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                       A D Y FLV W ERFP++K  DF+IAGESY GHYVPQL+++V+ RN   
Sbjct: 334  -----------AHDAYKFLVKWFERFPKYKYRDFYIAGESYGGHYVPQLSQLVY-RNNIG 381

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE-NWSDK 895
               P IN KGF+VGN  TND  D  G+ E+ W H +ISD+  +   ++C  +   +   +
Sbjct: 382  VENPSINFKGFMVGNGLTNDRTDMIGMFEFWWHHGLISDETLESGLKICPGSSFIHIEPE 441

Query: 894  CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKR-- 721
            C +       +   ID Y+IY P C                    +K   YA RR++R  
Sbjct: 442  CQKIWDKAVEEQGNIDGYSIYTPPC--------------------DKGTPYARRRLRRSR 481

Query: 720  ----IPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS 553
                +P  YDPC + Y+ +Y N  +VQ A HAN+        W  CSDP++  +  T  S
Sbjct: 482  RPLMLPA-YDPCTAFYSTKYLNLPEVQTAMHANVSGI-IDYPWVLCSDPLYYNWTDTPAS 539

Query: 552  LLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWF 403
            +LP+Y++LI  GLK+W++SGD D  VP+ G+R  + AL LP+K+ W  W+
Sbjct: 540  MLPIYKELIGAGLKVWVFSGDTDTAVPLSGTRRSLAALGLPVKTSWYPWY 589



>gb:AY136365_1581866 Arabidopsis thaliana serine carboxypeptidase 1
            precursor-like protein (At4g12910) mRNA, complete
            cds.>gb:BT000181_1634459 Arabidopsis thaliana serine
            carboxypeptidase 1 precursor-like protein (At4g12910)
            mRNA, complete cds.
          Length = 497

 Score =  264 bits (675), Expect = 4e-69
 Identities = 172/498 (34%), Positives = 256/498 (51%), Gaps = 31/498 (6%)
 Frame = -2

Query: 1659 FLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYW 1480
            +L+  F+ + +L       ++A ES  I  LPG        H+SGY+T+++ HG+ L+Y+
Sbjct: 8    WLMKVFVFVTLLSLVFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKEHGKNLWYY 67

Query: 1479 FFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGP----LRVKRNGVG-LHFNKYSWNK 1315
            F E++ +PS  P+VLWLNGGPGCSS+  G   E GP    L  K N +  LH N YSW+K
Sbjct: 68   FIESEKNPSKDPVVLWLNGGPGCSSMD-GFVYEHGPFNFELPKKNNSLPLLHLNPYSWSK 126

Query: 1314 EANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGE 1135
             +N+++++SPVGVGFSY+N          K  A D++ FL+ W + FP+F+ + FFI+GE
Sbjct: 127  VSNIIYLDSPVGVGFSYSNNKSDYITGDIK-TAVDSHAFLLKWFQMFPEFQSNPFFISGE 185

Query: 1134 SYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD 955
            SYAG YVP LA  V   N++ G+ P +N KG++VGN   +  +D    + +A    +ISD
Sbjct: 186  SYAGVYVPTLASEVVIGNKN-GVKPALNFKGYLVGNVVADPKFDGNAFVPFAHGMGLISD 244

Query: 954  QQYDKAKEVCDFT-QENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIR-- 784
            + ++   + C     E    +C E  + V     +++IYNI  P C    S SA  IR  
Sbjct: 245  ELFENVTKACKGNFYEIEGLECEEQYTKVNDDTNQLNIYNILEP-CYHGTSLSAFDIRSL 303

Query: 783  --GVLDLALTNKERTYAYRRMKR-------IPGGYDPCYSP-------------YAEEYF 670
               +L L  T K      R   R       +  G  P +S               A  + 
Sbjct: 304  PSSLLQLGKTEKRLPIRKRMFGRAWPVRAPVHPGIVPSWSQLLADVTVPCIDDRVATAWL 363

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGD 490
            N  +++KA H   +       W+ CS  +  ++ +   S++  +  L   G +  IYSGD
Sbjct: 364  NDPEIRKAIHT--KEESEIGRWELCSGKL--SFYHDAGSMIDFHRNLTLSGYRALIYSGD 419

Query: 489  ADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLN 313
             D  VP  GS    ++L   +   WR+W  N QV G    Y + LTF+T++GAGH VP  
Sbjct: 420  HDMCVPFTGSEAWTKSLGYKVIDEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVPEY 479

Query: 312  KPSEALALIHSFLSGEEL 259
            KP EAL     FL G ++
Sbjct: 480  KPREALDFYSRFLEGSKI 497



>gb:AB025639_1516683 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone:MWL2.
          Length = 504

 Score =  263 bits (673), Expect = 6e-69
 Identities = 171/490 (34%), Positives = 251/490 (51%), Gaps = 42/490 (8%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNG 1423
            K+A +S  I  LPG        H++GY+ +++   + L+Y+F E++ + S  P+VLWLNG
Sbjct: 22   KSAPKSALITNLPGFNGTFPSKHYAGYVAIDKHRNKNLWYYFVESERNASVDPVVLWLNG 81

Query: 1422 GPGCSSIGYGAAAELGPLRV---KRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            GPGCSS+  G   E GP      K+N   LH N YSW+K +N+++++SPVGVGFSY+N  
Sbjct: 82   GPGCSSMD-GFVYEHGPFNFEPKKKNSHLLHLNPYSWSKVSNIIYLDSPVGVGFSYSNDN 140

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD- 1075
                    K  A DT+ FL+ W + FP+F+ + FFI+GESYAG YVP LA  V   N++ 
Sbjct: 141  ADYTTDDTK-TASDTHTFLLEWFKMFPEFQSNPFFISGESYAGIYVPTLAAEVVKGNKNA 199

Query: 1074 --------RGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDF 919
                        P IN KG++VGN  T++ +D   L+ +     +ISD+ Y++ K VC+ 
Sbjct: 200  MRTNKTSKNVTKPVINFKGYLVGNGVTDEVFDGNALVPFTHGMGLISDELYEETKLVCNG 259

Query: 918  T-----QENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGI----RGVLDLA 766
            T     Q   S +C   +  V      +++YNI  P C    S SA  I    + +L L 
Sbjct: 260  TYYTGGQSGVSKECAGKLKTVSDTVNLLNLYNILEP-CYHGTSLSALDIEFLPKSLLTLG 318

Query: 765  LTNKERTYAYRRMKR-------------------IPGGYDPCY-SPYAEEYFNRIDVQKA 646
             T K      R   R                   + G   PC     A ++ N   V+KA
Sbjct: 319  KTEKPMAVRKRMFGRAWPLGAVVRPGIVPSWSQLLAGFGVPCIDDTVATKWLNDPAVRKA 378

Query: 645  FHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVI 466
             HA  +   +  NW+ CS  +   Y++ T S++  +  L   G +  I+SGD D  VP  
Sbjct: 379  VHA--KEEKAIGNWELCSSNL--EYRHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYT 434

Query: 465  GSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALAL 289
            GS    +A+   +   WR W  N+QV G    Y + LTF+T++GAGH VP  KP E+L  
Sbjct: 435  GSEAWTKAMGYKVVDEWRPWMSNNQVAGFTQGYANNLTFLTIKGAGHTVPEYKPRESLDF 494

Query: 288  IHSFLSGEEL 259
               FL+GE++
Sbjct: 495  YSRFLAGEKI 504



>pir|S53311|S53311 hydroxymandelonitrile lyase (EC 4.1.2.11) chain A -
            sorghum  (fragment)
          Length = 366

 Score =  261 bits (667), Expect = 3e-68
 Identities = 147/370 (39%), Positives = 207/370 (55%), Gaps = 9/370 (2%)
 Frame = -2

Query: 1332 KYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHD 1153
            +Y+WNK AN+LF ESP GVGFSY+N         DK +AQDTY FLV W ERFP +K  +
Sbjct: 4    EYAWNKAANILFAESPAGVGFSYSNTSSDLSMGDDK-MAQDTYTFLVKWFERFPHYKYRE 62

Query: 1152 FFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWS 973
            F+IAGES  GH++PQL++VV+   R+R   P IN +G +V +  TND+ D  G+ E  W 
Sbjct: 63   FYIAGES--GHFIPQLSQVVY---RNRNNSPFINFQGLLVSSGLTNDHEDMIGMFESWWH 117

Query: 972  HAIISDQQYDKAKEVCDFTQ-ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSA 796
            H +ISD+  D   +VC  T   + + +C E  +    +   I+ Y IY P C        
Sbjct: 118  HGLISDETRDSGLKVCPGTSFMHPTPECTEVWNKALAEQGNINPYTIYTPTC-------- 169

Query: 795  TGIRGVLDLALTNKERTYAYRRMKRIP-----GGYDPCYSPYAEEYFNRIDVQKAFHANI 631
                   D   +  +R +     +  P       YDPC    +  Y N  +VQ A HAN+
Sbjct: 170  -------DREPSPYQRRFWAPHGRAAPPPLMLPPYDPCAVFNSINYLNLPEVQTALHANV 222

Query: 630  RAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYC 451
                    W  CS+ +F  +      LLPVY +LI+ GL++W+YSGD D  VPV  +R  
Sbjct: 223  SGI-VEYPWTVCSNTIFDQWGQAADDLLPVYRELIQAGLRVWVYSGDTDSVVPVSSTRRS 281

Query: 450  IEALKLPLKSPWRSWF---HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHS 280
            + AL+LP+K+ W  W+      +VGG  V+Y GLT+V+  GAGHLVP+++P++A  L   
Sbjct: 282  LAALELPVKTSWYPWYMAPTEREVGGWSVQYEGLTYVSPSGAGHLVPVHRPAQAFLLFKQ 341

Query: 279  FLSGEELPAQ 250
            FL GE +PA+
Sbjct: 342  FLKGEPMPAE 351



>sp|P37890|CBP1_ORYSA Serine carboxypeptidase I precursor (EC
            3.4.16.5) (Carboxypeptidase C).>pir|S43516|S43516
            carboxypeptidase C (EC 3.4.16.5) precursor -
            rice>gb:RICCBPI_1703565 Oryza sativa (japonica
            cultivar-group) gene for serine carboxypeptidase I,
            complete cds.
          Length = 510

 Score =  258 bits (660), Expect = 2e-67
 Identities = 174/518 (33%), Positives = 257/518 (49%), Gaps = 36/518 (6%)
 Frame = -2

Query: 1704 VSKESRVEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSG 1525
            +++  R  +A P     L  FL            +AA  S  +  +PG   A    H++G
Sbjct: 1    MARRGRRSLASPAVAIALFVFLAYGGGGGGGGVCEAAPASAVVKSVPGFDGALPSKHYAG 60

Query: 1524 YITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVG 1345
            Y+TV + HGR LFY+  E++  P+  PLVLWLNGGPGCSS   G   E GP   +  G  
Sbjct: 61   YVTVEEQHGRNLFYYLVESERDPAKDPLVLWLNGGPGCSSFD-GFVYEHGPFNFESGGSA 119

Query: 1344 -----LHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE 1180
                 LH N YSW+K +++++++SP GVG SY+           K  A D++ FL+ W +
Sbjct: 120  KSLPKLHLNPYSWSKVSSVIYLDSPAGVGLSYSKNTSDYNTGDLK-TAADSHTFLLKWFQ 178

Query: 1179 RFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDY 1000
             +P+F  + F+IAGESYAG YVP L+  V     D G+ P IN KG++VGN   +  +D 
Sbjct: 179  LYPEFLSNPFYIAGESYAGVYVPTLSHEVVKGLHD-GVKPTINFKGYMVGNGVCDTVFDG 237

Query: 999  KGLLEYAWSHAIISDQQYDKAKEVCDFTQEN-WSDKCNEAMSIVFTKYEEIDIYNI---- 835
              L+ +A   A+ISD  Y +A+  C     N  +DKC  A+  V T   +++IY+I    
Sbjct: 238  NALVPFAHGMALISDDIYQEAQTACHGNYWNTTTDKCENALYKVDTSINDLNIYDILEPC 297

Query: 834  YGPRCLLNGSSSATGI-RGVLDLALTNKERTYAYR------------RMKRIPGGYD--- 703
            Y  + +   + + T + +    L  T K      R            R  R+P   +   
Sbjct: 298  YHSKTIKKVTPANTKLPKSFQHLGTTTKPLAVRTRMHGRAWPLRAPVRAGRVPSWQEFAR 357

Query: 702  -------PCYS-PYAEEYFNRIDVQKAFHANIRAPGSTV-NWKTCSDPVFRAYKYTTFSL 550
                   PC S   A  + N  DV+ A HA    P S++ +W  C++ +   + +   S+
Sbjct: 358  GSRPSGVPCMSDEVATAWLNNDDVRAAIHAQ---PVSSIGSWLICTNVL--DFIHDAGSM 412

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVE 370
            +  ++ L   G + +IYSGD D  VP  G+     +L   +   WR W  N QV G    
Sbjct: 413  ISYHKNLTGQGYRAFIYSGDHDMCVPYTGTEAWTRSLGYGVIDSWRPWHLNGQVSGYTQG 472

Query: 369  Y-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            Y HGLTF T++GAGH VP  KP E+LA    +L+G +L
Sbjct: 473  YEHGLTFATIKGAGHTVPEYKPQESLAFYSRWLAGSKL 510



>sp|P52708|HNLS_SORBI P-(S)-hydroxymandelonitrile lyase precursor (EC
            4.1.2.11) (Hydroxynitrile lyase) (HNL)
            (Fragment).>gb:SBHYDMAN_1704864 S.bicolor mRNA for
            p-(S)-hydroxymandelonitrile lyase.
          Length = 366

 Score =  256 bits (654), Expect = 1e-66
 Identities = 145/370 (39%), Positives = 205/370 (55%), Gaps = 9/370 (2%)
 Frame = -2

Query: 1332 KYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHD 1153
            +Y+WNK AN+LF ESP GV FSY+N         DK +AQDTY FLV W ERFP +   +
Sbjct: 4    EYAWNKAANILFAESPAGVVFSYSNTSSDLSMGDDK-MAQDTYTFLVKWFERFPHYNYRE 62

Query: 1152 FFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWS 973
            F+IAGES  GH++PQL++VV+   R+R   P IN +G +V +  TND+ D  G+ E  W 
Sbjct: 63   FYIAGES--GHFIPQLSQVVY---RNRNNSPFINFQGLLVSSGLTNDHEDMIGMFELWWH 117

Query: 972  HAIISDQQYDKAKEVCDFTQ-ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSA 796
            H +ISD+  D   +VC  T   + + +C E  +    +   I+ Y IY P C        
Sbjct: 118  HGLISDETRDSGLKVCPGTSFMHPTPECTEVWNKALAEQGNINPYTIYTPTC-------- 169

Query: 795  TGIRGVLDLALTNKERTYAYRRMKRIP-----GGYDPCYSPYAEEYFNRIDVQKAFHANI 631
                   D   +  +R +     +  P       YDPC    +  Y N  +VQ A HAN+
Sbjct: 170  -------DREPSPYQRRFWAPHGRAAPPPLMLPPYDPCAVFNSINYLNLPEVQTALHANV 222

Query: 630  RAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYC 451
                    W  CS+ +F  +      LLPVY +LI+ GL++W+YSGD D  VPV  +R  
Sbjct: 223  SGI-VEYPWTVCSNTIFDQWGQAADDLLPVYRELIQAGLRVWVYSGDTDSVVPVSSTRRS 281

Query: 450  IEALKLPLKSPWRSWF---HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHS 280
            + AL+LP+K+ W  W+      +VGG  V+Y GLT+V+  GAGHLVP+++P++A  L   
Sbjct: 282  LAALELPVKTSWYPWYMAPTEREVGGWSVQYEGLTYVSPSGAGHLVPVHRPAQAFLLFKQ 341

Query: 279  FLSGEELPAQ 250
            FL GE +PA+
Sbjct: 342  FLKGEPMPAE 351



>sp|P07519|CBP1_HORVU Serine carboxypeptidase I precursor (EC
            3.4.16.5) (Carboxypeptidase C) (CP-MI).>pir|T05367|CPBHS
            carboxypeptidase C (EC 3.4.16.5) precursor -
            barley>gb:HVCPI_1682322 H.vulgare mRNA for serine
            carboxypeptidase I, CP-MI.
          Length = 499

 Score =  255 bits (652), Expect = 2e-66
 Identities = 168/493 (34%), Positives = 251/493 (50%), Gaps = 32/493 (6%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            L++ +  A S    AA +  ++  LPG   A    H++GY+TV++ HGR LFY+  E++ 
Sbjct: 16   LLLLLALALSGGGGAAPQGAEVTGLPGFDGALPSKHYAGYVTVDEGHGRNLFYYVVESER 75

Query: 1461 HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNG-----VGLHFNKYSWNKEANLLF 1297
             P   P+VLWLNGGPGCSS   G   E GP   +  G       LH N Y+W+K + +++
Sbjct: 76   DPGKDPVVLWLNGGPGCSSFD-GFVYEHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIY 134

Query: 1296 VESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHY 1117
            ++SP GVG SY+           K  A D++ FL+ W + +P+F  + F+IAGESYAG Y
Sbjct: 135  LDSPAGVGLSYSKNVSDYETGDLK-TATDSHTFLLKWFQLYPEFLSNPFYIAGESYAGVY 193

Query: 1116 VPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKA 937
            VP L+  V  +    G  P IN KG++VGN   +  +D   L+ +A    +ISD+ Y +A
Sbjct: 194  VPTLSHEVV-KGIQGGAKPTINFKGYMVGNGVCDTIFDGNALVPFAHGMGLISDEIYQQA 252

Query: 936  KEVCDFTQENWSD-KCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGI------RGV 778
               C     N +D KC+ A+S + +    ++IY+I  P C  + S     +      +  
Sbjct: 253  STSCHGNYWNATDGKCDTAISKIESLISGLNIYDILEP-CYHSRSIKEVNLQNSKLPQSF 311

Query: 777  LDLALTNKE---------RTYAYR---RMKRIPGGYD-----PCYS-PYAEEYFNRIDVQ 652
             DL  TNK          R +  R   +  R+P   +     PC S   A  + +   V+
Sbjct: 312  KDLGTTNKPFPVRTRMLGRAWPLRAPVKAGRVPSWQEVASGVPCMSDEVATAWLDNAAVR 371

Query: 651  KAFHA-NIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRV 475
             A HA ++ A G    W  C+D ++  + +   S++  ++ L   G +  I+SGD D  V
Sbjct: 372  SAIHAQSVSAIGP---WLLCTDKLY--FVHDAGSMIAYHKNLTSQGYRAIIFSGDHDMCV 426

Query: 474  PVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEA 298
            P  GS    ++L   +   WR W  N QV G    Y HGLTF T++GAGH VP  KP EA
Sbjct: 427  PFTGSEAWTKSLGYGVVDSWRPWITNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEA 486

Query: 297  LALIHSFLSGEEL 259
             A    +L+G +L
Sbjct: 487  FAFYSRWLAGSKL 499



>gb:AF242849_1780201 Lycopersicon esculentum wound-inducible
            carboxypeptidase mRNA, complete cds.
          Length = 498

 Score =  254 bits (648), Expect = 5e-66
 Identities = 170/505 (33%), Positives = 256/505 (50%), Gaps = 39/505 (7%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            LL+  L    L  E      A +S  +  LPG        H++GY+ +++SHG+ L+Y+F
Sbjct: 13   LLISLLAFLFLLTEG-----APQSALVTQLPGFNGTFNSKHYAGYVNIDESHGKNLYYYF 67

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRV---KRNG--VGLHFNKYSWNKE 1312
             E++ +PS  P+VLWLNGGPGCSS   G   E GP      K +G    LH N YSW+K 
Sbjct: 68   VESERNPSKDPVVLWLNGGPGCSSFD-GFVYEHGPFNFDFGKPSGSLPSLHNNPYSWSKV 126

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            +N+++++SPVGVG SY+           K  A D+++FL+ W E +P+F  + F+I+GES
Sbjct: 127  SNIIYLDSPVGVGLSYSGNKSDYNTGDLK-TASDSHSFLLKWFEIYPEFLKNPFYISGES 185

Query: 1131 YAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQ 952
            YAG YVP LA  V  +  D G+ P IN  G++VGN   +D  D   ++ +     +ISD 
Sbjct: 186  YAGIYVPTLASEVI-KGIDAGVRPAINFMGYMVGNGVADDIIDGNAIVPFQHGMGLISDD 244

Query: 951  QYDKAKEVC-----DFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGI 787
             Y++A   C     +    N S+K N+   +V+    ++++Y+I  P       S  T  
Sbjct: 245  LYEEAVVACHGNFYEPVDSNCSEKLNKIDQVVY----DLNVYDILEPCYHSKKPSVITTG 300

Query: 786  RGVLDLA---LTNKERTYAYRRMKRIPGGYDPCYSP------------------------ 688
               L ++   L   ER    R  KR+ G   P  +P                        
Sbjct: 301  NSRLPMSFRKLGETERPLPVR--KRMFGRAWPYKAPVRAGHVPTWPEILNSVEVPCTDDR 358

Query: 687  YAEEYFNRIDVQKAFHANIRAPGSTVN-WKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLK 511
             A  + N  DV+KA HA    P + +  W+ C+D +     + + S++P ++ L   G +
Sbjct: 359  VATLWLNNADVRKAIHAE---PATVIGPWELCTDKI--DLDHDSGSMIPYHKNLTARGYR 413

Query: 510  IWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGA 334
              I+SGD D  VP  GS    ++L  P+   WR W+ N QV G I  Y + L F+T++GA
Sbjct: 414  AIIFSGDHDMCVPFTGSAVWTKSLGYPIVDEWRPWYVNDQVAGFIQGYANNLIFMTIKGA 473

Query: 333  GHLVPLNKPSEALALIHSFLSGEEL 259
            GH VP  KP EALA    +L G+++
Sbjct: 474  GHTVPEYKPREALAFYSRWLEGKKI 498



>sp|Q09991|YSS2_CAEEL Putative serine carboxypeptidase K10B2.2
            precursor (EC 3.4.16.-).>pir|T16606|T16606 probable
            serine carboxypeptidase (EC 3.4.16.-) K10B2.2 precursor -
            Caenorhabditis elegans>gb:U28730_1402483 Caenorhabditis
            elegans cosmid K10B2, complete sequence.
          Length = 470

 Score =  244 bits (624), Expect = 3e-63
 Identities = 153/488 (31%), Positives = 247/488 (50%), Gaps = 29/488 (5%)
 Frame = -2

Query: 1638 VIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSH 1459
            ++++  +  S   AA  +DK+  LPG    P   H+SGY+       + L YW  E+   
Sbjct: 6    ILFIFVSSYSFCLAAPATDKVNDLPGLTFTPDFFHYSGYLRAWTD--KYLHYWLTESSRA 63

Query: 1458 PSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVG 1279
            P+  PLVLWLNGGPGCSS+  G   ELGP  VK  G  +++N+Y+WNK AN+LF+ESP G
Sbjct: 64   PTQDPLVLWLNGGPGCSSLD-GLIEELGPFHVKDFGNSIYYNEYAWNKFANVLFLESPAG 122

Query: 1278 VGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAE 1099
            VG+SY+          +  V+   Y  L+++L +FP++KG DF+I GESYAG Y+P LA 
Sbjct: 123  VGYSYSTNFNLTVSDDE--VSLHNYMALLDFLSKFPEYKGRDFWITGESYAGVYIPTLAV 180

Query: 1098 VVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKE---- 931
             + +   D+  +P  N KG  +GN   N   +Y  ++ + + HA++ D  Y+        
Sbjct: 181  RILN---DKKNFP--NFKGVAIGNGALNFPNNYNTMVPFYYYHALVRDDLYNDIARNCCN 235

Query: 930  ----VCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLAL 763
                 CD   + +   C + +        E+++YN+Y   C  N +              
Sbjct: 236  NNIGTCDIYSKFFDPNCRDKVINALDGTNELNMYNLYDV-CYYNPT-------------- 280

Query: 762  TNKERTYAYRRMKRIPGGYDP------------CYSPYAEEYFNRIDVQKAFHANIRAPG 619
            TN ++ +  R+M RI  G                 +     Y NR DV+K+ H     P 
Sbjct: 281  TNLKKAFIERQM-RIAVGLPARKHNAATTVPLCAQTNNTHVYLNRADVRKSLH----IPS 335

Query: 618  STVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL 439
            S   W+ CSD V + Y  T F+++P ++ +I  G+KI +Y+GD D     I ++  + +L
Sbjct: 336  SLPAWEECSDQVGKNYVVTHFNVIPEFQTMIAAGIKILVYNGDVDTACNSIMNQQFLTSL 395

Query: 438  KLPL----KSPWRSWFHNHQVGGRIVEYH-----GLTFVTVRGAGHLVPLNKPSEALALI 286
             L +    +    +W ++ Q G  +  +       + F+TVRG+GH VP +KP E+  +I
Sbjct: 396  NLTVLGEQEKVNEAWHYSGQTGTAVAGFQTKFAGNVDFLTVRGSGHFVPEDKPKESQQMI 455

Query: 285  HSFLSGEE 262
             +F++ ++
Sbjct: 456  FNFINNKD 463



>sp|P42661|NF31_NAEFO Virulence-related protein Nf314 (EC
            3.4.16.-).>pir|A43828|A43828 probable serine
            carboxypeptidase (EC 3.4.16.-) NF314 - Naegleria
            fowleri>gb:NGRNF314A_1390841 Naegleria fowleri
            virulence-related protein (NF314) mRNA, complete cds.
          Length = 482

 Score =  241 bits (614), Expect = 4e-62
 Identities = 163/469 (34%), Positives = 237/469 (50%), Gaps = 35/469 (7%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            LPG      +  ++GY+  N + GR LFYWFFE+  +PS  PLV+W NGGPGCSS+G G 
Sbjct: 19   LPGLSGNIGVKSYTGYLLANATRGRYLFYWFFESMRNPSQDPLVMWTNGGPGCSSLG-GE 77

Query: 1389 AAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQD 1210
            A+E G   V  +G  +  N YSWN+ +N+L++E PVGVGFSY+N         D   A D
Sbjct: 78   ASEHGLFLVNADGATITRNPYSWNRVSNILYIEQPVGVGFSYSNSTDDYQNLNDVQAASD 137

Query: 1209 TYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVG 1030
              N L ++L RFPQF G + ++AGESY G YVP  A  + + N  +G  P +NL G +VG
Sbjct: 138  MNNALRDFLTRFPQFIGRETYLAGESYGGVYVPTTAYNIVEGN-GKGQQPYVNLVGILVG 196

Query: 1029 NPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC--DFTQENWSDKCNEAMSIVFTKYE 856
            N  T+   D   +      H++IS + Y++  + C  DF        C + ++       
Sbjct: 197  NGVTDAEADSNSIPPMMKYHSLISIKYYEEGYKACQGDFYANQNLPACQKFLTDSSNAMG 256

Query: 855  EIDIYNIYGPRCLLNGSSSATGIR-------GVLDLALTNKERTYAYRRMKRIPGGYD-- 703
             I+ Y IY   C   G +    ++        VLD       + +   +M +  GG+   
Sbjct: 257  NINPYYIY-DSCPWLGINLQQKLKTTQEMTFQVLDPKTQQPVKIHPLFQMYK-HGGWSKR 314

Query: 702  ---------------PCY-SPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAY 571
                           PC  +    +YF R+DVQ+A     R       W  C+  +    
Sbjct: 315  VANERNFAPRFETDAPCVPNQSIAKYFRRLDVQQALGVR-RKTADPNGWNICTGIINYTQ 373

Query: 570  KYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQ 391
             Y+T  +LP Y KL+   ++I +YSGD D  V  +G++  I+ L+L   S WR+W  +  
Sbjct: 374  VYST--ILPFYAKLLP-HIRILVYSGDTDMVVNGLGTQAAIDKLQLQETSSWRTWEFDSA 430

Query: 390  ----VGGRIVEYH----GLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
                VGG I ++     GLTF+TVRGAGH+VPL KP  A  +  +F+ G
Sbjct: 431  LGTVVGGYIRKFEKSGKGLTFITVRGAGHMVPLVKPDSAFYMFKNFIDG 479



>gb:BC082950_2563019 Xenopus laevis hypothetical LOC494810, mRNA (cDNA
            clone MGC:86394 IMAGE:7011317), complete cds.
          Length = 470

 Score =  238 bits (608), Expect = 2e-61
 Identities = 168/492 (34%), Positives = 247/492 (50%), Gaps = 25/492 (5%)
 Frame = -2

Query: 1665 RTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALF 1486
            R FLL+G L          S  A   +D+I Y+PG P  P    +SG++ V  S G+ L 
Sbjct: 6    RCFLLLGAL----------SVVACYAADEITYMPGLPKQPSFRQYSGFLNV--SDGKHLH 53

Query: 1485 YWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEAN 1306
            YWF E++  PS  PLVLWLNGGPGCSS+  G   E GP  ++++GV L +N YSWNK AN
Sbjct: 54   YWFVESQKDPSTNPLVLWLNGGPGCSSLD-GLLTEHGPFLIQQDGVTLEYNDYSWNKIAN 112

Query: 1305 LLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYA 1126
            +L++E+P GVGFSY++         +  VA + Y  L  + + +PQF  +DF+I GESY 
Sbjct: 113  VLYIEAPAGVGFSYSDDKNYKTNDTE--VAHNNYLALKQFFQLYPQFSKNDFYITGESYG 170

Query: 1125 GHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD-- 955
            G YVP LA EV  D +        INLKG  VGN  ++   +   L+ +A+ H I+    
Sbjct: 171  GVYVPSLAVEVSQDSS--------INLKGIAVGNGLSSYENNDNSLIFFAYYHGILGSQL 222

Query: 954  ----QQYDKAKEVCDFTQE---NWSDKCNEAMSIVFTKYEEIDIYNIYGP-------RCL 817
                Q Y   K  C F      N S    EAM  V++    ++IYN+Y            
Sbjct: 223  WSGLQTYCCTKGSCQFYNNPDGNCSLLVQEAMHDVYS--TGLNIYNLYESCPGGAPGEVK 280

Query: 816  LNGSSSATGIRGVLDLALTN--KERTYAYRRMKRIPGGYDPCYSPYAEEYF-NRIDVQKA 646
             NG        G++   L     ++  +   +++      PC +  A   F N   V+ A
Sbjct: 281  DNGDHIIVYHPGMISPQLLKHWNKKLLSLSLVQKPIRLDPPCVNSTASRIFLNNGLVRLA 340

Query: 645  FHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDADGRVPV 469
             H     P S   W+ CS  V+  Y     S+   Y KL+     +I +Y+GD D     
Sbjct: 341  LH----IPPSVQQWEVCSYDVYSTYGRIYQSMKDHYLKLLSTMKYRILVYNGDVDMACNF 396

Query: 468  IGSRYCIEALKLPLKSPWRSWFHN----HQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSE 301
            +G ++ +++L+  L+   R W +N     Q+GG + E+  L+F+T++GAGH+VP +KP+ 
Sbjct: 397  LGDQWFVDSLQQKLQVQRRPWLYNEGGQQQIGGFVKEFSNLSFLTIKGAGHMVPTDKPNA 456

Query: 300  ALALIHSFLSGE 265
            A  +   FL  E
Sbjct: 457  AFIMFSRFLQNE 468



>pir|A85139|A85139 hypothetical protein AT4g12910 [imported] -
            Arabidopsis thaliana>gb:ATCHRIV35_1545055 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            35.>gb:ATF25G13_1549996 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F25G13, partial sequence (ESSA
            project).
          Length = 456

 Score =  238 bits (608), Expect = 2e-61
 Identities = 160/479 (33%), Positives = 238/479 (49%), Gaps = 32/479 (6%)
 Frame = -2

Query: 1659 FLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYW 1480
            +L+  F+ + +L       ++A ES  I  LPG        H+SGY+T+++ HG+ L+Y+
Sbjct: 3    WLMKVFVFVTLLSLVFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKEHGKNLWYY 62

Query: 1479 FFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGP----LRVKRNGVG-LHFNKYSWNK 1315
            F E++ +PS  P+VLWLNGGPGCSS+  G   E GP    L  K N +  LH N YSW+K
Sbjct: 63   FIESEKNPSKDPVVLWLNGGPGCSSMD-GFVYEHGPFNFELPKKNNSLPLLHLNPYSWSK 121

Query: 1314 EANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGE 1135
             +N+++++SPVGVGFSY+N          K  A D++ FL+ W + FP+F+ + FFI+GE
Sbjct: 122  VSNIIYLDSPVGVGFSYSNNKSDYITGDIK-TAVDSHAFLLKWFQMFPEFQSNPFFISGE 180

Query: 1134 SYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD 955
            SYAG YVP LA  V   N++ G+ P +N KG++VGN   +  +D    + +A    +ISD
Sbjct: 181  SYAGVYVPTLASEVVIGNKN-GVKPALNFKGYLVGNGVADPKFDGNAFVPFAHGMGLISD 239

Query: 954  QQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIR--- 784
            +                          +F    +++IYNI  P C    S SA  IR   
Sbjct: 240  E--------------------------LFEDTNQLNIYNILEP-CYHGTSLSAFDIRSLP 272

Query: 783  -GVLDLALTNKERTYAYRRMKR-------IPGGYDPCYSP-------------YAEEYFN 667
              +L L  T K      R   R       +  G  P +S               A  + N
Sbjct: 273  SSLLQLGKTEKRLPIRKRMFGRAWPVRAPVHPGIVPSWSQLLADVTVPCIDDRVATAWLN 332

Query: 666  RIDVQKAFHAN--IRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSG 493
              +++KA H      +      W+ CS  +  ++ +   S++  +  L   G +  IYSG
Sbjct: 333  DPEIRKAIHTKEVSNSESEIGRWELCSGKL--SFYHDAGSMIDFHRNLTLSGYRALIYSG 390

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVP 319
            D D  VP  GS    ++L   +   WR+W  N QV G    Y + LTF+T++GAGH VP
Sbjct: 391  DHDMCVPFTGSEAWTKSLGYKVIDEWRAWISNDQVAGYTQGYANNLTFLTIKGAGHTVP 449



>gb:AJ720789_2502976 Gallus gallus mRNA for hypothetical protein,
            clone 25l7.
          Length = 471

 Score =  238 bits (607), Expect = 3e-61
 Identities = 160/473 (33%), Positives = 245/473 (51%), Gaps = 28/473 (5%)
 Frame = -2

Query: 1599 AAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGG 1420
            AA    ++ YLPG P  P   HFSG++ +  +  + L YWF EA+++P   PLVLWLNGG
Sbjct: 17   AAPAGHEVTYLPGLPKQPSFRHFSGHLCIGPT--QRLHYWFVEAQNNPQGSPLVLWLNGG 74

Query: 1419 PGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXX 1240
            PGCSS+  G   E GP  V+ +GV L +N Y+WNK AN+L++ESP GVGFSY+       
Sbjct: 75   PGCSSME-GFLKEHGPFLVQPDGVTLKYNDYAWNKIANMLYLESPAGVGFSYSEDKKYAT 133

Query: 1239 XXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYP 1060
               +  VA + Y  L  +L  FP++  +D F+ GESY G Y+P LAE V          P
Sbjct: 134  NDTE--VAHNNYLALKEFLRLFPEYSKNDLFLTGESYGGVYIPTLAEWVMQD-------P 184

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC---------DFTQEN 907
             +NLKG  VGN  ++   +   L+ +A+ H ++  Q +   +  C         D +  N
Sbjct: 185  SLNLKGIAVGNGLSSYEINDNSLVYFAYYHGLLGTQLWKDLQTFCCSEGKCNFHDNSNLN 244

Query: 906  WSDKCNEAMSIVFTKYEEIDIYNIYGPRCL--LNGSSSATG---IRGVLDLALTNKERTY 742
             + K  E + IV  +   ++IYN+Y P C   + GS    G   I   L  +       +
Sbjct: 245  CTLKMAEMIEIV--EESGLNIYNLYAP-CAGGVPGSMRYEGDYLITHDLGNSFIRMPMRF 301

Query: 741  AYRR-MKRIPGGYD------PCYSPYAEE-YFNRIDVQKAFHANIRAPGSTVNWKTCSDP 586
            ++R+ + R+P   +      PC +  A   Y N  +V+KA H +  AP     W+ CS  
Sbjct: 302  SWRQNLFRMPVARNKVRMDPPCTNSTAPTMYLNSPEVRKALHISPDAP----EWQVCSFE 357

Query: 585  VFRAYKYTTFSLLPVYEKLIKGGLK--IWIYSGDADGRVPVIGSRYCIEALKLPLKSPWR 412
            V R+YK     +   Y KL+ G +K  I +Y+GD D     +G  + +++L   ++   R
Sbjct: 358  VNRSYKRLYMQMNDQYLKLL-GAMKYRILVYNGDVDMACNFLGDEWFVDSLCQKVQVARR 416

Query: 411  SWFH----NHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             W +     +Q+GG + E+  + F+TV+GAGH+VP ++P  A   +  F+  E
Sbjct: 417  PWLYTVGGENQIGGFVKEFTNIAFLTVKGAGHMVPTDQPLAAFTHVSRFIKNE 469



>gb:OSJN00208_1696721 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0062H02, complete sequence.
          Length = 504

 Score =  235 bits (599), Expect = 2e-60
 Identities = 157/482 (32%), Positives = 244/482 (50%), Gaps = 35/482 (7%)
 Frame = -2

Query: 1599 AAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGG 1420
            AA +   +  LPG   A    H+SGY+TV++  GR LFY+   ++   +  P+VLWLNGG
Sbjct: 33   AAPDGHLVASLPGFHGAFPSKHYSGYVTVDEGSGRRLFYYLVTSERDAAADPVVLWLNGG 92

Query: 1419 PGCSSIGYGAAAELGPLRVKRNG-----VGLHFNKYSWNKEANLLFVESPVGVGFSYTNX 1255
            PGCSS+  G   E GP   +R         L  N YSW+K +N+++++SP GVG SY+  
Sbjct: 93   PGCSSLD-GFVYENGPFNFERGSDPGGLPNLELNPYSWSKVSNVVYLDSPAGVGMSYSLN 151

Query: 1254 XXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD 1075
                     K  A D + FL+ W E +P+F+ + F+++GES+AG Y+P LA+ V  +  +
Sbjct: 152  KSDYTTGDLK-TAADAHTFLLKWFELYPEFQSNPFYMSGESFAGIYIPTLADEVV-KGIE 209

Query: 1074 RGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFT-QENWSD 898
            + + PRIN KG+++GN  T+  YD+   + +A    +IS + ++ A   C  T     ++
Sbjct: 210  KDLKPRINFKGYLIGNGATDQDYDFNSFVPFAHGMGLISTELFEDASTACHGTFWGKVNN 269

Query: 897  KCNEAMSIVFTKYEEIDIYNIYGP--------RCLLNGSSSATGIRGVLDLALTNKE--- 751
             C E +  V  + ++++ YNI  P              SS  +  R    L  T K    
Sbjct: 270  LCQEKIDRVHWELKDLNKYNILAPCYHHPEIQELEFKNSSLPSSFR---KLGETEKRFPV 326

Query: 750  ------RTYAYR------RMKRIP--GGYD-PCYS-PYAEEYFNRIDVQKAFHANIRAPG 619
                  R++  R      RM   P  GG   PC S   A  + +  DV+ A HA    P 
Sbjct: 327  RKRMAGRSWPLRAPVTRGRMTMWPELGGRSLPCTSDELANAWLDDEDVRAAIHAE---PK 383

Query: 618  STV-NWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEA 442
            S + +W+  +  +   Y  T  S++  ++K    G +  IYSGD D  +P +G+   + +
Sbjct: 384  SLIGSWELYTARI-EYYHDTGDSMVKYHKKFTAMGYRALIYSGDHDLCIPYVGTEAWVRS 442

Query: 441  LKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
            +   +   WR W+   QV G    Y H LTF+T++GAGH VP  KP E LA    +LSG+
Sbjct: 443  MGYRVIDHWRPWYFGGQVAGYTQGYEHNLTFLTIKGAGHTVPEYKPKETLAFYSHWLSGK 502

Query: 264  EL 259
            ++
Sbjct: 503  KI 504



>gb:AY280669_1315649 Branchiostoma belcheri tsingtaunese cathepsin A
            (CTSA) mRNA, complete cds.
          Length = 469

 Score =  229 bits (583), Expect = 2e-58
 Identities = 154/460 (33%), Positives = 227/460 (49%), Gaps = 19/460 (4%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A   D+I  LPG  S      +SGY  VN +  + L YWF E++ +P   P+VLWLNGGP
Sbjct: 22   AAHPDEIKSLPGLKSDLKFAQYSGY--VNATGNKKLHYWFVESQGNPKTDPVVLWLNGGP 79

Query: 1416 GCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXX 1237
            GCSS+  G  +E GP  V+ +G  L+ N YSWN+ AN++++ESP GVGFSY+        
Sbjct: 80   GCSSLD-GYLSENGPYHVEDDGSTLYENPYSWNQVANVVYLESPAGVGFSYSTDKNYSTD 138

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
                 VA D +  + ++  +FPQF  +DF+I GESY G+YVP LA  +   N        
Sbjct: 139  DNQ--VAMDNFVAVQSFFVKFPQFLPNDFYIVGESYGGYYVPTLAVNIMKGNTS------ 190

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE------NWSDK 895
            IN KGF +GN  T+   +    + Y + H +  D  +    + C           N    
Sbjct: 191  INFKGFGIGNGLTSHEMNANSAVYYGYYHGLYGDDIWKLLNKFCCSDDAGCQFAYNEDAN 250

Query: 894  CNEAMSIVFTKYEEIDI--YNIYG------PRCLLNGSSSATGIRGVLDLALTNKERTYA 739
            C EA+        +I +  Y +Y       P        + + +     L+L    +   
Sbjct: 251  CQEAVRQAMHYIYDIGLNEYALYRDCAGGLPPHFARWRMAVSHLFNTYGLSLPAPPKPQV 310

Query: 738  Y-RRMKRIP---GGYDPCYSPYAE-EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRA 574
               RM   P   G   PC +  A+  + NR DV+ A H     P     W  CS+ V   
Sbjct: 311  NGSRMYTAPTTLGQTPPCINATAQTAWLNRPDVRLALH----IPEFVQQWTLCSEEVGEQ 366

Query: 573  YKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNH 394
            YK    S+   Y  L+    +  +Y+GD D     +G ++ +E+LK P+ +  + W +N+
Sbjct: 367  YKTVYSSMHDQYLALLP-KYRALVYNGDTDMACNFLGDQWFVESLKQPVVAARKPWTYNN 425

Query: 393  QVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFL 274
            QV G I ++  LTF+TV+GAGH+VP  KP +ALA+I +FL
Sbjct: 426  QVAGFIKQFQNLTFLTVKGAGHMVPQWKPGQALAMITNFL 465



>gb:BC056531_2551805 Danio rerio zgc:65802, mRNA (cDNA clone MGC:65802
            IMAGE:6791975), complete cds.
          Length = 471

 Score =  226 bits (575), Expect = 1e-57
 Identities = 147/471 (31%), Positives = 235/471 (49%), Gaps = 29/471 (6%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A ++D++ YLPG    P   H+SGY  V  +  + L YWF E++  P + P+VLWLNGGP
Sbjct: 18   APDADEVKYLPGLSKQPSFRHYSGYFNV--ADNKHLHYWFVESQKDPVSSPVVLWLNGGP 75

Query: 1416 GCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXX 1237
            GCSS+  G   E GP  ++ +G  L +N Y+WNK AN+L++ESP GVGFSY++       
Sbjct: 76   GCSSMD-GLLTEHGPFLIQDDGATLEYNPYAWNKIANVLYLESPAGVGFSYSDDKQYTTN 134

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              +  VA + Y  L  + + FP+F  ++FF+ GESY G Y+P LAE+V + +        
Sbjct: 135  DTE--VAMNNYLALKAFFQLFPEFSKNEFFLTGESYGGIYIPTLAEIVMEDS-------S 185

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC---------DFTQENW 904
            INLKG  VGN  ++   +   L+ +A+ H ++    ++  ++ C         D    N 
Sbjct: 186  INLKGIAVGNGLSSYELNDNSLVYFAYYHGLLGTSLWNDLQKFCCKDGVCNFYDNQDVNC 245

Query: 903  SDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRG----VLDLALTNKERTYAY 736
            S   N    IV+     +++YN+Y P     G     G       + DL        ++ 
Sbjct: 246  SSSVNTVQVIVY--QSGLNMYNLYAP--CPGGVGQRFGFENGQFVIRDLGHHFINHQWSK 301

Query: 735  RRMKRIPGGYD---------PC-YSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDP 586
             + +++ G            PC  S  +  Y N   V+ A H +  A    ++W  CS  
Sbjct: 302  AQSEKMRGVVSLFKSTKLDPPCTNSTPSTLYLNNPLVKSALHISPNA----LDWVICSSE 357

Query: 585  VFRAYKYTTFSLLPVYEKLIKGGLK--IWIYSGDADGRVPVIGSRYCIEALKLPLKSPWR 412
            V   Y      +   Y KL+ G LK  + +Y+GD D     +G  + +E+L+  ++   R
Sbjct: 358  VNLNYNRLFMDVKKQYLKLL-GALKYRVLVYNGDVDMACNFLGDEWFVESLQQEVQVQRR 416

Query: 411  SWFH----NHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLS 271
             W +    + Q+GG + E+  L F+TV+G+GH+VP +KP  A  +   F++
Sbjct: 417  PWIYFNGESQQIGGFVKEFTNLAFITVKGSGHMVPTDKPIAAFTMFSRFIT 467



>gb:BC018534_2092764 Mus musculus protective protein for
            beta-galactosidase, mRNA (cDNA clone MGC:6527
            IMAGE:2651479), complete cds.
          Length = 474

 Score =  219 bits (558), Expect = 1e-55
 Identities = 151/488 (30%), Positives = 240/488 (49%), Gaps = 29/488 (5%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            L++ +L + +S  +AA + D+I  LPG    P    +SGY+  + S  +   YWF E+++
Sbjct: 9    LLLLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLRASDS--KHFHYWFVESQN 66

Query: 1461 HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
             P N P+VLWLNGGPGCSS+  G   E GP  ++ +GV L +N Y+WN  AN+L++ESP 
Sbjct: 67   DPKNSPVVLWLNGGPGCSSLD-GLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPA 125

Query: 1281 GVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA 1102
            GVGFSY++         +  VA++ Y  L ++   FP++K +  F+ GESYAG Y+P LA
Sbjct: 126  GVGFSYSDDKMYVTNDTE--VAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLA 183

Query: 1101 EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD------QQYDK 940
             +V          P +NL+G  VGN   +   +   L+ +A+ H ++ +      Q +  
Sbjct: 184  VLVMQD-------PSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCC 236

Query: 939  AKEVCDFTQENWSDKCNEAMSIV-FTKYEEIDIYNIYGPRCLLNGSSSATGIRG--VLDL 769
            A+  C+F      +  N  + +        ++IYN+Y P         A G+ G    + 
Sbjct: 237  AQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAP--------CAGGVPGRHRYED 288

Query: 768  ALTNKERTYAYRRM---KRIPGGY----------DPCYSPYA-EEYFNRIDVQKAFHANI 631
             L  ++    + R+   +R P              PC +  A   Y N   V+KA H   
Sbjct: 289  TLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALH--- 345

Query: 630  RAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDADGRVPVIGSRY 454
              P S   W  C+  V   Y+    S+   Y KL+     +I +Y+GD D     +G  +
Sbjct: 346  -IPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEW 404

Query: 453  CIEALKLPL---KSPW--RSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALAL 289
             +++L   +   + PW    W    QV G + E   +TF+T++GAGH+VP +KP  A  +
Sbjct: 405  FVDSLNQKMEVQRRPWLVDYWESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTM 464

Query: 288  IHSFLSGE 265
               FL+ E
Sbjct: 465  FSRFLNKE 472



>gb:AK019861_1160222 Mus musculus 11 days pregnant adult female ovary
            and uterus cDNA, RIKEN full-length enriched library,
            clone:5031400F07 product:protective protein for
            beta-galactosidase, full insert sequence.
          Length = 474

 Score =  219 bits (558), Expect = 1e-55
 Identities = 150/488 (30%), Positives = 241/488 (49%), Gaps = 29/488 (5%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            L++ +L + +S  +AA + D+I  LPG    P    +SGY+  + S  +   YWF E+++
Sbjct: 9    LLVLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLRASDS--KHFHYWFVESQN 66

Query: 1461 HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
             P N P+VLWLNGGPGCSS+  G   E GP  ++ +GV L +N Y+WN  AN+L++ESP 
Sbjct: 67   DPKNSPVVLWLNGGPGCSSLD-GLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPA 125

Query: 1281 GVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA 1102
            GVGFSY++         +  VA++ Y  L ++   FP++K +  F+ GESYAG Y+P LA
Sbjct: 126  GVGFSYSDDKMYVTNDTE--VAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLA 183

Query: 1101 EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD------QQYDK 940
             +V          P +NL+G  VGN   +   +   L+ +A+ H ++ +      Q +  
Sbjct: 184  VLVMQD-------PSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCC 236

Query: 939  AKEVCDFTQENWSDKCNEAMSIV-FTKYEEIDIYNIYGPRCLLNGSSSATGIRG--VLDL 769
            A+  C+F      +  N  + +        ++IYN+Y P         A G+ G    + 
Sbjct: 237  AQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAP--------CAGGVPGRHRYED 288

Query: 768  ALTNKERTYAYRRM---KRIPGGY----------DPCYSPYA-EEYFNRIDVQKAFHANI 631
             L  ++    + R+   +R P              PC +  A   Y N   V+KA H   
Sbjct: 289  TLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALH--- 345

Query: 630  RAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDADGRVPVIGSRY 454
              P S   W  C+  V   Y+    S+   Y KL+     +I +Y+GD D     +G  +
Sbjct: 346  -IPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEW 404

Query: 453  CIEALKLPLKSPWRSWFHNH-----QVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALAL 289
             +++L   ++   R W  ++     QV G + E   +TF+T++GAGH+VP +KP  A  +
Sbjct: 405  FVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTM 464

Query: 288  IHSFLSGE 265
               FL+ E
Sbjct: 465  FSRFLNKE 472



>sp|P16675|PRTP_MOUSE Lysosomal protective protein precursor (EC
            3.4.16.5) (Cathepsin A) (Carboxypeptidase C) (Protective
            protein for beta-galactosidase).>pir|A35732|A35732
            protective protein precursor - mouse>gb:AK032197_1162796
            Mus musculus adult male olfactory brain cDNA, RIKEN
            full-length enriched library, clone:6430411I23
            product:protective protein for beta-galactosidase, full
            insert sequence.>gb:MUSPROA_2129728 Mouse protective
            protein (Mo54) mRNA, complete cds.
          Length = 474

 Score =  219 bits (557), Expect = 2e-55
 Identities = 150/488 (30%), Positives = 241/488 (49%), Gaps = 29/488 (5%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            L++ +L + +S  +AA + D+I  LPG    P    +SGY+  + S  +   YWF E+++
Sbjct: 9    LLLLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLRASDS--KHFHYWFVESQN 66

Query: 1461 HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
             P N P+VLWLNGGPGCSS+  G   E GP  ++ +GV L +N Y+WN  AN+L++ESP 
Sbjct: 67   DPKNSPVVLWLNGGPGCSSLD-GLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPA 125

Query: 1281 GVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA 1102
            GVGFSY++         +  VA++ Y  L ++   FP++K +  F+ GESYAG Y+P LA
Sbjct: 126  GVGFSYSDDKMYVTNDTE--VAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLA 183

Query: 1101 EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD------QQYDK 940
             +V          P +NL+G  VGN   +   +   L+ +A+ H ++ +      Q +  
Sbjct: 184  VLVMQD-------PSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCC 236

Query: 939  AKEVCDFTQENWSDKCNEAMSIV-FTKYEEIDIYNIYGPRCLLNGSSSATGIRG--VLDL 769
            A+  C+F      +  N  + +        ++IYN+Y P         A G+ G    + 
Sbjct: 237  AQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAP--------CAGGVPGRHRYED 288

Query: 768  ALTNKERTYAYRRM---KRIPGGY----------DPCYSPYA-EEYFNRIDVQKAFHANI 631
             L  ++    + R+   +R P              PC +  A   Y N   V+KA H   
Sbjct: 289  TLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALH--- 345

Query: 630  RAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDADGRVPVIGSRY 454
              P S   W  C+  V   Y+    S+   Y KL+     +I +Y+GD D     +G  +
Sbjct: 346  -IPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEW 404

Query: 453  CIEALKLPLKSPWRSWFHNH-----QVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALAL 289
             +++L   ++   R W  ++     QV G + E   +TF+T++GAGH+VP +KP  A  +
Sbjct: 405  FVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTM 464

Query: 288  IHSFLSGE 265
               FL+ E
Sbjct: 465  FSRFLNKE 472



>sp|P52717|YUW5_CAEEL Putative serine carboxypeptidase F41C3.5
            precursor (EC 3.4.16.-).>pir|T16316|T16316 probable
            serine carboxypeptidase (EC 3.4.16.-) F41C3.5 precursor -
            Caenorhabditis elegans>gb:U23521_1402381 Caenorhabditis
            elegans cosmid F41C3, complete sequence.
          Length = 469

 Score =  218 bits (556), Expect = 2e-55
 Identities = 149/495 (30%), Positives = 229/495 (46%), Gaps = 26/495 (5%)
 Frame = -2

Query: 1665 RTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALF 1486
            +T LL+ F V  V C E           +I  LPG    P   H+SG+  V+ +H   L 
Sbjct: 2    KTLLLLAFFV-GVTCGE-----------EIKDLPGLDFEPNFKHYSGFFQVSDNH--VLH 47

Query: 1485 YWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEAN 1306
            YWF E+++ PSN PL+ W NGGPGCSS+  G   E+GP     +G  L  N+YSWNK A+
Sbjct: 48   YWFVESQNEPSNDPLIFWFNGGPGCSSLD-GLLNEMGPYVANEDGKTLRENEYSWNKMAS 106

Query: 1305 LLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYA 1126
            ++++ESP GVG+SY           D   + + Y  +  +   FPQF+ H  FI GESY 
Sbjct: 107  VVYIESPAGVGYSY--ATDGNITTNDDLTSLENYEAVKQFFTEFPQFRHHQTFIMGESYG 164

Query: 1125 GHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQY 946
            G YVP L   + D  +D   +P INLKG  +GN   N+  +    + +A+ H +I ++ +
Sbjct: 165  GVYVPTLTARIVDGQKD---FP-INLKGMALGNGYVNEKLNIDTSVRFAYGHGLIDEKIW 220

Query: 945  DKAK--------EVCDFTQENWSDKCNEAMSIVFT-----KYEEIDIYNIYGPRCLLNGS 805
            +  +        + CD TQ   +  C   +  +F           D+Y    P   +N  
Sbjct: 221  NTLERDCCRGCIDSCDLTQV--TGHCATLVEDIFQFLWFGGLNPYDLYRDCDPNPSVNSK 278

Query: 804  SSATGIRGV------LDLALTNKERTYAYRRMKRIPGGYDPCYS--PYAEE-----YFNR 664
                 +RGV       D  L N+ +T  Y+ +K       P  +  P   +     Y N 
Sbjct: 279  RMKHMLRGVAPAMAHFDELLKNQTKTSLYQFLKNKSQSQKPLKADVPCLNDTEMLSYMNN 338

Query: 663  IDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDAD 484
              V+KA H     P +   W  CSD V   Y+     + P  +K++K  +++ +Y GD D
Sbjct: 339  PKVRKAIH----IPFNLGKWDICSDKVTTTYQKQYTDMTPFIKKIVKNHVRVLLYYGDTD 394

Query: 483  GRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPS 304
                 +  +   + L L        W ++ Q+ G    + GL+F+T+RGAGH+ P  +  
Sbjct: 395  MACNFMMGQQFSDQLGLRRTLKKTPWKYDRQIAGFKTLFDGLSFITIRGAGHMAPQWRAP 454

Query: 303  EALALIHSFLSGEEL 259
            +    +  FL+   L
Sbjct: 455  QMYYAVQQFLNNHPL 469



>sp|P52715|YUA6_CAEEL Putative serine carboxypeptidase F13S12.6
            precursor (EC 3.4.16.-).>pir|T20829|T20829 probable
            serine carboxypeptidase (EC 3.4.16.-) F13D12.6 precursor
            - Caenorhabditis elegans>gb:CEF13D12_1362338
            Caenorhabditis elegans cosmid F13D12, complete sequence.
          Length = 454

 Score =  214 bits (545), Expect = 4e-54
 Identities = 152/483 (31%), Positives = 221/483 (45%), Gaps = 18/483 (3%)
 Frame = -2

Query: 1668 NRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRAL 1489
            +RT +LV  L    +C          ES  I  LPG P +     +SGY  V       L
Sbjct: 4    SRTLVLVALLGFAYVC----------ESALITNLPGAPISNF-KQYSGYYNVGTKKNHML 52

Query: 1488 FYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEA 1309
             YWF E++S+PS  P++LWL GGPGCS +      E GP  V  +G  L  N YSWNK A
Sbjct: 53   HYWFVESQSNPSTDPVLLWLTGGPGCSGLS-ALLTEWGPWNVNTDGATLRTNPYSWNKNA 111

Query: 1308 NLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESY 1129
            ++L +E+P GVG+SY               A + +  LV +   FPQ+KG+DF++ GESY
Sbjct: 112  SILTLEAPAGVGYSYATDNNIATGDDQ--TASENWEALVAFFNEFPQYKGNDFYVTGESY 169

Query: 1128 AGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQ 949
             G YVP L + + DR         IN+KG  +GN   +       L+ + + H ++   +
Sbjct: 170  GGIYVPTLVQTILDRQSQ----SHINIKGLAIGNGCVSANEGVDSLVNFLYHHGVVDQAK 225

Query: 948  YDKAKEVCDFTQENWSDKCNEAMSIVFTKYEE-------------IDIYNIYGPRCLLNG 808
            ++  K  C     N +D C       F+   E             ++ YN+Y   C+   
Sbjct: 226  WEHMKTSC---CHNDTDACPWHSFSEFSACGEFVEATQQTAWNGGLNPYNMYAD-CISTS 281

Query: 807  SSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY--SPYAEEYFNRIDVQKAFHAN 634
            +S   G+           ER +  +    + G   PC   SP    Y NR DV+KA    
Sbjct: 282  ASFRFGM---------EYERRFNKKYTPEVLGTV-PCLDESP-VTNYLNRQDVRKA---- 326

Query: 633  IRAPGSTVNWKTCSDPVFRAYKYTTFSLLP-VYEKLIKGGLKIWIYSGDADGRVPVIGSR 457
            +  P S   W  CS+ +   YK     +   V   +    LK+ +Y+GD D     +  +
Sbjct: 327  LGIPSSLPAWSICSNAISYGYKRQYGDMTSRVLNAVNNNNLKMMLYNGDVDLACNALMGQ 386

Query: 456  YCIEALKLPLKSPWRSWFHNHQVGGRIVEYHG--LTFVTVRGAGHLVPLNKPSEALALIH 283
               + L L L      +    Q+GG + +Y G  +TF TVRGAGH+VP +KP+ A  +I 
Sbjct: 387  RFTDKLGLTLSKKKTHFTVKGQIGGYVTQYKGSQVTFATVRGAGHMVPTDKPAVAEHIIQ 446

Query: 282  SFL 274
            SFL
Sbjct: 447  SFL 449



>pir|A31589|A31589 carboxypeptidase C (EC 3.4.16.5) precursor -
            human>gb:HUMPPR_2035836 Human protective protein mRNA,
            complete cds.
          Length = 480

 Score =  213 bits (541), Expect = 1e-53
 Identities = 154/496 (31%), Positives = 242/496 (48%), Gaps = 24/496 (4%)
 Frame = -2

Query: 1686 VEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            +  APP    LL   L++ +L + +S  +AA + D+I  LPG    P    +SGY+    
Sbjct: 2    IRAAPPPLFLLL---LLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYL--KS 56

Query: 1506 SHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKY 1327
            S  + L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  V+ +GV L +N Y
Sbjct: 57   SGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLVQPDGVTLEYNPY 115

Query: 1326 SWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFF 1147
            SWN  AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F
Sbjct: 116  SWNLIANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLF 173

Query: 1146 IAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHA 967
            + GESYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H 
Sbjct: 174  LTGESYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG 226

Query: 966  IISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI---------DIYNIYGPRCLL 814
            ++ ++ +   +  C  +Q   +   N+ +  V T  +E+         +IYN+Y P    
Sbjct: 227  LLGNRLWSSLQTHC-CSQNKCNFYDNKDLECV-TNLQEVARIVGNSGLNIYNLYAPCAGG 284

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRM--KRIPGGYD------PC-YSPYAEEYFNRI 661
              S        V+   L N       +RM  + +    D      PC  +  A  Y N  
Sbjct: 285  VPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNP 344

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDAD 484
             V+KA    +  P     W  C+  V   Y+    S+   Y KL+     +I +Y+GD D
Sbjct: 345  YVRKA----LNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVD 400

Query: 483  GRVPVIGSRYCIEALKLPLKSPWRSWF-----HNHQVGGRIVEYHGLTFVTVRGAGHLVP 319
                 +G  + +++L   ++   R W         Q+ G + E+  + F+T++GAGH+VP
Sbjct: 401  MACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVP 460

Query: 318  LNKPSEALALIHSFLS 271
             +KP  A  +   FL+
Sbjct: 461  TDKPLAAFTMFSRFLN 476



>gb:HS337O18_1998140 Human DNA sequence from clone RP3-337O18 on
            chromosome 20q12-13.1 Contains the PLPT gene for
            phospholipid transfer protein, the PPGB gene for
            protective protein for beta-galactosidase
            (galactosialidosis), the PTE1 gene for peroxisomal
            acyl-CoA thioesterase, the C20orf161 gene, the C20orf162
            gene, the C20orf163, the C20orf164 gene, the C20orf165
            gene, the 5' end of an variant of the TNNC2 gene for fast
            troponin C2 and three CpG islands, complete sequence.
          Length = 498

 Score =  212 bits (539), Expect = 2e-53
 Identities = 154/496 (31%), Positives = 242/496 (48%), Gaps = 24/496 (4%)
 Frame = -2

Query: 1686 VEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            +  APP    LL   L++ +L + +S  +AA + D+I  LPG    P    +SGY+    
Sbjct: 20   IRAAPPPLFLLL---LLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYL--KG 74

Query: 1506 SHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKY 1327
            S  + L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  V+ +GV L +N Y
Sbjct: 75   SGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLVQPDGVTLEYNPY 133

Query: 1326 SWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFF 1147
            SWN  AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F
Sbjct: 134  SWNLIANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLF 191

Query: 1146 IAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHA 967
            + GESYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H 
Sbjct: 192  LTGESYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG 244

Query: 966  IISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI---------DIYNIYGPRCLL 814
            ++ ++ +   +  C  +Q   +   N+ +  V T  +E+         +IYN+Y P    
Sbjct: 245  LLGNRLWSSLQTHC-CSQNKCNFYDNKDLECV-TNLQEVARIVGNSGLNIYNLYAPCAGG 302

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRM--KRIPGGYD------PC-YSPYAEEYFNRI 661
              S        V+   L N       +RM  + +    D      PC  +  A  Y N  
Sbjct: 303  VPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNP 362

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDAD 484
             V+KA    +  P     W  C+  V   Y+    S+   Y KL+     +I +Y+GD D
Sbjct: 363  YVRKA----LNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVD 418

Query: 483  GRVPVIGSRYCIEALKLPLKSPWRSWF-----HNHQVGGRIVEYHGLTFVTVRGAGHLVP 319
                 +G  + +++L   ++   R W         Q+ G + E+  + F+T++GAGH+VP
Sbjct: 419  MACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVP 478

Query: 318  LNKPSEALALIHSFLS 271
             +KP  A  +   FL+
Sbjct: 479  TDKPLAAFTMFSRFLN 494



>gb:HS337O18_1998139 Human DNA sequence from clone RP3-337O18 on
            chromosome 20q12-13.1 Contains the PLPT gene for
            phospholipid transfer protein, the PPGB gene for
            protective protein for beta-galactosidase
            (galactosialidosis), the PTE1 gene for peroxisomal
            acyl-CoA thioesterase, the C20orf161 gene, the C20orf162
            gene, the C20orf163, the C20orf164 gene, the C20orf165
            gene, the 5' end of an variant of the TNNC2 gene for fast
            troponin C2 and three CpG islands, complete sequence.
          Length = 548

 Score =  212 bits (539), Expect = 2e-53
 Identities = 154/496 (31%), Positives = 242/496 (48%), Gaps = 24/496 (4%)
 Frame = -2

Query: 1686 VEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            +  APP    LL   L++ +L + +S  +AA + D+I  LPG    P    +SGY+    
Sbjct: 70   IRAAPPPLFLLL---LLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYL--KG 124

Query: 1506 SHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKY 1327
            S  + L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  V+ +GV L +N Y
Sbjct: 125  SGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLVQPDGVTLEYNPY 183

Query: 1326 SWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFF 1147
            SWN  AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F
Sbjct: 184  SWNLIANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLF 241

Query: 1146 IAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHA 967
            + GESYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H 
Sbjct: 242  LTGESYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG 294

Query: 966  IISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI---------DIYNIYGPRCLL 814
            ++ ++ +   +  C  +Q   +   N+ +  V T  +E+         +IYN+Y P    
Sbjct: 295  LLGNRLWSSLQTHC-CSQNKCNFYDNKDLECV-TNLQEVARIVGNSGLNIYNLYAPCAGG 352

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRM--KRIPGGYD------PC-YSPYAEEYFNRI 661
              S        V+   L N       +RM  + +    D      PC  +  A  Y N  
Sbjct: 353  VPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNP 412

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDAD 484
             V+KA    +  P     W  C+  V   Y+    S+   Y KL+     +I +Y+GD D
Sbjct: 413  YVRKA----LNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVD 468

Query: 483  GRVPVIGSRYCIEALKLPLKSPWRSWF-----HNHQVGGRIVEYHGLTFVTVRGAGHLVP 319
                 +G  + +++L   ++   R W         Q+ G + E+  + F+T++GAGH+VP
Sbjct: 469  MACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVP 528

Query: 318  LNKPSEALALIHSFLS 271
             +KP  A  +   FL+
Sbjct: 529  TDKPLAAFTMFSRFLN 544



>gb:AF248647_1780666 Lycopersicon pennellii glucose acyltransferase
            (AT) mRNA, complete cds.
          Length = 464

 Score =  212 bits (539), Expect = 2e-53
 Identities = 147/459 (32%), Positives = 221/459 (48%), Gaps = 22/459 (4%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            LPG       T  +GYI+V +     LFY+F +++  P N PL++WL GGPGCS +    
Sbjct: 26   LPGFHGKLPFTLETGYISVGEEEKVQLFYFFVQSERDPRNDPLMIWLTGGPGCSGLS-SF 84

Query: 1389 AAELGPL-----RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDK 1225
              E+GPL         N   L  N YSW K AN++F++ P G G+SY N           
Sbjct: 85   VYEIGPLTFDYANSSGNFPKLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTL 144

Query: 1224 FVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLK 1045
             V   TY+FL  WL   P++  +  ++ G+SY+G +V  L   ++D   + G  PR+N+K
Sbjct: 145  SVTL-TYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVALLTRKIYD-GIEVGDRPRVNIK 202

Query: 1044 GFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSD------KCNEA 883
            G+I GN  T+   D+ G ++YA    +ISD+ Y  AK  C+    N+ D       C   
Sbjct: 203  GYIQGNALTDRSIDFNGRVKYANHMGLISDKIYQSAKANCN---GNYIDVDPNNILCLND 259

Query: 882  MSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYD 703
            +  V    + I    I  P C L        + G+L    TN +  +        P   +
Sbjct: 260  LQKVTRCLKNIRRAQILEPYCDL------PYLMGILQETPTNGQSVFPIAG----PWCRE 309

Query: 702  PCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVF-------RAYKYTTFSLLP 544
              Y  Y+  + N   VQKA   N+R  G+T+ W  C++ +         +Y Y   S++ 
Sbjct: 310  KNYI-YSYVWANDKAVQKAL--NVR-EGTTLEWVRCNESMHYRGKERTESYVYDVPSVID 365

Query: 543  VYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY- 367
             ++ L     +  IYSGD D  VP + +   IE LKLP+   W  WF + QV G  V+Y 
Sbjct: 366  DHQHLTSKSCRALIYSGDHDMVVPHLSTEEWIETLKLPIADDWEPWFVDDQVAGYKVKYL 425

Query: 366  ---HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
               + +T+ TV+GAGH  P  KP + L ++  + SG+ L
Sbjct: 426  QNDYEMTYATVKGAGHTAPEYKPEQCLPMVDRWFSGDPL 464



>sp|P10619|PRTP_HUMAN Lysosomal protective protein precursor (EC
            3.4.16.5) (Cathepsin A) (Carboxypeptidase C) (Protective
            protein for beta-galactosidase).>gb:HS337O18_1998141
            Human DNA sequence from clone RP3-337O18 on chromosome
            20q12-13.1 Contains the PLPT gene for phospholipid
            transfer protein, the PPGB gene for protective protein
            for beta-galactosidase (galactosialidosis), the PTE1 gene
            for peroxisomal acyl-CoA thioesterase, the C20orf161
            gene, the C20orf162 gene, the C20orf163, the C20orf164
            gene, the C20orf165 gene, the 5' end of an variant of the
            TNNC2 gene for fast troponin C2 and three CpG islands,
            complete sequence.
          Length = 480

 Score =  212 bits (539), Expect = 2e-53
 Identities = 154/496 (31%), Positives = 242/496 (48%), Gaps = 24/496 (4%)
 Frame = -2

Query: 1686 VEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            +  APP    LL   L++ +L + +S  +AA + D+I  LPG    P    +SGY+    
Sbjct: 2    IRAAPPPLFLLL---LLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYL--KG 56

Query: 1506 SHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKY 1327
            S  + L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  V+ +GV L +N Y
Sbjct: 57   SGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLVQPDGVTLEYNPY 115

Query: 1326 SWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFF 1147
            SWN  AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F
Sbjct: 116  SWNLIANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLF 173

Query: 1146 IAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHA 967
            + GESYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H 
Sbjct: 174  LTGESYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG 226

Query: 966  IISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI---------DIYNIYGPRCLL 814
            ++ ++ +   +  C  +Q   +   N+ +  V T  +E+         +IYN+Y P    
Sbjct: 227  LLGNRLWSSLQTHC-CSQNKCNFYDNKDLECV-TNLQEVARIVGNSGLNIYNLYAPCAGG 284

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRM--KRIPGGYD------PC-YSPYAEEYFNRI 661
              S        V+   L N       +RM  + +    D      PC  +  A  Y N  
Sbjct: 285  VPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNP 344

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDAD 484
             V+KA    +  P     W  C+  V   Y+    S+   Y KL+     +I +Y+GD D
Sbjct: 345  YVRKA----LNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVD 400

Query: 483  GRVPVIGSRYCIEALKLPLKSPWRSWF-----HNHQVGGRIVEYHGLTFVTVRGAGHLVP 319
                 +G  + +++L   ++   R W         Q+ G + E+  + F+T++GAGH+VP
Sbjct: 401  MACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVP 460

Query: 318  LNKPSEALALIHSFLS 271
             +KP  A  +   FL+
Sbjct: 461  TDKPLAAFTMFSRFLN 476



>gb:BC000597_1966866 Homo sapiens protective protein for
            beta-galactosidase (galactosialidosis), mRNA (cDNA clone
            MGC:1994 IMAGE:3346150), complete cds.
          Length = 479

 Score =  211 bits (537), Expect = 4e-53
 Identities = 154/492 (31%), Positives = 238/492 (48%), Gaps = 24/492 (4%)
 Frame = -2

Query: 1674 PPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGR 1495
            PP    LL+  LV W     +S  +AA + D+I  LPG    P    +SGY+    S  +
Sbjct: 7    PPLFLLLLLLLLVSW-----ASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYL--KGSGSK 59

Query: 1494 ALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNK 1315
             L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  V+ +GV L +N YSWN 
Sbjct: 60   HLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLVQPDGVTLEYNPYSWNL 118

Query: 1314 EANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGE 1135
             AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F+ GE
Sbjct: 119  IANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLFLTGE 176

Query: 1134 SYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD 955
            SYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H ++ +
Sbjct: 177  SYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGN 229

Query: 954  QQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI---------DIYNIYGPRCLLNGSS 802
            + +   +  C  +Q   +   N+ +  V T  +E+         +IYN+Y P      S 
Sbjct: 230  RLWSSLQTHC-CSQNKCNFYDNKDLECV-TNLQEVARIVGNSGLNIYNLYAPCAGGVPSH 287

Query: 801  SATGIRGVLDLALTNKERTYAYRRM--KRIPGGYD------PC-YSPYAEEYFNRIDVQK 649
                   V+   L N       +RM  + +    D      PC  +  A  Y N   V+K
Sbjct: 288  FRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRK 347

Query: 648  AFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDADGRVP 472
            A    +  P     W  C+  V   Y+    S+   Y KL+     +I +Y+GD D    
Sbjct: 348  A----LNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACN 403

Query: 471  VIGSRYCIEALKLPLKSPWRSWF-----HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKP 307
             +G  + +++L   ++   R W         Q+ G + E+  + F+T++GAGH+VP +KP
Sbjct: 404  FMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKP 463

Query: 306  SEALALIHSFLS 271
              A  +   FL+
Sbjct: 464  LAAFTMFSRFLN 475



>gb:CR860232_1184319 Pongo pygmaeus mRNA; cDNA DKFZp469O2419 (from
            clone DKFZp469O2419).
          Length = 494

 Score =  210 bits (534), Expect = 8e-53
 Identities = 154/499 (30%), Positives = 239/499 (47%), Gaps = 27/499 (5%)
 Frame = -2

Query: 1686 VEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            +  APP    LL+  LV W     +S  +AA + D+I  LPG    P    +SGY+    
Sbjct: 20   IRAAPPPLFLLLL--LVSW-----ASRGEAASDQDEIQRLPGLAKQPSFRQYSGYL--KG 70

Query: 1506 SHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKY 1327
            S  + L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  V+ +GV L +N Y
Sbjct: 71   SGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLVQPDGVTLEYNPY 129

Query: 1326 SWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFF 1147
            SWN  AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F
Sbjct: 130  SWNLIANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLF 187

Query: 1146 IAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHA 967
            + GESYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H 
Sbjct: 188  LTGESYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG 240

Query: 966  IISDQQYDK------AKEVCDFTQENWSDKCNEAMSIV--FTKYEEIDIYNIYGPRCLLN 811
            ++ ++ +        ++  C+F  +N   +C   +  V        ++IYN+Y P C   
Sbjct: 241  LLGNRLWSSLQTHCCSQNKCNF-YDNKDPECVTNLQEVARIVGNSGLNIYNLYAP-C--- 295

Query: 810  GSSSATGIRGVLDLALTNK----------ERTY--AYRRMKRIPGGYDPC-YSPYAEEYF 670
                 +  R   D  +             +RT+  A  R         PC  +  A  Y 
Sbjct: 296  AGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRTWHQALLRSGDKVRMDPPCTNTTAASTYL 355

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSG 493
            N   V+KA    +  P     W  C+  V   Y+    S+   Y KL+     +I +Y+G
Sbjct: 356  NNPYVRKA----LNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNG 411

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRSWF-----HNHQVGGRIVEYHGLTFVTVRGAGH 328
            D D     +G  + +++L   ++   R W         Q+ G + E+  + F+T++GAGH
Sbjct: 412  DVDMACNFMGDEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGH 471

Query: 327  LVPLNKPSEALALIHSFLS 271
            +VP +KP  A  +   FL+
Sbjct: 472  MVPTDKPLAAFTMFSRFLN 490



>gb:AF061282_1765199 Sorghum bicolor 22 kDa kafirin cluster.
          Length = 362

 Score =  207 bits (528), Expect = 4e-52
 Identities = 117/268 (43%), Positives = 149/268 (55%), Gaps = 7/268 (2%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEA-----KSHPSNKPLV 1438
            + + E D+I  +PGQP+      + GYITV++  GRALFYWF EA     K      PLV
Sbjct: 49   QGSSEDDRILAMPGQPNDVAFDMYGGYITVDEQAGRALFYWFQEADQTAVKDPDDAAPLV 108

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            LWLNGGPGCSSIG GA  ELG  RV ++G  L  N+Y+WNK                   
Sbjct: 109  LWLNGGPGCSSIGGGALEELGAFRVHKDGERLLLNEYAWNK------------------- 149

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                         A D Y FLV W ERFP++K  DF+IAGESY GHYVPQL+++V+ RN 
Sbjct: 150  -------------AHDAYTFLVKWFERFPKYKYRDFYIAGESYGGHYVPQLSQLVYRRN- 195

Query: 1077 DRGI-YPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ-ENW 904
              G+  P IN KGF+VGN  T+D  D  G+ EY W H +ISD+   +  +VC  T   + 
Sbjct: 196  -IGVDKPIINFKGFMVGNGLTDDRTDMIGMFEYWWHHGLISDETLARGLKVCPGTSLIHA 254

Query: 903  SDKCNEAMSIVFTKYEEIDIYNIYGPRC 820
            S +C E   +   +   ID Y+IY P C
Sbjct: 255  SPECKEVWDVATKEQGNIDGYSIYTPPC 282



 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 31/48 (64%), Positives = 37/48 (77%)
 Frame = -2

Query: 393 QVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
           QVGG  +EY GLTFVTVRGAGH VPL++P +AL L   FL GE +PA+
Sbjct: 298 QVGGWSMEYEGLTFVTVRGAGHEVPLHRPEQALFLFKQFLQGEPMPAE 345



>gb:U39852_1403143 Caenorhabditis elegans cosmid K10C2, complete
            sequence.
          Length = 2314

 Score =  204 bits (518), Expect = 6e-51
 Identities = 152/541 (28%), Positives = 243/541 (44%), Gaps = 82/541 (15%)
 Frame = -2

Query: 1650 VGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFE 1471
            +G L +      + S  A++++D +  LPG    P    +SGY+  + S G  L YW  E
Sbjct: 5    LGILCLLGAALAAPSRIASKDTDLVNDLPGLSFTPTFKQYSGYL--DGSQGNHLHYWLVE 62

Query: 1470 AKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVE 1291
            ++++P   P+VLWLNGGPGCSS+  G  +E GP R++++GV +  N  SWNK AN+LF+E
Sbjct: 63   SQTNPQTAPIVLWLNGGPGCSSL-LGLLSENGPYRIQKDGVTVIENVNSWNKAANVLFLE 121

Query: 1290 SPVGVGFSYTNXXXX-XXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYV 1114
            SP  VGFSY            D   A D    LV + +RFP+++G DF+I GESY G YV
Sbjct: 122  SPRDVGFSYREKSATPDLLYNDDKTATDNALALVQFFQRFPEYQGRDFYITGESYGGVYV 181

Query: 1113 PQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAK 934
            P L ++V    ++    P INLKGF VGN   +  +     ++  +   ++   Q++  +
Sbjct: 182  PTLTKLVVQMIQNNTT-PYINLKGFAVGNGALSRKHLTNSGIDLLYYRGMLGTTQWENLR 240

Query: 933  EVCDFTQENWSDKCNEAMSIVFTKYEEI-------------------------------D 847
            + C  T  N    C+ +  +VF  +                                  D
Sbjct: 241  QCCPDTLNNPLVDCDYSKYVVFDNFGNPSPRNDTNDAQAIACGKMVINLSLNSIWETYND 300

Query: 846  IYNIYGP------------------------RCLLNGSSSATGIRGVLDLALTNK----E 751
            +YN Y                          R ++  + S TG     +L         +
Sbjct: 301  VYNSYQDCYNFDSSVFGAAEERHAKVHQQTMRKIMRTTLSTTGANDAYNLFSNGFNPFID 360

Query: 750  RTYAYRRMKRIPGGYDPCYSPYAEE-YFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRA 574
            +   Y +M        PCY   A   +  R DV+ A H    AP     W+ CSD +   
Sbjct: 361  QGSLYNKMSTDALNNYPCYIDDATTAWLGRTDVRSALHIPAAAPV----WQECSDDINAK 416

Query: 573  YKYTTF-SLLPVYEKLIKGG--LKIWIYSGDADGRVPVIGSRYCIEAL-----KLPLKSP 418
            Y    +    PV++ L+  G  LK+ IY+GD D     +G ++ +E L     ++ L +P
Sbjct: 417  YYIQQYPDTTPVFQFLVDSGYPLKVLIYNGDVDLACNYLGDQWFVENLATVSYQMTLTTP 476

Query: 417  WRSWFHNHQ---------VGGRIVEYH----GLTFVTVRGAGHLVPLNKPSEALALIHSF 277
             + W              + G +  ++     +  +TV+GAGH+VP+++P  AL + +++
Sbjct: 477  RQQWNFTRAGTQNKYIPTLAGYLKSWNYQQFSIDLLTVKGAGHMVPMDRPGPALQIFYNY 536

Query: 276  L 274
            L
Sbjct: 537  L 537



 Score =  201 bits (510), Expect = 5e-50
 Identities = 144/492 (29%), Positives = 230/492 (46%), Gaps = 48/492 (9%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +++D++  LPG         +SGY+  N   G  L YWF E++ +P+  PLVLWL GGPG
Sbjct: 572  KQADRVWNLPGITYGLNFKQYSGYL--NGVTGNYLHYWFVESQGNPTTDPLVLWLTGGPG 629

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN-XXXXXXX 1237
            CS +      ELGP     +G  L  N YSWNK AN++F+ESP GVGFS  +        
Sbjct: 630  CSGL-MAMLTELGPFHPNPDGKTLFENVYSWNKAANVIFLESPRGVGFSVQDPSLNNDTI 688

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              D+  A DTY  L ++L  +P++    FF+ GESY G YVP +  ++ D+ +  G + +
Sbjct: 689  WDDQRTATDTYLALKDFLTVYPEYINRPFFVTGESYGGVYVPTITSLLIDKIQS-GDFAQ 747

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ--ENWSDKCNEA 883
            +NL G  +GN E +    +   +  ++ H + S   +D  +  C+ T+    W + CN A
Sbjct: 748  LNLVGMSIGNGELSAIQQFNSAIMMSYFHGLFSKDDFDSLQPCCNQTKTSSQWFEYCNFA 807

Query: 882  M---------------SIVFTKYEEI----------DIYNIYGPRCLLNGSSSATGIRGV 778
                            S    K  ++          D+YNIY  +     +  A G R  
Sbjct: 808  QYIHLGPDGTAIPNDKSFCANKVADLGQQRFWNSLNDVYNIY--QDCYQQADRAFGSR-- 863

Query: 777  LDLALTNKE---RTYAYRRMKRIPGGYD-----PCY-SPYAEEYFNRIDVQKAFHANIRA 625
              +++  K+   R +  +  K      D      CY +  A  + N  DV+ A H +  A
Sbjct: 864  --MSIKQKKEHMRGFIDQGAKISTSSTDNQGGLACYGTTQAANWINLPDVRSALHVSSAA 921

Query: 624  PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI--KGGLKIWIYSGDADGRVPVIGSRYC 451
                  W  C+D +   Y         V++ ++  K  L++ IY+GD D     +G ++ 
Sbjct: 922  GA----WSACNDTINGLYVQQHNDTTSVFQHILDSKYPLRVLIYNGDVDQACNYLGDQWF 977

Query: 450  IEAL----KLPLKSPWRSWFHNHQVGGRIVEY-----HGLTFVTVRGAGHLVPLNKPSEA 298
            IEA     +LP+  P   W +  Q+ G   ++       +  +TV+GAGHLVP ++P  A
Sbjct: 978  IEAFALKNQLPVTKPRADWRYMTQIAGYAKKFDNNAGFSVDLITVKGAGHLVPTDRPGPA 1037

Query: 297  LALIHSFLSGEE 262
            L +I +F   ++
Sbjct: 1038 LQMIANFFRNQD 1049



 Score =  170 bits (430), Expect = 1e-40
 Identities = 141/527 (26%), Positives = 215/527 (40%), Gaps = 82/527 (15%)
 Frame = -2

Query: 1605 PKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLN 1426
            P   +  D++  LPG    P    +SGY+  N S G  L YW  E++ + +  PL+LWLN
Sbjct: 1126 PTQTKAQDEVTNLPGLTFTPNFKQYSGYL--NASAGNYLHYWLVESQLNATYDPLILWLN 1183

Query: 1425 GGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSY-TNXXX 1249
            GGPGCSSIG G   ELGP  V  +G  L  N +SWNK  N+LF+E+P  VG+S+ +N   
Sbjct: 1184 GGPGCSSIG-GFLEELGPFHVNADGKTLFENTFSWNKAGNVLFLEAPRDVGYSFRSNEFA 1242

Query: 1248 XXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRG 1069
                  D + A DT   L ++  +FP+++   F+I GESY G YVP L   + +  +  G
Sbjct: 1243 PDTMYNDTYTASDTVLALASFFNKFPEYQNRPFYITGESYGGIYVPTLTRALINAIQ-TG 1301

Query: 1068 IYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFT-QENWSDKC 892
                +NL G  +GN E +        +   +         +D   + CD +  + + D  
Sbjct: 1302 TIKNVNLVGVAIGNGELSGIQQINSAVSLLYFRGERDKSDWDAISKCCDTSVPQAYCD-- 1359

Query: 891  NEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATG----IRGVLDLALTNKE--------- 751
                   + KY  ID      P+   N  +   G     +G LD+  T+ +         
Sbjct: 1360 -------YIKYVNIDTSGNVWPKVNDNSLAGQCGQLVTQQGFLDVWTTDNDVYNTFADCY 1412

Query: 750  -----------------RTYAYRRMKRIP--------------------------GGYDP 700
                             R    RR KR                            GG+  
Sbjct: 1413 TAPGAGDSKLNELASGIRRVQNRRSKRAADVSPFLPSTLFVDQAKKINYQSTDANGGFTC 1472

Query: 699  CYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG 520
                 +E Y N  +V+ A H     P S   W  C+D +   Y         V+  +   
Sbjct: 1473 FSGASSENYMNLPEVRTALH----IPTSLPYWTDCNDNMNENYIQQHNDTSSVFTDIFAT 1528

Query: 519  G--LKIWIYSGDADGRVPVIGSRYCIEALK---------------------LP-LKSPWR 412
            G  L+  IY+GD D     +G ++ +E L                      LP +   W+
Sbjct: 1529 GYPLRFLIYNGDVDMACQFLGDQWFLEKLAKDNGLAVTRQHGPWNYTQGQFLPRVGGYWK 1588

Query: 411  SWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLS 271
             + + +      V +  L   TV+GAGH VP ++P  AL +I++F++
Sbjct: 1589 QFTYTNTAKNTKVVFDQL---TVKGAGHFVPQDRPGPALQMIYNFVN 1632



 Score =  161 bits (408), Expect = 3e-38
 Identities = 135/500 (27%), Positives = 216/500 (43%), Gaps = 57/500 (11%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +++D I  LPG          SGY+   +  G  LFYWF E++S     P++LWL GGPG
Sbjct: 1663 RKADHIFSLPGVTWNVNFMQHSGYLQATR--GNKLFYWFVESQSGNEGDPIILWLQGGPG 1720

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
            C+S G G  +E+GP  V  +G  L  N YSWNK A++L ++SP GVGFSY +        
Sbjct: 1721 CASTG-GLFSEIGPFFVNPDGETLFENIYSWNKAAHILIIDSPRGVGFSYQDKNVNNDTT 1779

Query: 1233 -XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              D   A DTY  L ++   +P  +  + +I GESY G YVP L  ++    + +     
Sbjct: 1780 WDDDKTALDTYTALEDFFVTYPPHRNSELYITGESYGGVYVPTLTRLLI--QKIQAGQSN 1837

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCN---- 889
            I L+G  +GN   +   D + L ++ + H I     ++K +  C       S  CN    
Sbjct: 1838 IQLRGMGIGNGMVSAVNDVRTLPDFLYFHGIYDKPMWEKLRACCPSADS--SGDCNYDYY 1895

Query: 888  ----EAMSIVFTKYEE-----------------------IDIYNIYGPRCLLNGSSSATG 790
                  ++++  ++                          D YN+Y   C +     A  
Sbjct: 1896 ITIDSGVNVIAKQFPNNQTLQDCANLVENLSYDRNWKALYDQYNLY-QDCYVTPRDQANP 1954

Query: 789  I---RGVLDLALTNKERTYAYRRMKR----------IPGGYDPCYSPYA-EEYFNRIDVQ 652
                     L + +K +T   + + +            GGY  C+S  A   Y +   V+
Sbjct: 1955 FAMKEKFSRLDVDHKLKTSIPQAITKTAPQDPLSTDATGGYS-CWSLGAINNYLSLSHVR 2013

Query: 651  KAFHANIRAPGSTVNWKTCSDPVF-RAYKYTTFSLLPVYEKLIKGG--LKIWIYSGDADG 481
             A H     P S   W  C+   +   Y  TT     V+  ++  G  LK+ IY+GD D 
Sbjct: 2014 DALH----IPDSVPRWGFCNKINYANLYNDTT----QVFTDILNSGYNLKVLIYNGDVDS 2065

Query: 480  RVPVIGSRYCIE----ALKLPLKSPWRSWFHNHQVGGRIVEYH----GLTFVTVRGAGHL 325
               +  +   I     A       P  SW +  Q+GG + ++      +  +TV+GAGH+
Sbjct: 2066 VCSMFEAESMINNFAAAQTFVSNQPRGSWMYGGQIGGYVQKFQKNNMTIDLLTVKGAGHM 2125

Query: 324  VPLNKPSEALALIHSFLSGE 265
             P ++P   L ++++F+ G+
Sbjct: 2126 SPTDRPGPVLQMMNNFVHGQ 2145



>gb:AF006078_1760851 Solanum berthaultii glucose acyltransferase
            (pldp15) mRNA, complete cds.
          Length = 464

 Score =  203 bits (517), Expect = 8e-51
 Identities = 145/456 (31%), Positives = 215/456 (47%), Gaps = 19/456 (4%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            LPG       T  +GYI V +     LFY+F  ++  P N PL++WL GGPGCS +    
Sbjct: 26   LPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCSGLS-SF 84

Query: 1389 AAELGPL-----RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDK 1225
              E+GPL         N   L  N  SW K AN++F++ P G G+SY N           
Sbjct: 85   VYEIGPLTFDYANSNGNFPKLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTL 144

Query: 1224 FVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLK 1045
             V   TY+FL  WL   P++  +  ++ G+SY+G +V  L   ++D   + G  PR+N+K
Sbjct: 145  SVTL-TYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVALLTRKIYD-GIEVGDKPRLNIK 202

Query: 1044 GFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDKCNEAMSI 874
            G+I GN  T+ Y D  G ++YA    +ISD+ Y  AK  C+   F  +  +  C   +  
Sbjct: 203  GYIQGNALTDRYIDSNGRIKYANRMGLISDKIYQSAKTNCNGSYFDVDPHNILCLNDLQK 262

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
            V    + I    I  P C L        +  +L    TN +  +        P   +  Y
Sbjct: 263  VTKCLKNIRRAQILEPYCDL------PYLMDILQETPTNGQSVFPIAG----PWCREKNY 312

Query: 693  SPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVF-------RAYKYTTFSLLPVYE 535
              Y+  + N   VQKA   N+R  G+T+ W  C++ +         +Y Y   S +  + 
Sbjct: 313  I-YSYVWANDKVVQKAL--NVR-EGTTLEWVRCNESMHYRGKERTESYVYDVPSAVGDHR 368

Query: 534  KLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY---- 367
             L     +  IYSGD D  VP + +   I+ LKLP+   W  WF + QV G  V+Y    
Sbjct: 369  HLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKLPIADDWEPWFVDAQVAGYKVKYLQND 428

Query: 366  HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            + LT+ TV+GAGH  P  KP + L ++  + SG+ L
Sbjct: 429  YELTYATVKGAGHTAPEYKPEQCLPMVDRWFSGDPL 464



>gb:AF006080_1760853 Solanum berthaultii glucose acyltransferase
            (pldp15) mRNA, complete cds.
          Length = 461

 Score =  202 bits (513), Expect = 2e-50
 Identities = 142/459 (30%), Positives = 209/459 (45%), Gaps = 22/459 (4%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            LPG       T  +GYI V +     LFY+F  ++  P N PL++WL GGPGCS +    
Sbjct: 26   LPGFHGKLPFTLETGYIGVGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCSGLS-SF 84

Query: 1389 AAELGPL-----RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDK 1225
              E+GPL         N   L  N  SW K AN++F++ P G G+SY N           
Sbjct: 85   VYEIGPLTFDYANSNGNFPKLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTL 144

Query: 1224 FVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLK 1045
             V   TY+FL  WL   P++  +  ++ G+SY+G +V  L   ++D   + G  PR+N+K
Sbjct: 145  SVTL-TYDFLRKWLMDHPEYLNNPLYVGGDSYSGIFVAPLTRKIYD-GIEVGDKPRLNIK 202

Query: 1044 GFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDKCNEAMSI 874
            G+I GN  T+ Y D  G ++YA    +ISD+ Y  AK  C+   F  +  +  C   +  
Sbjct: 203  GYIQGNALTDRYIDSNGRIKYANRMGLISDKIYQSAKTNCNGSYFDVDPHNILCLNDLQK 262

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTN---KERTYAYRRMKRIPGGYD 703
            V        I   Y     L      T   G     +     +E+ Y Y  +        
Sbjct: 263  VTKNIRRAQILEPYCDLPYLMDILQETPTNGQSVFPIAGPWCREKNYIYSYV-------- 314

Query: 702  PCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVF-------RAYKYTTFSLLP 544
                     + N   VQKA   N+R  G+T+ W  C++ +         +Y Y   S + 
Sbjct: 315  ---------WANDKVVQKAL--NVR-EGTTLEWVRCNESMHYRGKERTESYVYDVPSAVG 362

Query: 543  VYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY- 367
             +  L     +  IYSGD D  VP + +   I+ LKLP+   W  WF + QV G  V+Y 
Sbjct: 363  DHRHLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKLPIADDWEPWFVDAQVAGYKVKYL 422

Query: 366  ---HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
               + LT+ TV+GAGH  P  KP + L ++  + SG+ L
Sbjct: 423  QNDYELTYATVKGAGHTAPQYKPEQCLPMVDRWFSGDPL 461



>gb:BLYCBX_1633132 H.vulgare (barley) carboxypeptidase I mRNA, 3' end.
          Length = 412

 Score =  201 bits (511), Expect = 4e-50
 Identities = 140/421 (33%), Positives = 208/421 (49%), Gaps = 32/421 (7%)
 Frame = -2

Query: 1425 GGPGCSSIGYGAAAELGPLRVKRNGV-----GLHFNKYSWNKEANLLFVESPVGVGFSYT 1261
            GGPGCSS   G   E GP   +  G       LH N Y+W+K + +++++SP GVG SY+
Sbjct: 1    GGPGCSSFD-GFVYEHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDSPAGVGLSYS 59

Query: 1260 NXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRN 1081
                       K  A D++ FL+ W + +P+F  + F+IAGESYAG YVP L+  V  + 
Sbjct: 60   KNVSDYETGDLK-TATDSHTFLLKWFQLYPEFLSNPFYIAGESYAGVYVPTLSHEVV-KG 117

Query: 1080 RDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWS 901
               G  P IN KG++VGN   +  +D   L+ +A    +ISD+ Y +A   C     N +
Sbjct: 118  IQGGAKPTINFKGYMVGNGVCDTIFDGNALVPFAHGMGLISDEIYQQASTSCHGNYWNAT 177

Query: 900  D-KCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGI------RGVLDLALTNKE--- 751
            D KC+ A+S + +    ++IY+I  P C  + S     +      +   DL  TNK    
Sbjct: 178  DGKCDTAISKIESLISGLNIYDILEP-CYHSRSIKEVNLQNSKLPQSFKDLGTTNKPFPV 236

Query: 750  ------RTYAYR---RMKRIPGGYD-----PCYS-PYAEEYFNRIDVQKAFHA-NIRAPG 619
                  R +  R   +  R+P   +     PC S   A  + +   V+ A HA ++ A G
Sbjct: 237  RTRMLGRAWPLRAPVKAGRVPSWQEVASGVPCMSDEVATAWLDNAAVRSAIHAQSVSAIG 296

Query: 618  STVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL 439
                W  C+D ++  + +   S++  ++ L   G +  I+SGD D  VP  GS    ++L
Sbjct: 297  P---WLLCTDKLY--FVHDAGSMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKSL 351

Query: 438  KLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEE 262
               +   WR W  N QV G    Y HGLTF T++GAGH VP  KP EA A    +L+G +
Sbjct: 352  GYGVVDSWRPWITNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEAFAFYSRWLAGSK 411

Query: 261  L 259
            L
Sbjct: 412  L 412



>pir|T25810|T25810 hypothetical protein K10C2.1 - Caenorhabditis
            elegans
          Length = 2338

 Score =  201 bits (510), Expect = 5e-50
 Identities = 144/492 (29%), Positives = 230/492 (46%), Gaps = 48/492 (9%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +++D++  LPG         +SGY+  N   G  L YWF E++ +P+  PLVLWL GGPG
Sbjct: 596  KQADRVWNLPGITYGLNFKQYSGYL--NGVTGNYLHYWFVESQGNPTTDPLVLWLTGGPG 653

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN-XXXXXXX 1237
            CS +      ELGP     +G  L  N YSWNK AN++F+ESP GVGFS  +        
Sbjct: 654  CSGL-MAMLTELGPFHPNPDGKTLFENVYSWNKAANVIFLESPRGVGFSVQDPSLNNDTI 712

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              D+  A DTY  L ++L  +P++    FF+ GESY G YVP +  ++ D+ +  G + +
Sbjct: 713  WDDQRTATDTYLALKDFLTVYPEYINRPFFVTGESYGGVYVPTITSLLIDKIQS-GDFAQ 771

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ--ENWSDKCNEA 883
            +NL G  +GN E +    +   +  ++ H + S   +D  +  C+ T+    W + CN A
Sbjct: 772  LNLVGMSIGNGELSAIQQFNSAIMMSYFHGLFSKDDFDSLQPCCNQTKTSSQWFEYCNFA 831

Query: 882  M---------------SIVFTKYEEI----------DIYNIYGPRCLLNGSSSATGIRGV 778
                            S    K  ++          D+YNIY  +     +  A G R  
Sbjct: 832  QYIHLGPDGTAIPNDKSFCANKVADLGQQRFWNSLNDVYNIY--QDCYQQADRAFGSR-- 887

Query: 777  LDLALTNKE---RTYAYRRMKRIPGGYD-----PCY-SPYAEEYFNRIDVQKAFHANIRA 625
              +++  K+   R +  +  K      D      CY +  A  + N  DV+ A H +  A
Sbjct: 888  --MSIKQKKEHMRGFIDQGAKISTSSTDNQGGLACYGTTQAANWINLPDVRSALHVSSAA 945

Query: 624  PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI--KGGLKIWIYSGDADGRVPVIGSRYC 451
                  W  C+D +   Y         V++ ++  K  L++ IY+GD D     +G ++ 
Sbjct: 946  GA----WSACNDTINGLYVQQHNDTTSVFQHILDSKYPLRVLIYNGDVDQACNYLGDQWF 1001

Query: 450  IEAL----KLPLKSPWRSWFHNHQVGGRIVEY-----HGLTFVTVRGAGHLVPLNKPSEA 298
            IEA     +LP+  P   W +  Q+ G   ++       +  +TV+GAGHLVP ++P  A
Sbjct: 1002 IEAFALKNQLPVTKPRADWRYMTQIAGYAKKFDNNAGFSVDLITVKGAGHLVPTDRPGPA 1061

Query: 297  LALIHSFLSGEE 262
            L +I +F   ++
Sbjct: 1062 LQMIANFFRNQD 1073



 Score =  188 bits (477), Expect = 3e-46
 Identities = 152/565 (26%), Positives = 243/565 (43%), Gaps = 106/565 (18%)
 Frame = -2

Query: 1650 VGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFF- 1474
            +G L +      + S  A++++D +  LPG    P    +SGY+  + S G  L Y F  
Sbjct: 5    LGILCLLGAALAAPSRIASKDTDLVNDLPGLSFTPTFKQYSGYL--DGSQGNHLHYCFLA 62

Query: 1473 -----------------------EAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRV 1363
                                   E++++P   P+VLWLNGGPGCSS+  G  +E GP R+
Sbjct: 63   FILHLILFWTVSKYTIPMDTKLVESQTNPQTAPIVLWLNGGPGCSSL-LGLLSENGPYRI 121

Query: 1362 KRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXX-XXXXXDKFVAQDTYNFLVNW 1186
            +++GV +  N  SWNK AN+LF+ESP  VGFSY            D   A D    LV +
Sbjct: 122  QKDGVTVIENVNSWNKAANVLFLESPRDVGFSYREKSATPDLLYNDDKTATDNALALVQF 181

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
             +RFP+++G DF+I GESY G YVP L ++V    ++    P INLKGF VGN   +  +
Sbjct: 182  FQRFPEYQGRDFYITGESYGGVYVPTLTKLVVQMIQNNTT-PYINLKGFAVGNGALSRKH 240

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI-------- 850
                 ++  +   ++   Q++  ++ C  T  N    C+ +  +VF  +           
Sbjct: 241  LTNSGIDLLYYRGMLGTTQWENLRQCCPDTLNNPLVDCDYSKYVVFDNFGNPSPRNDTND 300

Query: 849  -----------------------DIYNIYGP------------------------RCLLN 811
                                   D+YN Y                          R ++ 
Sbjct: 301  AQAIACGKMVINLSLNSIWETYNDVYNSYQDCYNFDSSVFGAAEERHAKVHQQTMRKIMR 360

Query: 810  GSSSATGIRGVLDLALTNK----ERTYAYRRMKRIPGGYDPCYSPYAEE-YFNRIDVQKA 646
             + S TG     +L         ++   Y +M        PCY   A   +  R DV+ A
Sbjct: 361  TTLSTTGANDAYNLFSNGFNPFIDQGSLYNKMSTDALNNYPCYIDDATTAWLGRTDVRSA 420

Query: 645  FHANIRAPGSTVNWKTCSDPVFRAYKYTTF-SLLPVYEKLIKGG--LKIWIYSGDADGRV 475
             H    AP     W+ CSD +   Y    +    PV++ L+  G  LK+ IY+GD D   
Sbjct: 421  LHIPAAAPV----WQECSDDINAKYYIQQYPDTTPVFQFLVDSGYPLKVLIYNGDVDLAC 476

Query: 474  PVIGSRYCIEAL-----KLPLKSPWRSWFHNHQ---------VGGRIVEYH----GLTFV 349
              +G ++ +E L     ++ L +P + W              + G +  ++     +  +
Sbjct: 477  NYLGDQWFVENLATVSYQMTLTTPRQQWNFTRAGTQNKYIPTLAGYLKSWNYQQFSIDLL 536

Query: 348  TVRGAGHLVPLNKPSEALALIHSFL 274
            TV+GAGH+VP+++P  AL + +++L
Sbjct: 537  TVKGAGHMVPMDRPGPALQIFYNYL 561



 Score =  170 bits (430), Expect = 1e-40
 Identities = 141/527 (26%), Positives = 215/527 (40%), Gaps = 82/527 (15%)
 Frame = -2

Query: 1605 PKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLN 1426
            P   +  D++  LPG    P    +SGY+  N S G  L YW  E++ + +  PL+LWLN
Sbjct: 1150 PTQTKAQDEVTNLPGLTFTPNFKQYSGYL--NASAGNYLHYWLVESQLNATYDPLILWLN 1207

Query: 1425 GGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSY-TNXXX 1249
            GGPGCSSIG G   ELGP  V  +G  L  N +SWNK  N+LF+E+P  VG+S+ +N   
Sbjct: 1208 GGPGCSSIG-GFLEELGPFHVNADGKTLFENTFSWNKAGNVLFLEAPRDVGYSFRSNEFA 1266

Query: 1248 XXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRG 1069
                  D + A DT   L ++  +FP+++   F+I GESY G YVP L   + +  +  G
Sbjct: 1267 PDTMYNDTYTASDTVLALASFFNKFPEYQNRPFYITGESYGGIYVPTLTRALINAIQ-TG 1325

Query: 1068 IYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFT-QENWSDKC 892
                +NL G  +GN E +        +   +         +D   + CD +  + + D  
Sbjct: 1326 TIKNVNLVGVAIGNGELSGIQQINSAVSLLYFRGERDKSDWDAISKCCDTSVPQAYCD-- 1383

Query: 891  NEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATG----IRGVLDLALTNKE--------- 751
                   + KY  ID      P+   N  +   G     +G LD+  T+ +         
Sbjct: 1384 -------YIKYVNIDTSGNVWPKVNDNSLAGQCGQLVTQQGFLDVWTTDNDVYNTFADCY 1436

Query: 750  -----------------RTYAYRRMKRIP--------------------------GGYDP 700
                             R    RR KR                            GG+  
Sbjct: 1437 TAPGAGDSKLNELASGIRRVQNRRSKRAADVSPFLPSTLFVDQAKKINYQSTDANGGFTC 1496

Query: 699  CYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG 520
                 +E Y N  +V+ A H     P S   W  C+D +   Y         V+  +   
Sbjct: 1497 FSGASSENYMNLPEVRTALH----IPTSLPYWTDCNDNMNENYIQQHNDTSSVFTDIFAT 1552

Query: 519  G--LKIWIYSGDADGRVPVIGSRYCIEALK---------------------LP-LKSPWR 412
            G  L+  IY+GD D     +G ++ +E L                      LP +   W+
Sbjct: 1553 GYPLRFLIYNGDVDMACQFLGDQWFLEKLAKDNGLAVTRQHGPWNYTQGQFLPRVGGYWK 1612

Query: 411  SWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLS 271
             + + +      V +  L   TV+GAGH VP ++P  AL +I++F++
Sbjct: 1613 QFTYTNTAKNTKVVFDQL---TVKGAGHFVPQDRPGPALQMIYNFVN 1656



 Score =  161 bits (408), Expect = 3e-38
 Identities = 135/500 (27%), Positives = 216/500 (43%), Gaps = 57/500 (11%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +++D I  LPG          SGY+   +  G  LFYWF E++S     P++LWL GGPG
Sbjct: 1687 RKADHIFSLPGVTWNVNFMQHSGYLQATR--GNKLFYWFVESQSGNEGDPIILWLQGGPG 1744

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
            C+S G G  +E+GP  V  +G  L  N YSWNK A++L ++SP GVGFSY +        
Sbjct: 1745 CASTG-GLFSEIGPFFVNPDGETLFENIYSWNKAAHILIIDSPRGVGFSYQDKNVNNDTT 1803

Query: 1233 -XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              D   A DTY  L ++   +P  +  + +I GESY G YVP L  ++    + +     
Sbjct: 1804 WDDDKTALDTYTALEDFFVTYPPHRNSELYITGESYGGVYVPTLTRLLI--QKIQAGQSN 1861

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCN---- 889
            I L+G  +GN   +   D + L ++ + H I     ++K +  C       S  CN    
Sbjct: 1862 IQLRGMGIGNGMVSAVNDVRTLPDFLYFHGIYDKPMWEKLRACCPSADS--SGDCNYDYY 1919

Query: 888  ----EAMSIVFTKYEE-----------------------IDIYNIYGPRCLLNGSSSATG 790
                  ++++  ++                          D YN+Y   C +     A  
Sbjct: 1920 ITIDSGVNVIAKQFPNNQTLQDCANLVENLSYDRNWKALYDQYNLY-QDCYVTPRDQANP 1978

Query: 789  I---RGVLDLALTNKERTYAYRRMKR----------IPGGYDPCYSPYA-EEYFNRIDVQ 652
                     L + +K +T   + + +            GGY  C+S  A   Y +   V+
Sbjct: 1979 FAMKEKFSRLDVDHKLKTSIPQAITKTAPQDPLSTDATGGYS-CWSLGAINNYLSLSHVR 2037

Query: 651  KAFHANIRAPGSTVNWKTCSDPVF-RAYKYTTFSLLPVYEKLIKGG--LKIWIYSGDADG 481
             A H     P S   W  C+   +   Y  TT     V+  ++  G  LK+ IY+GD D 
Sbjct: 2038 DALH----IPDSVPRWGFCNKINYANLYNDTT----QVFTDILNSGYNLKVLIYNGDVDS 2089

Query: 480  RVPVIGSRYCIE----ALKLPLKSPWRSWFHNHQVGGRIVEYH----GLTFVTVRGAGHL 325
               +  +   I     A       P  SW +  Q+GG + ++      +  +TV+GAGH+
Sbjct: 2090 VCSMFEAESMINNFAAAQTFVSNQPRGSWMYGGQIGGYVQKFQKNNMTIDLLTVKGAGHM 2149

Query: 324  VPLNKPSEALALIHSFLSGE 265
             P ++P   L ++++F+ G+
Sbjct: 2150 SPTDRPGPVLQMMNNFVHGQ 2169



>gb:OSJN00121_1695240 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0051N19, complete sequence.
          Length = 467

 Score =  199 bits (507), Expect = 1e-49
 Identities = 144/485 (29%), Positives = 226/485 (46%), Gaps = 24/485 (4%)
 Frame = -2

Query: 1641 LVIWVLCAESS------SPKAAQESDK-IGYLPGQPSAPLLTHFSGYITVNQSHGRALFY 1483
            L++ +LC+ SS      SP A   S K +  LPG       +  +GY+ V ++     FY
Sbjct: 11   LLLLLLCSCSSAAVAAASPAAMSSSRKAVDRLPGFAGPLPFSLETGYVAVGEAR---FFY 67

Query: 1482 WFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNG-----VGLHFNKYSWN 1318
            +F E++  P   P++LWL GGPGCS+   G   E+GPL    +G       LH+   SW 
Sbjct: 68   YFIESERSPEEDPVLLWLTGGPGCSAFS-GLIYEIGPLFFDFHGHKGGLPTLHYKANSWT 126

Query: 1317 KEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAG 1138
            K +N++FV+SP G GF+Y              V    Y F+  W +  PQF  +  +++G
Sbjct: 127  KISNVIFVDSPPGTGFTYATTAEGLKSSDT-IVVHQLYTFIQKWFDDHPQFSSNPLYVSG 185

Query: 1137 ESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIIS 958
            +SY+G  +P L  +   + ++      +NLKG+I GNP T+  +D      +  S  II 
Sbjct: 186  DSYSGIIIPTLT-MEIAKGKESSDERHLNLKGYIAGNPLTDTTHDDNSKFPFLHSLGIID 244

Query: 957  DQQYDKAKEVCD---FTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGI 787
            D+ Y+ A++ C     T  N   +C  ++  +     +++  +I  PRC  +G S     
Sbjct: 245  DELYEVARKNCKGDYMTPPN--SQCANSVQAIRDCIRDVNDLHILEPRCEEDGIS----- 297

Query: 786  RGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRA------ 625
                   +++   +   RR K +        S  +    N   V     AN  A      
Sbjct: 298  ------LMSDNSASSHDRRTKLLE-------SAVSSICRNATYVLSKIWANDEAVRESLG 344

Query: 624  --PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYC 451
               G+   W+ C+  +   YK    S +  +  LI  G +  +YSGD D  V +IG++  
Sbjct: 345  IHKGTVTTWERCNHDLL--YKKQIVSSVEYHLSLITQGYRGLVYSGDHDSVVSLIGTQGW 402

Query: 450  IEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFL 274
            + +L L +   WR W+ N QV G    Y + LT+ TV+GAGH  P   P E LA++  +L
Sbjct: 403  LRSLNLSITHGWRPWYVNSQVVGFTRTYSNNLTYATVKGAGHTAPEYMPKECLAMVDRWL 462

Query: 273  SGEEL 259
            SGE L
Sbjct: 463  SGEPL 467



>pir|T33463|T33463 probable serine carboxypeptidase (EC 3.4.16.-)
            Y40D12A.2 precursor - Caenorhabditis
            elegans>gb:AF078792_1239451 Caenorhabditis elegans cosmid
            Y40D12A, complete sequence.
          Length = 512

 Score =  195 bits (496), Expect = 2e-48
 Identities = 135/475 (28%), Positives = 224/475 (47%), Gaps = 34/475 (7%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A    +I  LP         H++GY+++  S  + LFYW+ E++  P   P+VLWLNGGP
Sbjct: 16   APADQQITSLPNLTEPLRSKHYAGYLSI--SDVKQLFYWYVESEESPETAPVVLWLNGGP 73

Query: 1416 GCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXX 1237
            GC+S+  G   E+GP RV+  G  ++ N ++WN+ AN++++++P GVGFSY N       
Sbjct: 74   GCASME-GLFIEMGPFRVRNYGEEVNRNPWTWNRIANIIYLDAPAGVGFSYYNTTKKVFT 132

Query: 1236 XXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPR 1057
              +  VAQD +N L  W  RFP+ K +DF+IAGESY G YVP L+  +   N D   +P+
Sbjct: 133  DDE--VAQDNFNALKMWFARFPERKTNDFYIAGESYGGTYVPMLSARITKANVD---FPQ 187

Query: 1056 INLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC--------DFTQENWS 901
               KG +VGN   +D  ++   + Y + HA++ + Q     + C         +T    +
Sbjct: 188  --FKGMLVGNGCVDDQINFNTNIMYQYYHAVVDETQMQNVTQQCCNGTMDCDYYTISQGN 245

Query: 900  DKCNE-----AMSIVFTKYEEIDIYNIYGPRCLLNGS---SSATGIRGVLDLALTNK--- 754
            D C +     + SI +T Y+   +Y      C LN +        IR +    L N    
Sbjct: 246  DTCGDLVNQLSYSIYYTGYDPYFLYF----ACYLNPNLPYPPHEEIRKLQKNVLRNNLYK 301

Query: 753  ---------ERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWK 601
                     +  Y Y     I G  D         Y N  +V+KA    +R P     ++
Sbjct: 302  KIIGESPVLKNKYFYPPSNDIQGQPDCASHDDHFPYLNSPEVKKA----LRIPDYVPKYE 357

Query: 600  TCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVI-GSRYCIEALKLPLK 424
             C+  +   Y+    ++   ++ +I     + +++GDAD     +  S++  + LK  +K
Sbjct: 358  MCNMEIAENYQSQYPTMKKFFDTVIDAKKHVAMFNGDADTLCNYVENSQFIYKTLKKTVK 417

Query: 423  S---PWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHL--VPLNKPSEALALIHSFL 274
            +   PW          G++ EY G+T ++++G GH       KP E   +  +++
Sbjct: 418  TAMMPWNDPVQLPMAVGQVTEYDGITLISIKGGGHFPAATEQKPKETFQMFQNYV 472



>gb:BC078934_2107081 Rattus norvegicus protective protein for
            beta-galactosidase (predicted), mRNA (cDNA clone
            MGC:93743 IMAGE:7108104), complete cds.
          Length = 456

 Score =  191 bits (486), Expect = 3e-47
 Identities = 134/437 (30%), Positives = 212/437 (48%), Gaps = 25/437 (5%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKS 1462
            L++ +L + +S  +AA + D+I  LPG    P    +SGY+  + S  +   YWF E+++
Sbjct: 9    LLLLLLLSWASRDEAAPDQDEIDCLPGLAKQPSFRQYSGYLKASDS--KHFHYWFVESQN 66

Query: 1461 HPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
             P N P+VLWLNGGPGCSS+  G   E GP  ++ +GV L +N YSWN  AN+L++ESP 
Sbjct: 67   DPKNSPVVLWLNGGPGCSSLD-GLLTEHGPFLIQPDGVTLEYNPYSWNLIANMLYIESPA 125

Query: 1281 GVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA 1102
            GVGFSY++         +  VA++ Y  L ++   FP++K +  F+ GESYAG Y+P LA
Sbjct: 126  GVGFSYSDDKMYVTNDTE--VAENNYQALKDFYHLFPEYKDNKLFLTGESYAGIYIPTLA 183

Query: 1101 EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISD------QQYDK 940
             +V          P +NL+G  VGN  ++   +   L+ +A+ H ++ +      Q +  
Sbjct: 184  VLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCC 236

Query: 939  AKEVCDFTQENWSDKCNEAMSIV-FTKYEEIDIYNIYGPRCLLNGSSSATGI--RGVLDL 769
            ++  C+F      D  N    +        ++IYN+Y P         A G+  R   + 
Sbjct: 237  SQNKCNFYDNKDPDCVNNLQEVSRIVGKSGLNIYNLYAP--------CAGGVPGRDRSED 288

Query: 768  ALTNKERTYAYRRM---KRIPGGY-----------DPCYSPYA-EEYFNRIDVQKAFHAN 634
             L  ++    + R+   +R P               PC +  A   Y N   V+KA H  
Sbjct: 289  TLVVQDFGNIFTRLPLKRRFPEALLLRSGDKVRLDPPCTNTTAPSTYLNNPYVRKALH-- 346

Query: 633  IRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKG-GLKIWIYSGDADGRVPVIGSR 457
               P S   W  C+  V   Y+    S+   Y KL+     +I +Y+GD D     +G  
Sbjct: 347  --IPESLPRWDMCNLMVNLQYRRLYESMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDE 404

Query: 456  YCIEALKLPLKSPWRSW 406
            + +++L   +K  W SW
Sbjct: 405  WFVDSLNQKVKCCWGSW 421



>sp|P52714|YXD2_CAEEL Putative serine carboxypeptidase C08H9.1 (EC
            3.4.16.-).>pir|T19106|T19106 probable serine
            carboxypeptidase (EC 3.4.16.-) C08H9.1 precursor -
            Caenorhabditis elegans>gb:CEC08H9_1360264 Caenorhabditis
            elegans cosmid C08H9, complete sequence.
          Length = 505

 Score =  191 bits (485), Expect = 4e-47
 Identities = 143/490 (29%), Positives = 222/490 (45%), Gaps = 54/490 (11%)
 Frame = -2

Query: 1572 YLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKP-LVLWLNGGPGCSSIGY 1396
            +LPG    P L   SGY+  N++  + +FY+  EA+  P  +  L++W NGGPGCSS+  
Sbjct: 25   HLPGNSDIPDLKLQSGYLNANENGTQKMFYFLLEARDIPVGEASLIIWFNGGPGCSSLS- 83

Query: 1395 GAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVA 1216
                E GPL V   G  L  N +SW  +AN+LF+ESP+GVGFSY           D  +A
Sbjct: 84   AFFEEFGPLYVNFGGKSLFENVHSWYHKANILFLESPIGVGFSYDTEQSNFTKVNDDSIA 143

Query: 1215 QDTYNFLVNWLER-FPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGF 1039
            +  +N ++++ +R    +  HDFFIA ESY G Y P L+ +V D    R  +P  N KG 
Sbjct: 144  EQNFNSVIDFFQRKHSSYVNHDFFIAAESYGGVYGPMLSALVVDSISKRE-FPNENFKGL 202

Query: 1038 IVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC---------------------- 925
            I+GN   N       ++ ++  H   S  ++D+ KE C                      
Sbjct: 203  IIGNGFMNVKLSTNTMILWSAYHDRTSPDEWDEIKEKCATSGAHDVDYYDFMQFMKTTNK 262

Query: 924  -DFTQENWSDKCNEAMSIVFTKYEEI----DIYNIYGPRCLLNGS--SSATGIRGVLDL- 769
             D+  +N S +C   +  +  ++ E     D +N Y   C  N S  ++   I+  L   
Sbjct: 263  MDYLADN-STECGRLIEPLLGQFSETFDGYDFFNYYHD-CYTNFSIPNATDPIKETLAQI 320

Query: 768  ------ALTNKERTYAYRRMKRIPGGYDPCYSPYA-EEYFNRIDVQKAFHANIRAPGSTV 610
                  AL NK  T      +        C++  A  +Y N  +VQ A   +        
Sbjct: 321  PRRRISALFNKHSTDGQASYR--------CWADDALHKYLNLKEVQNALGIDRAWKDRKK 372

Query: 609  NWKTCSDPVFRAYKYTTFSLLP----VYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEA 442
             W+ C+ P++  Y  T   + P    +++K      ++ IYSGD D     +   Y    
Sbjct: 373  KWEVCNMPIYDQYVMTHQDMTPFFSKIFDKFTGPAFRVLIYSGDIDTACNYLADGY---- 428

Query: 441  LKLPLKSPWRSWFHNHQ--VGGRIVEYHG---------LTFVTVRGAGHLVPLNKPSEAL 295
                LK     W+H+    + G  + Y G         +  VTV+G+GH VPL++P  AL
Sbjct: 429  --FTLKHG--PWYHSEHKVIAGNFMRYEGANHLGSKLSIDVVTVKGSGHFVPLDRPGPAL 484

Query: 294  ALIHSFLSGE 265
             ++H+FL+G+
Sbjct: 485  QMVHNFLTGK 494



>pir|C84619|C84619 probable serine carboxypeptidase I [imported] -
            Arabidopsis thaliana>gb:AY035052_1559829 Arabidopsis
            thaliana putative serine carboxypeptidase I (At2g22990)
            mRNA, complete cds.>gb:AY051060_1562535 Arabidopsis
            thaliana putative serine carboxypeptidase I (At2g22990)
            mRNA, complete cds.>gb:AF275313_1782515 Arabidopsis
            thaliana sinapoylglucose:malate sinapoyltransferase
            (SNG1) mRNA, complete cds.
          Length = 433

 Score =  191 bits (484), Expect = 5e-47
 Identities = 134/481 (27%), Positives = 220/481 (45%), Gaps = 15/481 (3%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            L + FL++ VL     S    +      +LPG          +GYI + +      FY+F
Sbjct: 3    LKIKFLLLLVLYHHVDSASIVK------FLPGFEGPLPFELETGYIGIGEDENVQFFYYF 56

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK-----RNGVGLHFNKYSWNKE 1312
             +++++P   PL++WLNGGPGCS +G G   E GP+ +K      +   L    YSW K 
Sbjct: 57   IKSENNPKEDPLLIWLNGGPGCSCLG-GIIFENGPVGLKFEVFNGSAPSLFSTTYSWTKM 115

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            AN++F++ PVG GFSY+           +   + T+ FL  WL R PQ+  +  ++ G+S
Sbjct: 116  ANIIFLDQPVGSGFSYSKTPIDKTGDISE--VKRTHEFLQKWLSRHPQYFSNPLYVVGDS 173

Query: 1131 YAGHYVPQLAEVVFDRNRDRGIY----PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI 964
            Y+G  VP L + +      +G Y    P INL+G+++GNP T   ++    + YA+   +
Sbjct: 174  YSGMIVPALVQEI-----SQGNYICCEPPINLQGYMLGNPVTYMDFEQNFRIPYAYGMGL 228

Query: 963  ISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYE---EIDIYNIYGPRCLLNGSSSAT 793
            ISD+ Y+  K +C+    N      + + +    ++   +I+I++I  P C +   +S  
Sbjct: 229  ISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKINIHHILTPDCDVTNVTSP- 287

Query: 792  GIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPY--AEEYFNRIDVQKAFHANIRAPG 619
                                         D  Y PY   E + N   V++A H      G
Sbjct: 288  -----------------------------DCYYYPYHLIECWANDESVREALHIE---KG 315

Query: 618  STVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL 439
            S   W  C+  +   Y +   S +P +      G +  IYSGD D  VP + ++  I +L
Sbjct: 316  SKGKWARCNRTI--PYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLATQAWIRSL 373

Query: 438  KLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEE 262
                   WR W  N+Q+ G    Y + +TF T++G GH     +P+E   +   ++SG+ 
Sbjct: 374  NYSPIHNWRPWMINNQIAGYTRAYSNKMTFATIKGGGHTAEY-RPNETFIMFQRWISGQP 432

Query: 261  L 259
            L
Sbjct: 433  L 433



>gb:AE016959_1020561 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC079632_1732621 Oryza sativa
            chromosome 10 clone OSJNBa0046L02, complete
            sequence.>gb:AC108883_1738642 Genomic sequence for
            (japonica cultivar-group) cultivar Nipponbare clone
            OJ1136E01, from chromosome 10, complete
            sequence.>gb:AE017047_1750380 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 1 of 77 of the
            complete sequence.
          Length = 432

 Score =  190 bits (482), Expect = 9e-47
 Identities = 142/486 (29%), Positives = 216/486 (44%), Gaps = 11/486 (2%)
 Frame = -2

Query: 1683 EMAPPNRTFLLVGFLVIWVLCA---ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITV 1513
            E A   R  LL+  L++   C    E S+  ++     + +LPG   A      +GY+ V
Sbjct: 6    EAAVTRRRLLLLLLLLVTCSCLSARERSNSSSSSSRRVVRHLPGFDGALPFELETGYVEV 65

Query: 1512 NQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVG---- 1345
            ++  G  LFY+F  ++S P++ PL+LWL GGPGCS+   G   E+GPL    +G G    
Sbjct: 66   DRIAGVRLFYYFIRSESSPADDPLLLWLTGGPGCSAFS-GLVYEVGPLTFDVHGHGHGQL 124

Query: 1344 --LHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWL-ERF 1174
              L +   SW K  N++F++SPVG GFSY +                   FL NW  E  
Sbjct: 125  PRLLYKPESWTKRTNVIFLDSPVGTGFSYADTDAGFRTGDT-IAVHHILVFLNNWFQEVH 183

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
            P F  +  +IAG+SY+G  VP +   +   +      P +NLKG+++GNP T+  +D   
Sbjct: 184  PDFLSNPLYIAGDSYSGMIVPAVTFGIATSSPK----PSLNLKGYLLGNPVTDHNFDAPS 239

Query: 993  LLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLL 814
             + +A    +ISDQ Y   K+                               IYG   L 
Sbjct: 240  KIPFAHGMGLISDQLYQCVKD-------------------------------IYGNHILE 268

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHAN 634
               + A+     +D   T+    Y   R+                 + N   V++A   +
Sbjct: 269  PYCTFASPHNPRIDKPFTSGTAEYTMSRI-----------------WANNDTVREALGIH 311

Query: 633  IRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRY 454
                G+  +W+ C+  +   Y Y   S +  +  L   G +  IYSGD D  +P IG++ 
Sbjct: 312  ---QGTVPSWQRCNYDIL--YTYDIKSSVRYHLDLTTRGYRSLIYSGDHDMIIPFIGTQA 366

Query: 453  CIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSF 277
             I +L   +   WR WF + QV G I  Y + LTF TV+G GH  P   P + LA++  +
Sbjct: 367  WIRSLNFSVVDEWRPWFVDGQVAGYIRSYSNNLTFATVKGGGHTAPEYMPKQCLAMLARW 426

Query: 276  LSGEEL 259
            +SG  L
Sbjct: 427  VSGNPL 432



>pir|T18968|T18968 probable serine-type carboxypeptidase (EC 3.4.16.-)
            Y16B4A.2 - Caenorhabditis elegans>gb:CEC05G5_1360075
            Caenorhabditis elegans cosmid C05G5, complete
            sequence.>gb:CEH40D05_1365088 Caenorhabditis elegans
            fosmid H40D05, complete sequence.>gb:CEY16B4A_1369457
            Caenorhabditis elegans YAC Y16B4A, complete sequence.
          Length = 2105

 Score =  189 bits (481), Expect = 1e-46
 Identities = 148/483 (30%), Positives = 232/483 (48%), Gaps = 32/483 (6%)
 Frame = -2

Query: 1611 SSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLW 1432
            ++P   +++DKI  LPG         +SGY+  + +H     YWF E+++ P+N P++LW
Sbjct: 493  AAPATRRDADKIVNLPGLTYQINFNQYSGYLNASDTH--RFHYWFVESQNDPTNSPVLLW 550

Query: 1431 LNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            LNGGPG SS+ +G   E GP R  ++G  L+ N +SWNK AN+L++ESP  VG+SY +  
Sbjct: 551  LNGGPGSSSL-WGMLTENGPFRPNKDGQTLYENVHSWNKFANVLYLESPHQVGYSY-STV 608

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLER-FPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD 1075
                   D   A D YN L ++    FPQ+K + F+I GESY G Y+P L++++      
Sbjct: 609  ANDYTYGDDLTASDNYNALKDFFNNIFPQYKQNPFYITGESYGGVYIPTLSKLLLQMLSA 668

Query: 1074 RGIYPRINLK------GFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDK-----AKEV 928
              I   IN K      G  +GN E          +   +++ +  + +Y+       K V
Sbjct: 669  GEI--NINFKARLIFIGIAIGNGELTTKLQVNSAIFQLYTYGLFGENEYNALVARCCKNV 726

Query: 927  CDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKER 748
             D TQ      C+     VF  Y         G    ++G+       G+L+LA ++   
Sbjct: 727  TDPTQ------CDFYTPYVFFDY--------LGNYKAVDGADPFCSSTGLLNLASSD--- 769

Query: 747  TYAYRRMKRIPGGYDPCYSPYA-EEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPV-FRA 574
                      P    PC+S  A   Y NR DV+ A H     P +   W++ +  V  + 
Sbjct: 770  ----------PFDGFPCWSTDATTTYLNRDDVRNALH----IPTTVQQWQSFNQTVNAQL 815

Query: 573  YKYTTFSLLPVYEKLI------KGGLKIWIYSGDADGRVPVIGSRYCIEALK----LPLK 424
            Y  + F L  V  +++      +  +KI IY+GD D     +G ++ IE +     L   
Sbjct: 816  YNRSYFELDAVLNRILSSYYYKQNNMKILIYNGDVDMVCNHLGDQWLIEQVASNAGLKTV 875

Query: 423  SPWRSWFH-----NH--QVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
            SP + W +     N+  Q+ G +  +   L  VTV+G+GHLVP ++P  AL +I +F+SG
Sbjct: 876  SPRQPWNYVMAGENYLPQLAGYVKVFDSNLNLVTVKGSGHLVPQDRPGPALQMIFNFISG 935

Query: 267  EEL 259
              L
Sbjct: 936  VNL 938



 Score =  187 bits (476), Expect = 4e-46
 Identities = 146/478 (30%), Positives = 219/478 (45%), Gaps = 39/478 (8%)
 Frame = -2

Query: 1590 ESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGC 1411
            ++D+I  LPG P+  L   +SG++  +   G  + YW  E++++PS  PL+LWLNGGPG 
Sbjct: 1546 QTDRIINLPGLPADMLFKQYSGFL--DGLSGHKVHYWLVESENNPSTDPLLLWLNGGPGS 1603

Query: 1410 SSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXX 1231
            SS+  G   E GP RV ++   L  N YSWNK AN+L++ESP+GVG+SY           
Sbjct: 1604 SSL-MGLFEENGPFRVSKDSQTLSRNPYSWNKFANVLYLESPIGVGYSYAYNNTNIQYDD 1662

Query: 1230 DKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRIN 1051
                AQ+ Y  L ++  ++PQ+   DF+  GESYAG Y+P L+ ++    +   I   IN
Sbjct: 1663 VT-TAQENYAALKSFFAQYPQYTTSDFYTTGESYAGVYLPGLSALLVQGIKSGDI--NIN 1719

Query: 1050 LKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQE------------- 910
             KG  +GN   +   D    L Y + H  IS   Y+ A ++C    E             
Sbjct: 1720 YKGVSIGNGVIDKRTDMNSQLHYQYYHGGISATTYNTALQLCCSGDEFKCRFSDRMTNFN 1779

Query: 909  ---NWSDKCNEAMSIVFTKYEEI-----DIYNIYGPRCLLNGSSSATGIRGVLDLALTNK 754
                W D  +     V     ++     D YN+Y  +C     +  T            +
Sbjct: 1780 NSIPWGDLSDPCYDFVVATGAQLLLTAFDPYNMY-QQCWTIPYNDTT------PRTPYGE 1832

Query: 753  ERTYAYRRMKRIPGGYDPCYSPYA-EEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFR 577
              T           GY PCY   A E Y NR  V+KA    +  P S   W   ++ +  
Sbjct: 1833 TWTGINYESSDFLNGY-PCYDDSAMEGYLNRPVVRKA----LNIPDSVPYW-AANNNIIN 1886

Query: 576  AYKYTTFSLLPVYEKLI---KGGLKIWIYSGDADGRVPVIGSRYC----IEALKLPLKSP 418
            AY     S++P  + ++       K+ +YSGDAD  V  +G+         AL L   SP
Sbjct: 1887 AYNQQVDSIVPNLQIIMANAPANFKMLLYSGDADTMVNWLGAEIFTANNFAALGLTTSSP 1946

Query: 417  WRSWFHNHQ------VGGRIVEYH----GLTFVTVRGAGHLVPLNKPSEALALIHSFL 274
               W   +       V G    Y      +  +TV+G+GH VPL++P +AL +I++F+
Sbjct: 1947 RAQWTFQYNSTFQPTVAGYQTSYTSNAINIDVLTVKGSGHFVPLDRPQQALQMIYNFV 2004



 Score =  176 bits (446), Expect = 1e-42
 Identities = 133/486 (27%), Positives = 221/486 (45%), Gaps = 19/486 (3%)
 Frame = -2

Query: 1668 NRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHG-RA 1492
            ++  LL   L++  L    ++P    ++D +  LPG         ++GY+  + +     
Sbjct: 4    HQILLLCLLLLLAPLRNGQTTPTTRAQADLVNQLPGTIFQVNFKQYAGYLNSDPNKNYNN 63

Query: 1491 LFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKE 1312
            L YW  E++  PSN  L+LW+NGGPGCSS+ +G   E+GP  V  +   ++ N ++WNK 
Sbjct: 64   LHYWLIESQLTPSNDTLLLWINGGPGCSSV-FGQIQEIGPFHVSSDSQTVYENVFAWNKV 122

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            +NLL ++ P G GFS+           D +V     N L+++   +P     D +IAGE 
Sbjct: 123  SNLLAIDGP-GAGFSWQQ----NLFQDDSYVTGALLNALMDFYTVYPNMLNSDLYIAGEG 177

Query: 1131 YAGHYVPQLAEVVFDRNRDRG--IYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIIS 958
            Y   +   L E +   N  R   +   +N++G ++ N + +    Y  L+ + ++H    
Sbjct: 178  YGSFFASSLVESLMVNNTPRPDIVTSPVNIRGLLLANGDLSARLQYNSLIPFYYTHGFAG 237

Query: 957  DQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEE-IDIYNIYGPRCLLNGSSSATGIRG 781
             +QYD  K VC       +     + +   TK +  I  ++ Y    ++      + I  
Sbjct: 238  SKQYDDLKSVCCTNASTQTCDFFNSNTACRTKADNAIATWSNYQANKIVLTRRGCSEINA 297

Query: 780  VLDLALTNKERTYAYRRMKRIPGGYDPCYSPYA-EEYFNRIDVQKAFHANIRAPGSTVNW 604
             +D    N   T ++R       GY PC++  A   Y NR DVQ A H ++ A   + N+
Sbjct: 298  AVD----NYNSTDSFR-------GY-PCFALSATAAYLNRQDVQAALHVSVNA---STNF 342

Query: 603  KTCSDPVFRAYK---YTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKL 433
            +TC +  +           S +   EK  +  +KI IY+GD D     IG++   + +  
Sbjct: 343  QTCRNLTYGELSTDLQIRISSILTSEKYAQNNMKIMIYNGDLDLWSNFIGAQRFGQEIAA 402

Query: 432  PLK---SPWRSWFHNHQV-------GGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALI 286
             LK   +  R W HN+         GG I  Y       ++RG GH  P N+PS++L L 
Sbjct: 403  ALKLNTTEDRIWRHNYDSAAFVWMDGGVITSYSSNFHIASIRGGGHFAPQNRPSQSLQLY 462

Query: 285  HSFLSG 268
              F+ G
Sbjct: 463  RDFVLG 468



 Score =  173 bits (438), Expect = 1e-41
 Identities = 149/506 (29%), Positives = 229/506 (45%), Gaps = 62/506 (12%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A ++D I  LPG         FSGY+T +++    LFYWF E+++ P N P+VLWLNGGP
Sbjct: 1021 AAKADMILSLPGLTFNVTYRMFSGYLTADETPLNHLFYWFVESQNDPVNDPVVLWLNGGP 1080

Query: 1416 GCSSIGYGAAAELGPLRVKRN-GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXX 1240
            GCSS+G G   ELGP     + G  L+ N +SWNK+AN++F+E+P  VGFSYT       
Sbjct: 1081 GCSSLG-GFFTELGPFHPNDDGGQTLYENVFSWNKKANVIFLEAPAKVGFSYTEDPNYYW 1139

Query: 1239 XXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYP 1060
                     + Y     + ++FPQ+  + FFI GESY G Y P L  +   +  D GI  
Sbjct: 1140 DDDTT-AQNNGYAIKSFFQKKFPQYAQNQFFITGESYGGVYCPTLT-LNLVQQIDAGIL- 1196

Query: 1059 RINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENW-------- 904
             +N KG  VGN   ++Y      +   +         ++  K  C+ T  +         
Sbjct: 1197 NLNFKGTAVGNGILSEYLQTNSEIVLQYGRGFNGVDDWNNLKTACNLTNSDTIYYDYQGA 1256

Query: 903  --SDKCNEAMSIVFTKYEEI-----DIYNIYGPRCLLN--------GSSSATGIRGVLDL 769
                 C +A+     K+  +     D YN+Y    L N         +   T  +   + 
Sbjct: 1257 PEGSACYQAVDDNQKKFYGLDERYGDPYNMYQDCYLYNNKGAWQTPSAQQQTKPKTRRER 1316

Query: 768  AL---TNKERTYAYRRM-------KRIPGGYDP-----CYSPYA-EEYFNRIDVQKAFHA 637
            AL    N+ +++A   +       K   G  DP     C++  A   Y +R DVQ A H+
Sbjct: 1317 ALRAHMNRRKSFASASIKFDNSNSKNWYGSTDPFRGLNCFAGDALVTYLSRDDVQTAIHS 1376

Query: 636  NIRAPGSTVNWKTCSDP----VFRAY---KY----TTFSLLPVYEKLIKGGLKIWIYSGD 490
                      W  C+D      FR +   KY     T S +   +   +  +++  Y+GD
Sbjct: 1377 R-----KQPLWVDCADENPANHFRYHTQEKYYDMQNTISDIMDSKWYTQNSMRLMFYNGD 1431

Query: 489  ADGRVPVIGSRYCIEAL----KLPLKSPWRSWFHNH--QVGGRIVEY-----HGLTFVTV 343
             D     +G ++ IE L     L + SP + W++    Q    I  Y       L  +TV
Sbjct: 1432 VDTICQFLGDQWLIEKLVTRRNLTVTSPRQPWYYQQGSQYVTTIAGYAKSWTQNLVQLTV 1491

Query: 342  RGAGHLVPLNKPSEALALIHSFLSGE 265
            +G+GH VP ++P++AL ++ +FLS +
Sbjct: 1492 KGSGHFVPSDRPAQALQMLTNFLSNQ 1517



>gb:AC004401_1531648 Arabidopsis thaliana chromosome 2 clone F21P24
            map CIC06C07, complete sequence.>gb:AC004786_1532170
            Arabidopsis thaliana chromosome 2 clone T20K9 map
            CIC06C07, complete sequence.
          Length = 433

 Score =  189 bits (479), Expect = 2e-46
 Identities = 133/481 (27%), Positives = 220/481 (45%), Gaps = 15/481 (3%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            L + FL++ VL     S    +      +LPG          +GYI + +      FY+F
Sbjct: 3    LKIKFLLLLVLYHHVDSASIVK------FLPGFEGPLPFELETGYIGIGEDENVQFFYYF 56

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK-----RNGVGLHFNKYSWNKE 1312
             +++++P   PL++WLNGGPGCS +G G   E GP+ +K      +   L    YSW K 
Sbjct: 57   IKSENNPKEDPLLIWLNGGPGCSCLG-GIIFENGPVGLKFEVFNGSAPSLFSTTYSWTKM 115

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            AN++F++ PVG GFSY+           +   + T+ FL  WL R PQ+  +  ++ G+S
Sbjct: 116  ANIIFLDQPVGSGFSYSKTPIDKTGDISE--VKRTHEFLQKWLSRHPQYFSNPLYVVGDS 173

Query: 1131 YAGHYVPQLAEVVFDRNRDRGIY----PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI 964
            Y+G  VP L + +      +G Y    P INL+G+++GNP T   ++    + YA+   +
Sbjct: 174  YSGMIVPALVQEI-----SQGNYICCEPPINLQGYMLGNPVTYMDFEQNFRIPYAYGMGL 228

Query: 963  ISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYE---EIDIYNIYGPRCLLNGSSSAT 793
            ISD+ Y+  K +C+    N      + + +    ++   +I+I++I  P C +   +S  
Sbjct: 229  ISDEIYEPMKRICNGNYYNVDPSNTQCLKLTEEYHKCTAKINIHHILTPDCDVTNVTSP- 287

Query: 792  GIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPY--AEEYFNRIDVQKAFHANIRAPG 619
                                         D  Y PY   E + N   V++A H      G
Sbjct: 288  -----------------------------DCYYYPYHLIECWANDESVREALHIE---KG 315

Query: 618  STVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL 439
            S   W  C+  +   Y +   S +P +      G +  IYSGD D  VP + ++  I +L
Sbjct: 316  SKGKWARCNRTI--PYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIAVPFLATQAWIRSL 373

Query: 438  KLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEE 262
                   WR W  N+Q+ G    Y + +TF T++ +GH     +P+E   +   ++SG+ 
Sbjct: 374  NYSPIHNWRPWMINNQIAGYTRAYSNKMTFATIKASGHTAEY-RPNETFIMFQRWISGQP 432

Query: 261  L 259
            L
Sbjct: 433  L 433



>pir|A96759|A96759 protein serine carboxypeptidase T18K17.5 [imported]
            - Arabidopsis thaliana>gb:AE005173_894875 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC010556_1536960 Arabidopsis thaliana
            chromosome 1 BAC T18K17 genomic sequence, complete
            sequence.
          Length = 441

 Score =  188 bits (477), Expect = 3e-46
 Identities = 130/431 (30%), Positives = 200/431 (46%), Gaps = 7/431 (1%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK--- 1360
            +GYI V +     LFY+F +++ +P   PL+LWL+GGPGCSSI  G   E GPL +K   
Sbjct: 49   TGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGCSSIS-GLLFENGPLAMKLDV 107

Query: 1359 RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    YSW K ++++F++ PVG GFSY+              A+  + FL  W
Sbjct: 108  YNGTLPSLVSTTYSWTKASSMIFLDQPVGAGFSYSRTQLLNKPSDSG-EAKRIHEFLQKW 166

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
            L +  +F  + F++ G+SY+G  VP   + +   N +    P INL+G+++GNP T+  Y
Sbjct: 167  LGKHQEFSSNPFYVGGDSYSGMVVPATVQEISKGNYE-CCNPPINLQGYVLGNPLTDFVY 225

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
            DY   + +A   A+ISD+ ++  K+ C     N   +  E +  +    EE         
Sbjct: 226  DYNSRIPFAHGMALISDELFESLKKTCKGDYRNVHPRNTECLKFI----EE--------- 272

Query: 825  RCLLNGSSSATGIRGVLD-LALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQK 649
                N  +++   R ++D    T     Y YR +              A  + N   V+K
Sbjct: 273  ---FNKCTNSICQRRIIDPFCETETPNCYIYRFL-------------LAAYWANDETVRK 316

Query: 648  AFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPV 469
            A        G    W  C   +   Y Y   S +P +      G +  IYSGD D  VP 
Sbjct: 317  ALQIKKETIG---EWVRCHYGI--PYNYDIKSSIPYHMNNSINGYRSLIYSGDHDFEVPF 371

Query: 468  IGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALA 292
            +G++  I +L   +   WR W    Q+ G    Y + +TF T+RG GH +   KP EA  
Sbjct: 372  LGTQAWIRSLNYSVIDDWRPWMIKDQIAGYTRTYANKMTFATIRGGGHTIEF-KPEEASI 430

Query: 291  LIHSFLSGEEL 259
            +   ++ G+ L
Sbjct: 431  MFQRWIKGQPL 441



>pir|T49055|T49055 serine carboxypeptidase-like protein - Arabidopsis
            thaliana>gb:ATT5P19_1556259 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T5P19.
          Length = 264

 Score =  187 bits (475), Expect = 6e-46
 Identities = 93/160 (58%), Positives = 111/160 (69%)
 Frame = -2

Query: 1593 QESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPG 1414
            +E D I  LPGQPS      + GY+TVN+S GR+L+Y+F EA +  ++ PLVLWLNGGPG
Sbjct: 75   KERDLIENLPGQPSVNF-KQYGGYVTVNESAGRSLYYYFVEATNTKNSSPLVLWLNGGPG 133

Query: 1413 CSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
            CSS+ YGA  ELGP RV  +   L+ N YSWN  AN+LF+ESP G GFSYTN        
Sbjct: 134  CSSL-YGAFQELGPFRVHSDNKTLYTNPYSWNNVANMLFLESPAGTGFSYTNTTTDMENP 192

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYV 1114
             D   A D Y FLV WLERFP++KG DF+IAGESYAGHYV
Sbjct: 193  GDMKTAADNYVFLVKWLERFPEYKGRDFYIAGESYAGHYV 232



>pir|B96759|B96759 protein serine carboxypeptidase T18K17.4 [imported]
            - Arabidopsis thaliana>gb:AE005173_894876 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC010556_1536959 Arabidopsis thaliana
            chromosome 1 BAC T18K17 genomic sequence, complete
            sequence.
          Length = 438

 Score =  186 bits (472), Expect = 1e-45
 Identities = 131/446 (29%), Positives = 206/446 (46%), Gaps = 6/446 (1%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + +LPG   +      +GYI + +     LFY+F +++ +P   PL+LWL+GGPGCSSI 
Sbjct: 32   VKFLPGFEGSLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGCSSIS 91

Query: 1398 YGAAAELGPLRVK---RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G   E GPL +K    NG    L    YSW K ++++F++ PVG GFSY+         
Sbjct: 92   -GLLFENGPLAMKLDVYNGTLPSLVPTTYSWTKTSSMIFLDQPVGTGFSYSRTQQYNKPS 150

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
                 A+  + FL  WL +  +F  + F++AG+SY+G  VP   + +  +   +   P I
Sbjct: 151  DSG-EAKRIHEFLQKWLSKHQEFSSNPFYVAGDSYSGMVVPATVQEI-SKGNYQCCSPPI 208

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NL+G+++GNP T    DY   + +A   A+ISD+ Y+  K VC    E    +  E + +
Sbjct: 209  NLQGYVLGNPITEHAIDYNYRIPFAHGMALISDELYESLKRVC--KGEYVDPRDTECLKL 266

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
            V    EE         +C             +  L +T     Y YR +           
Sbjct: 267  V----EEFS-------KCTKGVCQEVV----IKPLCVTETPNCYIYRYL----------- 300

Query: 693  SPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGL 514
                  + N ++V+KA   N  + G    W  C   +   Y +   S +P +      G 
Sbjct: 301  --LTTYWVNDVNVRKALQINKESIG---EWVRCYFGI--PYTHDIKSSVPYHMNNSINGY 353

Query: 513  KIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRG 337
            +  IYSGD D  VP + ++  + +L   +   WR W    Q+GG    Y + +TF TVR 
Sbjct: 354  RSLIYSGDHDLNVPFLATQAWVRSLNYSIIDNWRPWMIKDQIGGYTKTYANKMTFATVRA 413

Query: 336  AGHLVPLNKPSEALALIHSFLSGEEL 259
            +GH     KP E   + H +++G+ L
Sbjct: 414  SGHTAEY-KPYETYIMFHRWINGQPL 438



>pir|C86459|C86459 probable serine carboxypeptidase, 88458-86107
            [imported] - Arabidopsis thaliana>gb:AE005172_892167
            Arabidopsis thaliana chromosome 1, top arm complete
            sequence.>gb:AC051630_1540105 Arabidopsis thaliana
            chromosome 1 BAC F10C21 genomic sequence, complete
            sequence.
          Length = 446

 Score =  186 bits (472), Expect = 1e-45
 Identities = 139/458 (30%), Positives = 204/458 (44%), Gaps = 18/458 (3%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            I YLPG          +GYI V +     LFY+F +++++P   PL++WL GGP C+++ 
Sbjct: 29   ISYLPGFEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLTGGPACTALS 88

Query: 1398 YGAAAELGPLRVKRNGV-----GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
               A E+GPL  K  G       L    YSW K A+++F++ PVG G+SY+         
Sbjct: 89   -ALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYSTTPLSYKPS 147

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
                 A+ TY FL  WL   PQF  +  ++ G+SYAG  VP + + +   N + G  P+I
Sbjct: 148  DTG-EAKQTYEFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGN-EHGYKPQI 205

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDKCNEA 883
            NLKG+I+GNP T+   D+   + YA    +ISD+ Y+  K  C       +  + KC + 
Sbjct: 206  NLKGYILGNPSTDLDSDHNSKIPYAHRMGLISDELYESLKRTCQGNYVKVDPTNTKCLKL 265

Query: 882  MSIVFTKYEEIDIYNIYGPRCLL---NGSSSATGIRGVL------DLALTNKERTYAYRR 730
            M         I+   I    C L   N  S   G R  L      DL+L   +  Y YR 
Sbjct: 266  MEDYGKCVSRINEGLILIALCDLASPNPYSGEHGGRSYLQTLVQSDLSLPTPD-CYMYRY 324

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
            +              A  + N  DV++  H      GS   W  C+  +   Y+    S 
Sbjct: 325  L-------------LASHWANDEDVRRELHV---VKGSIGKWMRCNWDL--PYEKDIKSS 366

Query: 549  LPVY-EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIV 373
            +P +    I G  +  +YS D D  VP IG+   I++L   +   WR WF N+Q GG   
Sbjct: 367  VPYHRNNSIIGDYRSLVYSSDHDMMVPYIGTEAWIKSLNYSITDDWRPWFVNNQGGGHTA 426

Query: 372  EYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            EY                  KP E+  +   ++SG  L
Sbjct: 427  EY------------------KPEESFMMFQRWISGRPL 446



>gb:AC011560_1537254 Arabidopsis thaliana chromosome 3 BAC F13M14
            genomic sequence, complete
            sequence.>gb:ATAC013428_1543487 Arabidopsis thaliana
            chromosome III BAC F18K10 genomic sequence, complete
            sequence.>gb:AY088751_1573764 Arabidopsis thaliana clone
            94163 mRNA, complete sequence.
          Length = 437

 Score =  186 bits (471), Expect = 2e-45
 Identities = 131/438 (29%), Positives = 202/438 (46%), Gaps = 14/438 (3%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK--- 1360
            +GYI V +     LFY+F +++ +P   PL+LWL+GGPGCSSI  G   E GP+ VK   
Sbjct: 45   TGYIGVGEEEEVQLFYYFIKSERNPQEDPLLLWLSGGPGCSSIS-GLLYENGPVNVKIEV 103

Query: 1359 RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    YSW K +++++++ PVG GFSY+              A+  + FL  W
Sbjct: 104  YNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTKLVNKPSDSG-EAKRIHEFLHKW 162

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY----PRINLKGFIVGNPET 1018
            L +  +F  + F++ G+SY G  +P L + +      +G Y    P INL+G+I+GNP T
Sbjct: 163  LGKHQEFSSNPFYVGGDSYCGMVIPALVQEI-----SKGNYVCCKPPINLQGYILGNPST 217

Query: 1017 NDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEE----I 850
             +  D    + YA   A+ISD+ Y+  K +C    EN   +  + + +V  +Y++    I
Sbjct: 218  ENEVDINYRIPYAHGMALISDELYESMKRICKGKYENVDPRNTKCLKLV-GEYQKCTKRI 276

Query: 849  DIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYF 670
            +   I  P C                  +      Y YR +                 + 
Sbjct: 277  NKALIITPEC------------------VDTSPDCYMYRYL-------------LTTYWA 305

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGD 490
            N  +VQ+A H N    GS   W  C   +   Y +   S +P +      G    I+SGD
Sbjct: 306  NDENVQRALHVN---KGSIGEWVRCYFEI--PYNHDIKSSVPYHMNNSIDGYASLIFSGD 360

Query: 489  ADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLN 313
             D  VP +G++  I +L   L   WR W    Q+ G    Y + + F T++G GH  P  
Sbjct: 361  HDMEVPYLGTQAWIRSLNYSLIDDWRPWMIGDQIAGYTRTYANKMAFATIKGGGH-TPEY 419

Query: 312  KPSEALALIHSFLSGEEL 259
            KP E+  +   ++SG+ L
Sbjct: 420  KPEESYIMFQRWISGQPL 437



>gb:AF006079_1760852 Solanum berthaultii glucose acyltransferase
            (pldp15) mRNA, complete cds.
          Length = 456

 Score =  185 bits (470), Expect = 2e-45
 Identities = 136/461 (29%), Positives = 204/461 (44%), Gaps = 37/461 (8%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL-----R 1366
            +GYI V +     LFY+F E++  P N PL++WL GGPGCS +      E GPL      
Sbjct: 40   TGYIGVGEEEKLQLFYFFVESERDPQNDPLMIWLTGGPGCSGLS-TFLYEFGPLTFDYAN 98

Query: 1365 VKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
               N   L  N +SW K AN++F++ PVG G+SY               A  TY+FL  W
Sbjct: 99   SSGNFPKLELNLHSWTKVANIIFIDQPVGTGYSYAKTSEAYNSNDT-LSATLTYDFLRKW 157

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
            L   P++  +  ++  ESYAG Y   +   ++D   + G  P++N+KG+I GN  T+ Y 
Sbjct: 158  LMDHPEYLKNPLYVGSESYAGIYSALVTRKIYD-GVEVGDEPQMNIKGYIQGNALTDAYI 216

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
                 ++Y +   +ISD+ Y  AK  C+                    Y +ID  NI   
Sbjct: 217  TVNSRVKYVYHMGLISDKIYQSAKANCN------------------GNYVDIDPNNIL-- 256

Query: 825  RCL---------LNGSSSATGIRGVLDLALTN---------KERTYAYRRMKRIPGGYDP 700
             CL         LN   S   +    DL+L           +E  Y Y ++         
Sbjct: 257  -CLNDLQKVKKCLNNIQSHHILENWCDLSLLRSNVHSGPWCRENNYIYSKI--------- 306

Query: 699  CYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPV----------FRAYKYTTFSL 550
                    + N   VQKA   N+R  G+ + W  C++ +            +Y Y   S 
Sbjct: 307  --------WANDKAVQKAL--NVR-EGTILEWVRCNNSMKYSARESMKRSGSYVYEIQSS 355

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVE 370
            +  +  L     +  IYSGD D  +  + +   I+ LKLP+   W  WF   QV G  V+
Sbjct: 356  IDDHRHLTSKSCRALIYSGDHDMIISHVSTEEWIDTLKLPIVDDWEPWFVEDQVAGYKVK 415

Query: 369  Y----HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            Y    + LT+ TV+GAGH  P  KP + ++++  + SG+ L
Sbjct: 416  YLQNDYELTYATVKGAGHTAPEYKPRQCMSMVDXWFSGDPL 456



>sp|P38109|YBY9_YEAST Putative serine carboxypeptidase in ESR1-IRA1
            intergenic region (EC 3.4.16.-).>pir|S46008|S46008
            probable carboxypeptidase C (EC 3.4.16.5) YBR139w - yeast
             (Saccharomyces cerevisiae)>gb:AY692681_1622728
            Saccharomyces cerevisiae clone FLH000892.01X YBR139W
            gene, complete cds.>gb:SC297II_1705103 S.cerevisiae
            29.7kb of right arm of chromosome II, with 13
            ORFs.>gb:SCYBR139W_1711375 S.cerevisiae chromosome II
            reading frame ORF YBR139w.
          Length = 508

 Score =  185 bits (470), Expect = 2e-45
 Identities = 131/452 (28%), Positives = 216/452 (47%), Gaps = 19/452 (4%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P +     +  +SGY+    S  +  FYWFFE+++ P+N P++LWLNGGPGCSS   G  
Sbjct: 83   PSKLGIDTVKQWSGYMDYKDS--KHFFYWFFESRNDPANDPIILWLNGGPGCSSFT-GLL 139

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             ELGP  +  +   +H N YSWN  A+++F+E P+GVGFSY +          K   +D 
Sbjct: 140  FELGPSSIGADMKPIH-NPYSWNNNASMIFLEQPLGVGFSYGDEKVSST----KLAGKDA 194

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN 1027
            Y FL  + E FP  + +DF IAGESYAGHY+PQ+A  +  +N +R      NL   ++GN
Sbjct: 195  YIFLELFFEAFPHLRSNDFHIAGESYAGHYIPQIAHEIVVKNPER----TFNLTSVMIGN 250

Query: 1026 PETN-----DYYDYKGLLEYAWSHAIISDQQYDKAKEV---CDFTQENWSDKCNEAMSIV 871
              T+     DYY+     +  + H ++S ++ +K  +    C    +      +    IV
Sbjct: 251  GITDPLIQADYYEPMACGKGGY-HPVLSSEECEKMSKAAGRCRRLNKLCYASKSSLPCIV 309

Query: 870  FTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS 691
             T Y +  +   Y     +N   +   IRG  +    N      Y  ++           
Sbjct: 310  ATAYCDSALLEPY-----INTGLNVYDIRGPCE---DNSTDGMCYTGLR----------- 350

Query: 690  PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKG 520
             Y ++Y N  +VQ+   +++       N+  C + VF  + +T     P  +   +L+  
Sbjct: 351  -YVDQYMNFPEVQETLGSDVH------NYSGCDNDVFTGFLFTGDGSKPFQQYIAELLNH 403

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLPLK--------SPWRSWFHNHQVGGRIVEYH 364
             + + IY+GD D     +G+      L+   K         PW S     ++ G++  Y 
Sbjct: 404  NIPVLIYAGDKDYICNWLGNHAWSNELEWINKRRYQRRMLRPWVSKETGEEL-GQVKNYG 462

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
              TF+ +  AGH+VP ++P  +L +++S++SG
Sbjct: 463  PFTFLRIYDAGHMVPYDQPEASLEMVNSWISG 494



>pir|E84618|E84618 probable serine carboxypeptidase I [imported] -
            Arabidopsis thaliana>gb:AC004786_1532163 Arabidopsis
            thaliana chromosome 2 clone T20K9 map CIC06C07, complete
            sequence.
          Length = 435

 Score =  184 bits (468), Expect = 4e-45
 Identities = 133/453 (29%), Positives = 208/453 (45%), Gaps = 13/453 (2%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + +LPG          +GYI + +     LFY+F +++ +P   PL+LWL+GGPGCSSI 
Sbjct: 25   VKFLPGFEGPLPFELETGYIGIGEEEDVQLFYYFIKSERNPKEDPLLLWLSGGPGCSSI- 83

Query: 1398 YGAAAELGPLRVKR---NG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G   E GPL +K    NG    L    YSW K AN++F++ P+G GFSY+         
Sbjct: 84   TGLLFENGPLALKSKVYNGSVPSLVSTTYSWTKTANIIFLDQPIGAGFSYSRIPLIDTPS 143

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY--- 1063
                V ++ + FL  WL + PQF  + F+ +G+SY+G  VP L + +      +G Y   
Sbjct: 144  DTGEV-KNIHEFLQKWLSKHPQFSSNPFYASGDSYSGMIVPALVQEI-----SKGNYICC 197

Query: 1062 -PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDK 895
             P INL+G+I+GNP T    D    + ++   A+ISD+ Y+  +  C    F  +  + K
Sbjct: 198  KPPINLQGYILGNPITYFEVDQNYRIPFSHGMALISDELYESIRRDCKGNYFNVDPRNTK 257

Query: 894  CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP 715
            C + +       +E++ +NI  P C                         Y Y  +    
Sbjct: 258  CLKLVEEYHKCTDELNEFNILSPDCDTTSPDCF----------------LYPYYLL---- 297

Query: 714  GGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE 535
             GY          + N   V+ A H N  + G    W+ C+      Y     + +P + 
Sbjct: 298  -GY----------WINDESVRDALHVNKSSIG---KWERCTYQNRIPYNKDINNSIPYHM 343

Query: 534  KLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGL 358
                 G +  IYSGD D  VP + ++  I++L   +   WR W    Q+ G    Y + +
Sbjct: 344  NNSISGYRSLIYSGDHDLVVPFLATQAWIKSLNYSIIHEWRPWMIKDQIAGYTRTYSNKM 403

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            TF TV+G+GH     KP+E   +   ++SG +L
Sbjct: 404  TFATVKGSGHTAEY-KPNETFIMFQRWISGHDL 435



>pir|A84619|A84619 probable serine carboxypeptidase II [imported] -
            Arabidopsis thaliana>gb:AC004401_1531646 Arabidopsis
            thaliana chromosome 2 clone F21P24 map CIC06C07, complete
            sequence.>gb:AC004786_1532168 Arabidopsis thaliana
            chromosome 2 clone T20K9 map CIC06C07, complete
            sequence.>gb:AY039596_1560309 Arabidopsis thaliana
            T20K9.18/T20K9.18 mRNA, complete cds.>gb:AY113074_1578234
            Arabidopsis thaliana At2g22970/T20K9.18 mRNA, complete
            cds.>gb:BT000747_1635019 Arabidopsis thaliana clone
            RAFL09-26-C09 (R18415) putative serine carboxypeptidase
            II (At2g22970) mRNA, complete cds.
          Length = 433

 Score =  184 bits (468), Expect = 4e-45
 Identities = 135/453 (29%), Positives = 213/453 (47%), Gaps = 13/453 (2%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + +LPG          +GYI + +     LFY+F +++ +P   PL+LWL+GGPGCSSI 
Sbjct: 25   VKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGCSSI- 83

Query: 1398 YGAAAELGPLRVKR---NG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G   + GPL +K    NG    L    YSW K AN++F++ PVG GFSY+         
Sbjct: 84   TGLLFQNGPLALKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGAGFSYSRAPLIDTPT 143

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY--- 1063
                V +  + FL  WL + PQF  + F+  G+SY+G  VP L + +      +G Y   
Sbjct: 144  DTGEVKR-IHEFLQKWLSKHPQFSSNHFYAGGDSYSGMIVPALVQEI-----SKGNYICC 197

Query: 1062 -PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDK 895
             P INLKG+++GNP T++  D    + ++   A+ISD+ Y+  +E C    F  +  + K
Sbjct: 198  NPPINLKGYVLGNPITHE-DDPNYRIPFSHGMALISDELYESIREACKGNYFNVDPRNTK 256

Query: 894  CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP 715
            C + +       ++++ ++I  P C                   T     Y Y       
Sbjct: 257  CLKLVEEFHKCTDKLNEFHILSPDC------------------DTASPDCYLY------- 291

Query: 714  GGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE 535
                P Y      + N   V+ A H N R+ G    W+ C + + + Y     S +P + 
Sbjct: 292  ----PFY--LISFWANDESVRDALHVNKRSIG---KWERC-NYLSKPYNKDIKSSVPYHM 341

Query: 534  KLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGL 358
                 G +  IYSGD D  VP + ++  I++L   +   WR W    Q+ G    Y + +
Sbjct: 342  NNSVSGYRSLIYSGDHDLVVPFLATQAWIKSLNYSIIDEWRPWMIRDQITGYTRTYSNKM 401

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            TF TV+G+GH    NKP E+  +   +++G+ L
Sbjct: 402  TFATVKGSGHTAE-NKPQESFIMFRRWINGQPL 433



>pir|H96758|H96758 protein serine carboxypeptidase T18K17.6 [imported]
            - Arabidopsis thaliana>gb:AE005173_894874 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC010556_1536961 Arabidopsis thaliana
            chromosome 1 BAC T18K17 genomic sequence, complete
            sequence.
          Length = 441

 Score =  183 bits (465), Expect = 8e-45
 Identities = 135/434 (31%), Positives = 204/434 (47%), Gaps = 10/434 (2%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKR-- 1357
            +GYI V +     LFY+F +++ +P   PL+LWL GGPGCS+I  G   E GPL +K   
Sbjct: 49   TGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPGCSAIS-GLLYENGPLTMKLDV 107

Query: 1356 -NGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    YSW K ++++F++ PVG GFSY+              A+  + FL  W
Sbjct: 108  YNGTLPSLVSTTYSWTKNSSMIFLDQPVGTGFSYSRTELFNKPSDTG-EAKRIHEFLQKW 166

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
            L +  +F  + F++ G+SY+G  VP   + +   N  +   P INL+G+++GNP T+   
Sbjct: 167  LGKHQEFSSNPFYVGGDSYSGITVPATVQEISKGNY-QCCKPPINLQGYMLGNPITDSKI 225

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
            D    + YA   A+ISD+ Y+  K +C                    +YE +D YN    
Sbjct: 226  DGNSQIPYAHGMALISDELYESLKRICK------------------GEYEHVDPYNTECL 267

Query: 825  RCL--LNGSSSATGIRGVLD--LALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRID 658
            + L   N  +S      +L     +TN +  Y YR            YS  +  + N   
Sbjct: 268  KLLEEFNECTSKLYRSHILYPLCEMTNPD-CYIYR------------YS-LSHYWVNDET 313

Query: 657  VQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGR 478
            V+KA   N     S   WK C     + Y     S +P +      G +  I+SGD D  
Sbjct: 314  VRKALQINKE---SIREWKRCDWS--KPYTKDIISSVPYHMNNSINGYRSLIFSGDHDFE 368

Query: 477  VPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSE 301
            VP+IG++  I++L   +   WR W  N+QV G    Y + +TF TV+G GH     KP E
Sbjct: 369  VPLIGTQVWIKSLNYAIVDKWRPWMINNQVAGYTRTYANKMTFATVKGGGHTAEY-KPDE 427

Query: 300  ALALIHSFLSGEEL 259
               +   +++G+ L
Sbjct: 428  TFIMFQRWINGQAL 441



>gb:AY383718_1604128 Brassica napus 1-O-sinapoylglucose:choline
            sinapoyltransferase mRNA, complete
            cds.>gb:AY383719_1604129 Brassica napus
            1-O-sinapoylglucose:choline sinapoyltransferase gene,
            complete cds.
          Length = 466

 Score =  182 bits (462), Expect = 2e-44
 Identities = 134/457 (29%), Positives = 207/457 (45%), Gaps = 17/457 (3%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + YLPG          +GY++V +S    LFY+F +++S+P   PL++WL GGPGCSSI 
Sbjct: 24   VKYLPGLEGPLPFELETGYVSVGESGDVELFYYFVKSESNPDKDPLMIWLTGGPGCSSI- 82

Query: 1398 YGAAAELGPLRVK---RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G     GPL  K    NG    L    +SW K AN+L++ESP G G+SY          
Sbjct: 83   CGLLFANGPLAFKGDEYNGTLPPLELTSFSWTKVANILYLESPAGSGYSYAKTRRAAETS 142

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
              K + Q    FL +W    P+F  + F++ G+SY+G  VP + + +     ++G+ P I
Sbjct: 143  DTKQIHQ-IDQFLRSWFVDHPEFISNSFYVGGDSYSGKIVPGVVQQI-SLGNEKGLTPLI 200

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDKCNEA 883
            N+KG+++GNP      +    + +A    +ISD+ ++  +  C    F  +  + KC+  
Sbjct: 201  NIKGYVLGNPAVRTNLEPNHRVSFAHRMGLISDELHESLERNCGGKFFNVDPSNAKCSNG 260

Query: 882  MSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYD 703
            +        EI I  I  P C ++       I   L    T++ R    +   R      
Sbjct: 261  LLAYHQCISEIYIEQILLPNCKVD--YVLADISQTLPNIRTSRRR--ELKEFSRNDSSSL 316

Query: 702  PCYSPYAEEYFNRIDVQKAFHAN----IRAPG---STVNWKTCSDPVFRAYKYTTFSLLP 544
            P  S +   YF       AF AN     RA G       W  C+      Y Y   + +P
Sbjct: 317  PPPSCFTYRYF-----LSAFWANDENVRRALGVKKGFGKWSRCNTQNI-PYTYDIHNAIP 370

Query: 543  VYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHN-HQVGGRIVEY 367
             +    + G +  IYSGD D  +P   +   I++L   +   WR W  N +QV G    Y
Sbjct: 371  YHVNNSRKGFRALIYSGDHDMMIPFSSTEAWIKSLNYSIVDDWRPWMMNSNQVAGYTRTY 430

Query: 366  -HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
             + +TF T++G GH    N P +   +   ++ GE L
Sbjct: 431  ANKMTFATIKGGGHTAEYN-PDQCSLMFKRWIDGESL 466



>gb:AC069472_1540870 Arabidopsis thaliana chromosome 3 BAC F28J15
            genomic sequence, complete sequence.>gb:BT012565_1641635
            Arabidopsis thaliana At3g12203 gene, complete cds.
          Length = 437

 Score =  182 bits (462), Expect = 2e-44
 Identities = 130/446 (29%), Positives = 207/446 (46%), Gaps = 6/446 (1%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            I +LPG          +GYI V ++    +FY+F +++S+P   PL+LWL+GGP CSS  
Sbjct: 30   IRFLPGFQGPLPFELETGYIGVGEAEKDQMFYYFIKSESNPEKDPLLLWLSGGPFCSSF- 88

Query: 1398 YGAAAELGPLRVKR---NG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
                 E GP+  K    NG    L    Y+W K A++L+++ PVG GFSY+         
Sbjct: 89   TALIYENGPIAFKAEEYNGSIPSLVSTTYAWTKVASILYLDQPVGTGFSYSRNPLADIPS 148

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
                VA+    FL  WL++ P+F  +  ++AG SY+G  +P + + + + N      P+I
Sbjct: 149  DTG-VAKPVNEFLHKWLDKHPEFLSNPLYVAGNSYSGIVIPTIVQEISNGNH-LDSKPQI 206

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NL+GF++GNP T+   D    + +A   A+ISD+ Y+  K  C   Q N+          
Sbjct: 207  NLQGFVLGNPATDTDIDLNSRIPFAHGKALISDEHYESLKRSC---QGNYIS-------- 255

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
                       N    +CL         + G+ +  +   +  + Y  M  +        
Sbjct: 256  ----------VNPRNTKCLKLLEDFKKCVSGISEEYILKPDCMWLYSCMANL-------- 297

Query: 693  SPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGL 514
               +E + N   V+KA   N    G+   W  C+  +  AY     S +P ++ +   G 
Sbjct: 298  HSLSEYWANEKSVRKALLVN---EGTVRKWIRCNTEI--AYNKDIRSSVPYHKYISIEGY 352

Query: 513  KIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRG 337
            +  ++SGD D  VP +G++  I +L   +   WR W   +QV G    Y + +TF TV+G
Sbjct: 353  RSLVFSGDHDMLVPFLGTQAWIRSLNYSIVDDWRPWMVQNQVAGYTRTYANKMTFATVKG 412

Query: 336  AGHLVPLNKPSEALALIHSFLSGEEL 259
             GH     KP E   +I  +LSG+ L
Sbjct: 413  GGHTSEY-KPVETYIMIKRWLSGQPL 437



>pir|T48977|T48977 carboxypeptidase-like protein F14D17.80 [imported]
            - Arabidopsis thaliana>gb:ATF14D17_1548524 Arabidopsis
            thaliana DNA chromosome 3, BAC clone
            F14D17.>gb:AY050427_1562204 Arabidopsis thaliana
            AT3g45010/F14D17_80 mRNA, complete
            cds.>gb:AY093993_1575499 Arabidopsis thaliana
            AT3g45010/F14D17_80 mRNA, complete cds.
          Length = 510

 Score =  181 bits (458), Expect = 5e-44
 Identities = 130/440 (29%), Positives = 211/440 (47%), Gaps = 7/440 (1%)
 Frame = -2

Query: 1563 GQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAA 1384
            G PS     H +GY  +  S    +FY+FFE++++ ++ P+V+WL GGPGCSS       
Sbjct: 92   GSPSVQDFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSS-ELALFY 149

Query: 1383 ELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTY 1204
            E GP  V  N   L +N++ W+K +NL++V+ PVG GFSYT+         D  V+ D Y
Sbjct: 150  ENGPFTVSNNS-SLSWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEDG-VSNDLY 207

Query: 1203 NFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNP 1024
            +FL  + +  PQF  +DF+I GESYAGHY+P LA  V   N+++     INLKGF +GN 
Sbjct: 208  DFLQAFFKEHPQFVKNDFYITGESYAGHYIPALASRVHRGNKNKE-GTHINLKGFAIGNG 266

Query: 1023 ETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDI 844
             TN    Y    +YA    +I+   +D         Q++                +E   
Sbjct: 267  LTNPEIQYGAYADYALDMNLITQSDHDNLNRYYATCQQS---------------IKECSA 311

Query: 843  YNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEEYFN 667
                G  C    +SS T    +    +        Y   K+  G    CY     E + N
Sbjct: 312  DGGEGDAC----ASSYTVCNNIFQKIMDIAGNVNYYDVRKQCEGSL--CYDFSNMENFLN 365

Query: 666  RIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSGD 490
            +  V+KA           + + +CS  V+ A +      L V    L++ G+K+ +Y+G+
Sbjct: 366  QKSVRKALGVG------DIEFVSCSTAVYEAMQMDWMRNLEVGIPALLQDGIKLLVYAGE 419

Query: 489  ADGRVPVIGSRYCIEALKLPLKSPWRSW----FH-NHQVGGRIVEYHGLTFVTVRGAGHL 325
             D     +G+   +  ++   +  + +     FH +++  G +  Y  LTF+ V  AGH+
Sbjct: 420  YDLICNWLGNSKWVHEMEWSGQKEFVAAATVPFHVDNKEAGLMKNYGSLTFLKVHDAGHM 479

Query: 324  VPLNKPSEALALIHSFLSGE 265
            VP+++P  AL ++ +++ G+
Sbjct: 480  VPMDQPKAALQMLQNWMQGK 499



>gb:AY057639_1564052 Arabidopsis thaliana AT3g45010/F14D17_80 mRNA,
            complete cds.
          Length = 510

 Score =  180 bits (457), Expect = 7e-44
 Identities = 130/440 (29%), Positives = 210/440 (47%), Gaps = 7/440 (1%)
 Frame = -2

Query: 1563 GQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAA 1384
            G PS     H +GY  +  S    +FY+FFE++++ ++ P+V+WL GGPGCSS       
Sbjct: 92   GSPSVQDFGHHAGYYKLPNSKAARMFYFFFESRTNKAD-PVVIWLTGGPGCSS-ELALFY 149

Query: 1383 ELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTY 1204
            E GP  V  N   L +N++ W+K +NL++V+ PVG GFSYT+         D  V+ D Y
Sbjct: 150  ENGPFTVSNNS-SLSWNEFGWDKASNLIYVDQPVGTGFSYTSDQSDLRHDEDG-VSNDLY 207

Query: 1203 NFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNP 1024
            +FL  + +  PQF  +DF+I GESYAGHY+P LA  V   N+++     INLKGF +GN 
Sbjct: 208  DFLQAFFKEHPQFVKNDFYITGESYAGHYIPALASRVHRGNKNKE-GTHINLKGFAIGNG 266

Query: 1023 ETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDI 844
             TN    Y    +YA    +I+   +D         Q++                +E   
Sbjct: 267  LTNPEIQYGAYADYALDMNLITQSDHDNLNRYYATCQQS---------------IKECSA 311

Query: 843  YNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEEYFN 667
                G  C    +SS T    +    +        Y   K+  G    CY     E + N
Sbjct: 312  DGGEGDAC----ASSYTVCNNIFQKIMDIAGNVNYYDVRKQCEGSL--CYDFSNMENFLN 365

Query: 666  RIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSGD 490
            +  V+KA           + + +CS  V+ A +      L V    L++ G+K+ +Y+G+
Sbjct: 366  QKSVRKALGVG------DIEFVSCSTAVYEAMQMDWMRNLEVGIPALLQDGIKLLVYAGE 419

Query: 489  ADGRVPVIGSRYCIEALKLPLKSPWRSW----FH-NHQVGGRIVEYHGLTFVTVRGAGHL 325
             D     +G+   +  ++   +  + +     FH  ++  G +  Y  LTF+ V  AGH+
Sbjct: 420  YDLICNWLGNSKWVHEMEWSGQKEFVAAATVPFHVGNKEAGLMKNYGSLTFLKVHDAGHM 479

Query: 324  VPLNKPSEALALIHSFLSGE 265
            VP+++P  AL ++ +++ G+
Sbjct: 480  VPMDQPKAALQMLQNWMQGK 499



>gb:AB005243_1509545 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MRN17.
          Length = 505

 Score =  180 bits (456), Expect = 9e-44
 Identities = 124/439 (28%), Positives = 217/439 (49%), Gaps = 8/439 (1%)
 Frame = -2

Query: 1557 PSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAEL 1378
            PS     H++GY ++  S    +FY+FFE+++  ++ P+V+WL GGPGCSS       E 
Sbjct: 91   PSVQEFGHYAGYYSLPHSKSAKMFYFFFESRNKTTD-PVVIWLTGGPGCSS-SVAMFYEN 148

Query: 1377 GPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNF 1198
            GP ++ ++ + L++N + W+K +N+++V+ PVG GFSYT+         D  V+ D Y+F
Sbjct: 149  GPFKISKD-LSLYWNDFGWDKVSNIIYVDQPVGTGFSYTSDESDIRNDEDG-VSNDLYDF 206

Query: 1197 LVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPET 1018
            L  + +  P+F  +DFFI GESYAGHY+P LA  V   N+ +   P INLKGF +GN  T
Sbjct: 207  LQAFFKEHPKFVKNDFFITGESYAGHYIPALASRVHSGNKKKEGIP-INLKGFAIGNGLT 265

Query: 1017 NDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQ-ENWSDKCNEAMSIVFTKYEEIDIY 841
            N    Y    +YA    +IS+  ++  K+  D+ + +N + KC+    +V     E+   
Sbjct: 266  NPEIQYGAYGDYALQMKLISESDHESLKQ--DYVECQNITKKCSLGGGLVCDSAVEV--- 320

Query: 840  NIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEEYFNR 664
                                + +  +  K     Y   K+  G    CY     E + N+
Sbjct: 321  -----------------CTSIFNKIVAKKSGLNYYDIRKKCVGSL--CYDFSRMEIFLNK 361

Query: 663  IDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSGDA 487
             +V+KA           + + +CS  V+ A        L V    L+  G+ + +Y+G+ 
Sbjct: 362  ENVRKALGV------GDIKFVSCSSTVYDAMIEDWMQNLEVKIPSLVNDGINLLVYAGEY 415

Query: 486  DGRVPVIGSRYCIEALKLPLKSPWR-----SWFHNHQVGGRIVEYHGLTFVTVRGAGHLV 322
            D     +G+   ++ +    +  +      S+  + +  G +  +  LTF+ V  AGH+V
Sbjct: 416  DLICNWLGNSRWVDQMNWSGQKGFGSAKNVSFLVDGKEAGLLKNHGPLTFLKVYNAGHMV 475

Query: 321  PLNKPSEALALIHSFLSGE 265
            P+++P  +L ++ +++ G+
Sbjct: 476  PMDQPKASLQMLQNWMQGK 494



>gb:CR548612_1375165 Paramecium tetraurelia macronuclear largest
            chromosome, complete sequence.
          Length = 493

 Score =  180 bits (456), Expect = 9e-44
 Identities = 140/468 (29%), Positives = 210/468 (44%), Gaps = 42/468 (8%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWF----FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLR 1366
            +SGY+           Y+F    FE      N P++LWLNGGPGCSS+  GA  E GP  
Sbjct: 44   YSGYLKAIDDDKTYFHYYFMTSTFEDDFTEENTPVMLWLNGGPGCSSL-QGAVNENGPFV 102

Query: 1365 VKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             K      + NK++W K A++L++ESP  VG+SY N            VA      LV++
Sbjct: 103  FKDGTAEFYENKWAWTKFAHMLYLESPAKVGYSYGNGNVNDDT-----VAIQNLRALVDF 157

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN-----PE 1021
             ERFP+++  DFFIAGESYAG Y+P LA  +   N        I+LKG ++GN      E
Sbjct: 158  FERFPEYQAKDFFIAGESYAGIYIPLLANQILKHNEQHPD-KAIHLKGIMIGNGCTHPTE 216

Query: 1020 TNDYYDYKGL--LEYAWSHAIISDQQYDKAKEVCDFTQ----ENWSDKCNEAMSIVFTKY 859
             +D  D   +  +E+      +S++QY  A+ + +  +     N    C E +  V  +Y
Sbjct: 217  CSDVADLYPIHTIEFFARQGFLSEEQYKVAQHLQNSGKCSDLHNLHGDCFEFLDQVVNQY 276

Query: 858  EE------IDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPC 697
             E      ++ YNIYG                        K   +  R+   +   + P 
Sbjct: 277  YESPSVFLMNPYNIYG-------------------YCYNYKPEQFLLRKNDPMLKKFKPK 317

Query: 696  YSPYAEEYFNRIDVQKAFHANIRAPG---------STVNWKTCSDPVFRAYKYTTFSLLP 544
                 EE+ +  D  K  +   R P           +  W  C+D     Y+        
Sbjct: 318  NRQNDEEFGSCTD-DKGLYVLFRDPKWKQITHIKPDSSEWDVCTDDDDFVYEKFERQSYY 376

Query: 543  VYEKLIKGG-LKIWIYSGDADGRVPVIGSRYCIEALKLPLK----SPWRSWF-------H 400
            +YE LIK   ++I  +SGD D  VP+ G+ + I+ L+  L+      WR+W+        
Sbjct: 377  IYESLIKSKKIRIMHFSGDIDSVVPITGTLFWIQLLQNELQLSTTENWRAWYVPGERTVD 436

Query: 399  NHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELP 256
              Q  G +    GL FVTVR AGH+VP ++  EA  ++  F+  ++LP
Sbjct: 437  KQQNAGSVFSIEGLQFVTVRDAGHMVPTDRRKEAYWMVKYFILDQKLP 484



>pir|C96759|C96759 protein serine carboxypeptidase T18K17.3 [imported]
            - Arabidopsis thaliana>gb:AE005173_894877 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC010556_1536958 Arabidopsis thaliana
            chromosome 1 BAC T18K17 genomic sequence, complete
            sequence.
          Length = 441

 Score =  179 bits (453), Expect = 2e-43
 Identities = 129/447 (28%), Positives = 205/447 (45%), Gaps = 7/447 (1%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + +LPG          +GYI + +     LFY+F +++ +P   PL+LWL GGPGCSSI 
Sbjct: 33   VKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPGCSSIS 92

Query: 1398 YGAAAELGPLRVK---RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G   E GPL +K    NG    L    YSW K ++++F++ PVG GFSY+         
Sbjct: 93   -GLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSRTQQFNKPS 151

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
                 A+  + FL  WL +  +F  + F++AG+SY+G  VP   + +   N +    P I
Sbjct: 152  DSG-EAKRIHEFLQKWLGKHQEFSSNPFYVAGDSYSGLVVPATVQEISKGNYE-CCNPPI 209

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NL+G+++GNP T+   D    + +A   A+ISD+ Y+  K+ C     N   +  + +  
Sbjct: 210  NLQGYVLGNPLTDYAIDSNSRIPFAHGMALISDELYESLKKTCKGEYTNVHPRNTQCLKF 269

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLD-LALTNKERTYAYRRMKRIPGGYDPC 697
            +    EE             N  ++    + +LD L  T     Y YR +          
Sbjct: 270  I----EE------------FNKCTNRILQQLILDPLCETETPDCYIYRYL---------- 303

Query: 696  YSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGG 517
                   + N   V++A   N  + G    W  C   +   Y     S +P +      G
Sbjct: 304  ---LTTYWANDATVREALQINKESIG---EWVRCYRTI--PYDNDIKSSMPYHVNNSISG 355

Query: 516  LKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVR 340
             +  IYSGD D  VP +G++  I +L   +   WR W   +Q+ G    Y + +TF T++
Sbjct: 356  YRSLIYSGDHDLEVPYLGTQAWIRSLNYSIIDDWRPWMIKNQIAGYTRTYANKMTFATIK 415

Query: 339  GAGHLVPLNKPSEALALIHSFLSGEEL 259
            G GH +   KP EA  +   +++G+ L
Sbjct: 416  GGGHTIEF-KPEEASIMFQRWINGQPL 441



>gb:AY072822_1567406 Gossypium hirsutum putative serine
            carboxypeptidase precursor (SCP) mRNA, complete cds.
          Length = 507

 Score =  176 bits (446), Expect = 1e-42
 Identities = 135/456 (29%), Positives = 217/456 (47%), Gaps = 10/456 (2%)
 Frame = -2

Query: 1605 PKAAQESDKIGYL--PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLW 1432
            PK  ++  K   L  PG  S   L H +GY  +  SH   +FY+FFE+++   + P+V+W
Sbjct: 72   PKLVEKRFKFPTLEVPGGVSFEDLGHHAGYYKLPNSHDARMFYFFFESRNSKKD-PVVIW 130

Query: 1431 LNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            L GGPGCSS       E GP  +  N + L +N+Y W+K +NLL+V+ P+G GFSY++  
Sbjct: 131  LTGGPGCSS-ELALFYENGPFTIADN-MSLVWNEYGWDKASNLLYVDQPIGTGFSYSSDQ 188

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                   D+ V+ D Y+FL  +    P+F  +DFFI GESYAGHY+P  A  V   N+ +
Sbjct: 189  RDIRHNEDE-VSNDLYDFLQAFFAEHPEFAKNDFFITGESYAGHYIPAFAARVHRGNKAK 247

Query: 1071 -GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDK 895
             GI+  INLKGF +GN  T+    YK   +YA    +I    +D+  ++           
Sbjct: 248  EGIH--INLKGFAIGNGLTDPAIQYKAYTDYALDMGVIKKSDHDRINKLVPV-------- 297

Query: 894  CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP 715
            C  A+ +  T      + + +    + NG  +  G              T  Y   K+  
Sbjct: 298  CEMAIKLCGTDGTISCMASYFVCNNIFNGIMALAG-------------DTNYYDVRKKCE 344

Query: 714  GGYDPCYS-PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV- 541
            G    CY     E + N+  V+ A           +++ +CS  V++A        L V 
Sbjct: 345  GSL--CYDFSNMESFLNKKSVRDALGV------GNIDFVSCSPTVYQAMLVDWMRNLEVG 396

Query: 540  YEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL-----KLPLKSPWRSWFHNHQVGGRI 376
               L++ G+K+ +Y+G+ D     +G+   + A+     K  + SP   +  +    G +
Sbjct: 397  IPVLLEDGIKLLVYAGEYDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFIVDGAEAGVL 456

Query: 375  VEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
              +  L F+ V  AGH+VP+++P  AL ++  +  G
Sbjct: 457  KTHGALGFLKVHDAGHMVPMDQPKAALEMLKRWTKG 492



>pir|D84619|D84619 probable serine carboxypeptidase I [imported] -
            Arabidopsis thaliana>gb:AC004401_1531649 Arabidopsis
            thaliana chromosome 2 clone F21P24 map CIC06C07, complete
            sequence.
          Length = 437

 Score =  175 bits (444), Expect = 2e-42
 Identities = 122/437 (27%), Positives = 204/437 (46%), Gaps = 13/437 (2%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKR-- 1357
            +GYI + +     LFY+F +++++P   PL+LWL+GGPGCSS+G G   E GP+ +K   
Sbjct: 41   TGYIGIGEEEDIQLFYYFIKSENNPKEDPLLLWLDGGPGCSSLG-GLLFENGPVALKSAV 99

Query: 1356 ---NGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
               +   L    YSW K AN+++++ PVG GFSY+           +   +  + FL  W
Sbjct: 100  YNGSNPSLFSTTYSWTKMANIIYLDQPVGSGFSYSRTPIGKSSDTSE--VKRIHEFLQKW 157

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY----PRINLKGFIVGNPET 1018
            L + PQF  + F++ G+SY+G  VP L + +      +G Y      INL+G+++GNP T
Sbjct: 158  LSKHPQFFSNPFYVTGDSYSGMIVPALVQEI-----SKGNYICCKHLINLQGYVLGNPIT 212

Query: 1017 NDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKY---EEID 847
               ++    + ++   ++ISD+ Y+  K  C    EN   +  + + +V   +   ++I+
Sbjct: 213  YAEHEKNYRIPFSHGMSLISDELYESLKRNCKGNYENVDPRNTKCVRLVEEYHKCTDKIN 272

Query: 846  IYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFN 667
              +I  P C   G    +                         P  Y   Y    E + N
Sbjct: 273  TQHILIPDCDKKGHGITS-------------------------PDCYYYLYF-LIECWAN 306

Query: 666  RIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDA 487
               V++A H      G+   W+ C+  +   Y     S +P +      G +  IYSGD 
Sbjct: 307  NERVREALHV---TKGTKGQWQRCNWTI--PYDNNIISSVPYHMDNSINGYRSLIYSGDH 361

Query: 486  DGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNK 310
            D  +P   ++  I++L   +   WR W  N Q+ G    Y + +TF TV+G GH      
Sbjct: 362  DITMPFQATQAWIKSLNYSIVDDWRPWMINDQIAGYTRTYSNKMTFATVKGGGHTAEY-L 420

Query: 309  PSEALALIHSFLSGEEL 259
            P+E+  +   ++SG+ L
Sbjct: 421  PNESSIMFQRWISGQPL 437



>gb:AE016818_1748170 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 524

 Score =  175 bits (443), Expect = 3e-42
 Identities = 131/451 (29%), Positives = 210/451 (46%), Gaps = 19/451 (4%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P +     +  +SGY+       +  FYWFFE+++ P+N P++LWLNGGPGCSS   G  
Sbjct: 102  PAKLGVDTVKQWSGYLDYKDE--KHFFYWFFESRNDPANDPVMLWLNGGPGCSSFT-GLL 158

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             ELGP  + ++   +H N +SWN  A+++F+E PVGVGFSY +               D 
Sbjct: 159  FELGPASIGKDLKPVH-NPHSWNNNASVIFLEQPVGVGFSYGDSVDSTAVAGA-----DV 212

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVG 1030
            Y FL  + ++FP    +DF IAGESYAGHY+PQ+A E++  +  +    P  NL   ++G
Sbjct: 213  YAFLRLFFQKFPHLAKNDFHIAGESYAGHYIPQIAHEIITSKEENSEEIPNFNLTSVLIG 272

Query: 1029 NPETNDYYDYKGLLEYAWSH----AIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTK 862
            N  T+    YK     A       A++++ Q  +            S +C+  M++ +  
Sbjct: 273  NGFTDPRTQYKYYEPMACGKGGVPAVLNEDQCSRMNAS--------SSRCDRLMNLCYLT 324

Query: 861  YEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS--P 688
               I         CL         I  V +    N    Y  RR    P   D CY    
Sbjct: 325  NRAIP--------CLAATVYCERYITQVYEETGLNY---YDMRRKCESPDS-DLCYRGLD 372

Query: 687  YAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGG 517
            Y ++Y N+ +VQ+A  + +        ++ C+  V   +  +     P  +   +L+   
Sbjct: 373  YVQQYMNQKEVQEALGSEVEL------YEGCNKRVGARFALSGDHGKPFQQYVSQLLDRA 426

Query: 516  LKIWIYSGDAD---------GRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYH 364
            + + IY+GD D              +G R+  +   LPLK PW +  +  +  G +  + 
Sbjct: 427  IPVLIYAGDKDYICNWLGNKAWSDEVGWRHTYKYRTLPLK-PWVNK-NTGKTAGEVKSFG 484

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLS 271
             LTF+ V  AGH+VP ++P  +  +I S+L+
Sbjct: 485  ALTFLRVYDAGHMVPYDQPESSAYMIESWLN 515



>gb:AY436353_1606115 Aspergillus fumigatus carboxypeptidase 3 gene,
            complete cds.
          Length = 543

 Score =  175 bits (443), Expect = 3e-42
 Identities = 135/462 (29%), Positives = 219/462 (47%), Gaps = 34/462 (7%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +  ++GY+  N++  + LFYWFFE+++ P N P+VLWLNGGPGCSS+  G   ELGP 
Sbjct: 135  PGVKQYTGYLDDNEND-KHLFYWFFESRNDPKNDPVVLWLNGGPGCSSL-TGLFLELGPS 192

Query: 1368 RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVN 1189
             +    +   +N ++WN  A+++F++ PV VG+SY+           K    D Y  L  
Sbjct: 193  SINEK-IKPIYNDFAWNSNASVIFLDQPVNVGYSYSGAAVSDTVAAGK----DVYALLTL 247

Query: 1188 WLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETN-- 1015
            + ++FP++   DF IAGESYAGHY+P  A  +    +       INLK  ++GN  T+  
Sbjct: 248  FFKQFPEYAKQDFHIAGESYAGHYIPVFASEILSHKK-----RNINLKSVLIGNGLTDGL 302

Query: 1014 ---DYY--------DYKGLLEYAWSHAIISDQQYDKAK---EVCDFTQENW-----SDKC 892
               DYY         Y  +L+ +   ++  D    + K   E C  T+ +W     S  C
Sbjct: 303  TQYDYYRPMACGEGGYPAVLDESSCQSM--DNALPRCKSMIESCYNTESSWICVPASIYC 360

Query: 891  NEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPG 712
            N A+   + +  +    N+Y  R     SS+                    Y+ M     
Sbjct: 361  NNALLGPYQRTGQ----NVYDIRGKCEDSSN------------------LCYKGM----- 393

Query: 711  GYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEK 532
                    Y  EY N+ +V++A  A +        +++C+  + R + +    + P Y +
Sbjct: 394  -------GYVSEYLNKREVREAVGAEVD------GYESCNFDINRNFLFHGDWMKP-YHR 439

Query: 531  LIKGGLK---IWIYSGDADGRVPVIGSRYCIEALK---------LPLKS-PWRSWFHNHQ 391
            L+ G L+   + IY+GDAD     +G++   EAL+         LPLK        H  +
Sbjct: 440  LVPGLLEQIPVLIYAGDADFICNWLGNKAWTEALEWPGQKEYAPLPLKDLVIEENEHKGK 499

Query: 390  VGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
              G+I  +   TF+ + GAGH+VP+++P  +L   + +L GE
Sbjct: 500  KIGQIKSHGNFTFMRLYGAGHMVPMDQPEASLEFFNRWLGGE 541



>sp|P52710|CBPY_PICPA Carboxypeptidase Y precursor (EC 3.4.16.5)
            (Carboxypeptidase YSCY).>pir|S61713|S61713
            carboxypeptidase C (EC 3.4.16.5) precursor - yeast
            (Pichia pastoris)>gb:PPPRC1GEN_1701431 P.pastoris PRC1
            gene.
          Length = 523

 Score =  174 bits (442), Expect = 4e-42
 Identities = 128/440 (29%), Positives = 204/440 (46%), Gaps = 17/440 (3%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+ V ++  +  FYWFFE+++ P N P++LWLNGGPGCSS+  G   ELG  R+  N
Sbjct: 123  YSGYLDV-EADDKHFFYWFFESRNDPQNDPIILWLNGGPGCSSL-TGLFFELGSSRINEN 180

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               + FN YSWN  A++++++ PV VGFSY++              +D Y FL  + + F
Sbjct: 181  LKPI-FNPYSWNGNASIIYLDQPVNVGFSYSSSSVSNTV----VAGEDVYAFLQLFFQHF 235

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYK 997
            P+++ +DF IAGESYAGHY+P  A E++  +NR+       NL   ++GN  T+    Y+
Sbjct: 236  PEYQTNDFHIAGESYAGHYIPVFADEILSQKNRN------FNLTSVLIGNGLTDPLTQYR 289

Query: 996  GLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCL 817
                 A               E    TQ    DKC   +S++   Y+    +        
Sbjct: 290  YYEPMACGEGGAPSVLPADECENMLVTQ----DKC---LSLIQACYDSQSAFTCAPAAIY 342

Query: 816  LNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS--PYAEEYFNRIDVQKAF 643
             N +      R       T K     Y   K   GG   CY    + + Y N+  VQ A 
Sbjct: 343  CNNAQMGPYQR-------TGKN---VYDIRKECDGG-SLCYKDLEFIDTYLNQKFVQDAL 391

Query: 642  HANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKIWIYSGDADGRVP 472
             A +        +++C+  + R + +    + P +E    L+  GL + IY+GD D    
Sbjct: 392  GAEVD------TYESCNFEINRNFLFAGDWMKPYHEHVSSLLNKGLPVLIYAGDKDFICN 445

Query: 471  VIGSRYCIEALKLPLKSPW-----------RSWFHNHQVGGRIVEYHGLTFVTVRGAGHL 325
             +G+R   + L      PW           + W  N +  G    Y   T++ V  AGH+
Sbjct: 446  WLGNRAWTDVL------PWVDADGFEKAEVQDWLVNGRKAGEFKNYSNFTYLRVYDAGHM 499

Query: 324  VPLNKPSEALALIHSFLSGE 265
             P ++P  +  +++ ++SG+
Sbjct: 500  APYDQPENSHEMVNRWISGD 519



>pir|E84619|E84619 probable serine carboxypeptidase I [imported] -
            Arabidopsis thaliana>gb:AC004401_1531650 Arabidopsis
            thaliana chromosome 2 clone F21P24 map CIC06C07, complete
            sequence.
          Length = 437

 Score =  174 bits (441), Expect = 5e-42
 Identities = 133/455 (29%), Positives = 209/455 (45%), Gaps = 15/455 (3%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + +LPG          +GYI + +      FY+F ++  +P   PL++WLNGGPGCS + 
Sbjct: 25   VKFLPGFKGPLPFELETGYIGIGEEENVQFFYYFIKSDKNPQEDPLIIWLNGGPGCSCLS 84

Query: 1398 YGAAAELGPLRVKR---NG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G   E GPL +K    NG    L    YSW K AN++F++ PVG GFSY+         
Sbjct: 85   -GLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANIIFLDQPVGSGFSYSKTPIERTSD 143

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY--- 1063
              +   +  + FL  WL + PQF  + F++ G+SY+G  VP L   +      +G Y   
Sbjct: 144  TSE--VKKIHEFLQKWLIKHPQFLSNPFYVVGDSYSGMIVPALVHEI-----SKGNYICC 196

Query: 1062 -PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDK 895
             P INL+G+++GNP T+  ++    + YA   ++ISD+ Y+  K +C    F+ +  + K
Sbjct: 197  NPPINLQGYVLGNPITHIEFEQNFRIPYAHGMSLISDELYESLKRICKGNYFSVDPSNKK 256

Query: 894  CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP 715
            C           + ++ Y+    +C  N +S  T I    D   +N +            
Sbjct: 257  C----------LKLVEEYH----KCTDNINSHHTLIANCDD---SNTQHI---------- 289

Query: 714  GGYDPCYSPY--AEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV 541
               D  Y PY   E + N   V++A H +    GS   W    D     YK    S +P 
Sbjct: 290  -SPDCYYYPYHLVECWANNESVREALHVD---KGSIGEW--IRDHRGIPYKSDIRSSIPY 343

Query: 540  YEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-H 364
            +      G +  I+SGD D  +P   ++  I++L   +   WR W    Q+ G    Y +
Sbjct: 344  HMNNSINGYRSLIFSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMIKGQIAGYTRTYSN 403

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
             +TF TV+G GH      P E+  +   ++SG+ L
Sbjct: 404  KMTFATVKGGGHTAEY-LPEESSIMFQRWISGQPL 437



>sp|P32826|CBPX_ARATH Serine carboxypeptidase precursor (EC
            3.4.16.-).>gb:AC011560_1537258 Arabidopsis thaliana
            chromosome 3 BAC F13M14 genomic sequence, complete
            sequence.>gb:AY091767_1574727 Arabidopsis thaliana
            AT3g10410/F13M14_32 mRNA, complete
            cds.>gb:AY149954_1584903 Arabidopsis thaliana
            At3g10410/F13M14_32 mRNA, complete cds.
          Length = 516

 Score =  174 bits (441), Expect = 5e-42
 Identities = 129/461 (27%), Positives = 222/461 (48%), Gaps = 23/461 (4%)
 Frame = -2

Query: 1563 GQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAA 1384
            G P+   L H +GY  + +S G ++FY+FFE+++   + P+V+WL GGPGCSS       
Sbjct: 90   GGPTVDDLGHHAGYYKLPKSRGASMFYFFFESRNK-KDAPVVIWLTGGPGCSS-ELAVFY 147

Query: 1383 ELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTY 1204
            E GP ++  N + L +N+Y W++ +NLL+V+ PVG GFSYT             V+ D Y
Sbjct: 148  ENGPFKITSN-MSLAWNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDETG-VSNDLY 205

Query: 1203 NFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR-DRGIYPRINLKGFIVGN 1027
            +FL  +    P+   +DF+I GESYAGHY+P  A  V   N+ + G++  INLKGF +GN
Sbjct: 206  DFLQAFFAEHPKLAKNDFYITGESYAGHYIPAFASRVHKGNKANEGVH--INLKGFAIGN 263

Query: 1026 PETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEID 847
              T+    Y    +YA    +I+ +++D+ +++           C  ++ +  T      
Sbjct: 264  GLTDPALQYPAYPDYALEMGLITQKEHDRLEKIVPL--------CELSIKLCGTDGTTSC 315

Query: 846  IYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEEYF 670
            + +      L +G  S  G     D+              K+  G    CY     E++ 
Sbjct: 316  LASYLVCNSLFSGVMSHAGGVNYYDI-------------RKKCVGSL--CYDFSNMEKFL 360

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSG 493
            N   V+K+           +++ +CS  V++A        L V    L++ G+ + +Y+G
Sbjct: 361  NLQSVRKSLGV------GDIDFVSCSTSVYQAMLVDWMRNLEVGIPTLLEDGISLLVYAG 414

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRS-----WFHNHQVGGRIVEYHGLTFVTVRGAGH 328
            + D     +G+   + A++   K+ + +     +  + +  G +  Y  L+F+ VR AGH
Sbjct: 415  EYDLICNWLGNSRWVNAMEWSGKTNFGAAKEVPFIVDGKEAGLLKTYEQLSFLKVRDAGH 474

Query: 327  LVPLNKPSEALALIHSFL---------------SGEELPAQ 250
            +VP+++P  AL ++  ++                GEEL AQ
Sbjct: 475  MVPMDQPKAALKMLKRWMENSLIEDATVTVAAQGGEELVAQ 515



>gb:CR382129_1662174 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 589

 Score =  174 bits (440), Expect = 7e-42
 Identities = 132/451 (29%), Positives = 219/451 (48%), Gaps = 16/451 (3%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P       +  +SGY+ + +   + LFYWFFE+++ P N P++LWLNGGPGCSS+  G  
Sbjct: 177  PSSLGVDTVQQYSGYVDIEEED-KHLFYWFFESRNDPKNDPVILWLNGGPGCSSM-TGLF 234

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             ELGP  +  + + L  N++SWN+ A+++F++ PV VGFS++              A+D 
Sbjct: 235  FELGPSNINED-LTLSHNEFSWNQNASVIFLDQPVNVGFSHSPNRIKNSRDG----AKDV 289

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVG 1030
              FL  + ++FPQ+K  DF IAGESYAGHY+P +A E+  +R+ +       NL   ++G
Sbjct: 290  NTFLNLFFDKFPQYKDLDFHIAGESYAGHYIPAIATEIQSNRHTN-----NFNLSSLLIG 344

Query: 1029 NPETNDYYDYKGLLEYAWSH----AIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVF-- 868
            N  T+     +G    A       AI+S +  +K  E           KC + + + +  
Sbjct: 345  NGITDSRTQIEGYEPMACGKGGHPAILSPEDCNKIHESV--------PKCQKLIDLCYET 396

Query: 867  -TKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS 691
             T+Y  +   ++Y    + + S S TG+  V D+     E    Y +++           
Sbjct: 397  NTRYACV-APSVYCDNAIFS-SFSKTGL-NVYDIREQCGESALCYSQIE----------- 442

Query: 690  PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVY---EKLIKG 520
             +   Y N+  V +A  A I        ++ C + V   + +      P +     L+  
Sbjct: 443  -WITNYLNQDHVLEALGAEIEV------FEGCKNSVGVDFGFDGDGNRPFHGDIADLLDD 495

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLT 355
            GL I IY+GD D     +G++   +AL+        K+  R+W  N +  G +    GLT
Sbjct: 496  GLPILIYAGDKDFICNWVGNKMWTDALEWTGAEKFGKAEIRNWTVNGENAGEVKTAKGLT 555

Query: 354  FVTVRGAGHLVPLNKPSEALALIHSFLSGEE 262
            ++ V  AGH+VP N+P  AL +++ ++   E
Sbjct: 556  YLRVYEAGHMVPFNQPEVALDMVNRWVGKYE 586



>gb:CR382127_1660225 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 493

 Score =  174 bits (440), Expect = 7e-42
 Identities = 127/437 (29%), Positives = 204/437 (46%), Gaps = 16/437 (3%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+ V +   +  FYWFFE+++ P N P+VLWLNGGPGCSS+  G   ELGP  +  +
Sbjct: 89   YSGYLDV-EDEDKHFFYWFFESRNDPKNDPIVLWLNGGPGCSSLT-GLFFELGPASIGED 146

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               +H N +SWN  A+++F++ PV VG+SY++          +    D Y FL  + ++F
Sbjct: 147  LKPIH-NPHSWNSNASVIFLDQPVNVGYSYSSGSVSDTVSAGR----DVYAFLSLFFQQF 201

Query: 1173 PQF-KGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYK 997
            P++ KG +F IAGESYAGHY+P  A  +   + DRG     NL   ++GN  T+    Y 
Sbjct: 202  PEYNKGQEFHIAGESYAGHYIPVFASEIQSHD-DRGF----NLTSILIGNGLTDPLRQYD 256

Query: 996  GLLEYAWSHAIISDQQYDKAKEVCDF-TQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRC 820
                 A             A  V D  T EN  D       ++   Y    ++       
Sbjct: 257  EYEPMACGKG--------GAPPVLDEPTCENMRDSQARCNGLINACYNTESVWTCLPAAT 308

Query: 819  LLN----GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSP--YAEEYFNRID 658
              N    G   ATG+                Y   K    G   CY    Y ++Y N+ +
Sbjct: 309  YCNNAMLGPYQATGLN--------------VYDIRKECDSGTSLCYKDLEYIDKYLNQPE 354

Query: 657  VQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEK---LIKGGLKIWIYSGDA 487
            V +A  A +        ++ C+  + R +++    + P Y     L++ G+   IY+GD 
Sbjct: 355  VMEAVGAQVS------EYEGCNFDINRNFQFAGDWMKPYYTAVPALLEEGIPTLIYAGDK 408

Query: 486  DGRVPVIGSRYCIEALKLPLKSPWR-----SWFHNHQVGGRIVEYHGLTFVTVRGAGHLV 322
            D     +G++   + L+   K  +       W  + +  G++  Y   TF+ V  AGH+V
Sbjct: 409  DFICNWLGNKRWTDELEWFGKEKYEPKELSDWVVDGKKAGQVKNYKHFTFLRVYEAGHMV 468

Query: 321  PLNKPSEALALIHSFLS 271
            P ++P  +L +++S+L+
Sbjct: 469  PYDQPKNSLEMLNSWLA 485



>gb:ATHCPYLP_1553131 Arabidopsis thaliana carboxypeptidase Y-like
            protein gene, complete cds.
          Length = 539

 Score =  174 bits (440), Expect = 7e-42
 Identities = 123/438 (28%), Positives = 216/438 (49%), Gaps = 8/438 (1%)
 Frame = -2

Query: 1563 GQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAA 1384
            G P+   L H +GY  + +S G ++FY+FFE+++   + P+V+WL GGPGCSS       
Sbjct: 90   GGPTVDDLGHHAGYYKLPKSRGASMFYFFFESRNK-KDAPVVIWLTGGPGCSS-ELAVFY 147

Query: 1383 ELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTY 1204
            E GP ++  N + L +N+Y W++ +NLL+V+ PVG GFSYT             V+ D Y
Sbjct: 148  ENGPFKITSN-MSLAWNEYGWDQVSNLLYVDQPVGTGFSYTTDKSDIRHDETG-VSNDLY 205

Query: 1203 NFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR-DRGIYPRINLKGFIVGN 1027
            +FL  +    P+   +DF+I GESYAGHY+P  A  V   N+ + G++  INLKGF +GN
Sbjct: 206  DFLQAFFAEHPKLAKNDFYITGESYAGHYIPAFASRVHKGNKANEGVH--INLKGFAIGN 263

Query: 1026 PETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEID 847
              T+    Y    +YA    +I+ +++D+ +++           C  ++ +  T      
Sbjct: 264  GLTDPALQYPAYPDYALEMGLITQKEHDRLEKIVPL--------CELSIKLCGTDGTTSC 315

Query: 846  IYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEEYF 670
            + +      L +G  S  G     D+              K+  G    CY     E++ 
Sbjct: 316  LASYLVCNSLFSGVMSHAGGVNYYDI-------------RKKCVGSL--CYDFSNMEKFL 360

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSG 493
            N   V+K+           +++ +CS  V++A        L V    L++ G+ + +Y+G
Sbjct: 361  NLQSVRKSLGV------GDIDFVSCSTSVYQAMLVDWMRNLEVGIPTLLEDGISLLVYAG 414

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRS-----WFHNHQVGGRIVEYHGLTFVTVRGAGH 328
            + D     +G+   + A++   K+ + +     +  + +  G +  Y  L+F+ VR AGH
Sbjct: 415  EYDLICNWLGNSRWVNAMEWSGKTNFGAAKEVPFIVDGKEAGLLKTYEQLSFLKVRDAGH 474

Query: 327  LVPLNKPSEALALIHSFL 274
            +VP+++P  AL ++  ++
Sbjct: 475  MVPMDQPKAALKMLKRWM 492



>pir|B84619|B84619 probable serine carboxypeptidase I [imported] -
            Arabidopsis thaliana>gb:AC004401_1531647 Arabidopsis
            thaliana chromosome 2 clone F21P24 map CIC06C07, complete
            sequence.>gb:AC004786_1532169 Arabidopsis thaliana
            chromosome 2 clone T20K9 map CIC06C07, complete sequence.
          Length = 430

 Score =  174 bits (440), Expect = 7e-42
 Identities = 128/455 (28%), Positives = 205/455 (45%), Gaps = 9/455 (1%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A     + +LPG          +GYI + +     LFY+F +++ +P   PL+LWL+GGP
Sbjct: 20   AHSGSIVKFLPGFEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSGGP 79

Query: 1416 GCSSIGYGAAAELGPLRVK---RNG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            GCSS+  G   E GP+ +K    NG    L    YSW K AN++F++ PVG GFSY+   
Sbjct: 80   GCSSL-TGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRTP 138

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                      V +  Y FL  WL +  QF  + F++ G+SY+G  VP L + +      +
Sbjct: 139  LVDKISDTGEVKR-IYEFLQKWLSKHQQFFSNPFYVGGDSYSGMIVPPLVQEI-----GK 192

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWS 901
            G Y +INL+G+I+GNP T+   +    + YA   A+ISD+ Y   + +C       ++ +
Sbjct: 193  GNY-QINLQGYILGNPITDTESEQNYQIPYAHGMALISDELYKSMERICKGNYVKVDSLN 251

Query: 900  DKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKR 721
             KC + +        +++ Y+I  P C +                       + YR    
Sbjct: 252  TKCYKLIKDYQKCIHKLNKYHILLPDCDITSPD------------------CFLYR---- 289

Query: 720  IPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV 541
                           + N   V++A   N    GS   W  C+     +Y Y   S +  
Sbjct: 290  ---------YTLITFWANNKSVREALQVN---KGSIGKWVQCNYKNI-SYNYDIKSSVAY 336

Query: 540  YEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-H 364
            + K    G +  IY+GD D  VP + ++  I +L   +   W+ W  N Q+ G    Y +
Sbjct: 337  HMKNSIDGYRSLIYNGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQIAGYTRSYSN 396

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
             +TF T++G+GH     KP E   +   ++S + L
Sbjct: 397  KMTFATIKGSGHTAEY-KPKETSIMFKRWISAQPL 430



>pir|JC1380|JC1380 carboxypeptidase C (EC 3.4.16.5) precursor - yeast
            (Candida albicans)
          Length = 542

 Score =  174 bits (440), Expect = 7e-42
 Identities = 129/444 (29%), Positives = 216/444 (48%), Gaps = 21/444 (4%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+ V     +  FY+FFE+++ P N P++LWLNGGPGCSS+  G   ELGP  + +N
Sbjct: 143  YSGYLDV-VDEDKHFFYYFFESRNDPKNDPVILWLNGGPGCSSL-TGLFFELGPSSIDKN 200

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
             +   +N +SWN  A+++F++ P+ VG+SY++          K    D Y FL  + + F
Sbjct: 201  -LKPVYNPHSWNANASVIFLDQPINVGYSYSSQSVSNTIAAGK----DVYAFLQLFFKNF 255

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVF---DRNRDRGIYPRINLKGFIVGNPETNDYYD 1003
            P++   DF IAGESYAGHY+P  A  +    +RN         NL   ++GN  T+    
Sbjct: 256  PEYANLDFHIAGESYAGHYIPAFASEILTHPERN--------FNLTSVLIGNGLTDP--- 304

Query: 1002 YKGLLEYAWSHAIISDQQYDKA---KEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIY 832
               L++Y +   +   +  + +    E CD    N   +C   +S++ + YE   +++  
Sbjct: 305  ---LVQYEYYEPMACGEGGEPSVLEPEECD-GMLNLLPRC---LSLIESCYESGSVWSCV 357

Query: 831  GPRCLLN----GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS--PYAEEYF 670
                  N    G    TG R V D+              + +  G   CYS   Y ++Y 
Sbjct: 358  PATIYCNNGQMGPYQKTG-RNVYDI--------------RTMCEGSSLCYSQLEYIDQYL 402

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEK----LIKGGLKIWI 502
            N  +V+KA  A +        +++C+  + R + +    + P Y+K    L++  L + I
Sbjct: 403  NLPEVKKALGAEVD------EYQSCNFDINRNFMFAGDWMKP-YQKNVIDLLEKELPVLI 455

Query: 501  YSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRG 337
            Y+GD D     +G++     L+        K+P +SW       G +  Y   TF+ V G
Sbjct: 456  YAGDKDFICNWLGNQAWTNRLEWSGSKGFTKAPVKSWKVGKNAAGEVKNYKHFTFLRVFG 515

Query: 336  AGHLVPLNKPSEALALIHSFLSGE 265
             GH+VP ++P  AL +++ ++SG+
Sbjct: 516  GGHMVPYDQPENALDMVNRWISGD 539



>gb:CR380959_1654243 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 508

 Score =  173 bits (439), Expect = 9e-42
 Identities = 124/441 (28%), Positives = 215/441 (48%), Gaps = 16/441 (3%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +   +GY+  N+   +  F+WFFE+++ P N P++LWLNGGPGCSS+  G   ELGP 
Sbjct: 94   PHVKQLTGYLD-NELEDKHFFFWFFESRNDPKNDPVILWLNGGPGCSSL-TGLFFELGPS 151

Query: 1368 RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVN 1189
             +    +    N +SWN  A+++F++ PV VGFSY                +D Y FL  
Sbjct: 152  SIDGQKLKPVKNPFSWNSNASVIFLDQPVNVGFSYAGSNSNGGVSNTVAAGKDVYAFLQL 211

Query: 1188 WLERFPQF-KGHDFFIAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVGNPETN 1015
            + ++FPQ+  G DF IAGESYAGHY+P  A E++    ++R      NL   ++GN  T+
Sbjct: 212  FFKQFPQYADGQDFHIAGESYAGHYIPVFASEILAHPQKER----HFNLTSVLIGNGLTD 267

Query: 1014 DYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNI 835
                Y+     A      +D     + E C    E+  D+C   +S++   Y+   ++  
Sbjct: 268  PLTQYRYYKPMACGEGSGADPVL--SPEECS-AMEDSLDRC---LSLIDACYQSESVWAC 321

Query: 834  YGPRCLLNGSSSA----TGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFN 667
                   N +  A    TG R V D+    +  +  Y  ++ I            ++Y N
Sbjct: 322  VPASIYCNNAQLAPYQRTG-RNVYDVRKDCEGGSLCYPELQNI------------DDYLN 368

Query: 666  RIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI---KGGLKIWIYS 496
               V++A  A +       ++++C+  + R + +    + P ++++I   + GL + IY+
Sbjct: 369  MDYVREAVGAEVD------HYESCNFDINRNFLFNGDWMKPYHKQVIEILEKGLPVLIYA 422

Query: 495  GDADGRVPVIGSRYCIEALKLPLKS-----PWRSWFHN--HQVGGRIVEYHGLTFVTVRG 337
            GD D     +G+R   + L+    S     P R+W  +   +V G +  Y  LTF+ +  
Sbjct: 423  GDKDFICNWMGNRAWTDELQWKYSSGFAQEPVRNWTASITGEVAGEVKSYENLTFLRLFD 482

Query: 336  AGHLVPLNKPSEALALIHSFL 274
             GH+VP ++P  +L++++ ++
Sbjct: 483  GGHMVPYDQPESSLSMLNEWI 503



>gb:AC010556_1536957 Arabidopsis thaliana chromosome 1 BAC T18K17
            genomic sequence, complete sequence.
          Length = 441

 Score =  173 bits (439), Expect = 9e-42
 Identities = 130/447 (29%), Positives = 199/447 (44%), Gaps = 7/447 (1%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + +LPG          +GYI V +     LFY+F +++ +P   PL+LWL GGPGCS+I 
Sbjct: 33   VKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPGCSAIS 92

Query: 1398 YGAAAELGPLRVK---RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G   + GPL +K    NG    L    YSW K ++++F++ PVG GFSY+         
Sbjct: 93   -GLLYQNGPLAMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSRTQLFNKPS 151

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
                 A+  + FL  WL +  +F  + F++ G+SY+G  VP   + +   N      P I
Sbjct: 152  DTG-EAKRIHEFLQKWLGKHQEFSSNPFYVGGDSYSGLVVPATVQEISKGNCQCCNRP-I 209

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NL+G+++GNP T+  YD    + +A   A+ISD+ Y+  K  C     N      E +  
Sbjct: 210  NLQGYVLGNPLTDCVYDCNYRVPFAHKMALISDELYESLKRTCRGEYVNVHPHDTECLKF 269

Query: 873  VFTKYEEID-IYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPC 697
            V    EE + + N    R +L+                T     Y+YR M          
Sbjct: 270  V----EEFNKLTNRVCERHILHSCCE------------TETPSCYSYRFM---------- 303

Query: 696  YSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGG 517
                   + N   V+KA   N  + G    W  C   +   Y +   S +P +      G
Sbjct: 304  ---LTTYWANDETVRKALQINKESIG---EWTRCYRGI--PYNHDIKSSVPYHMNNSIDG 355

Query: 516  LKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVR 340
             +  IYSGD D +VP +G++  I +L   +   WR W    Q+ G    Y + +TF TV 
Sbjct: 356  YRSLIYSGDHDIQVPFLGTQAWIRSLNYSIIDDWRPWMIKDQIAGYTTSYVNKMTFATVT 415

Query: 339  GAGHLVPLNKPSEALALIHSFLSGEEL 259
            G GH      P E   +   +++G+ L
Sbjct: 416  GGGHTAEFT-PKETFMMFQRWINGQPL 441



>sp|P30574|CBPY_CANAL Carboxypeptidase Y precursor (EC 3.4.16.5)
            (Carboxypeptidase YSCY).>gb:YSACARPEPY_1728079 Candida
            albicans carboxypeptidase Y precursor (CPY1) gene,
            complete cds.
          Length = 542

 Score =  173 bits (439), Expect = 9e-42
 Identities = 127/444 (28%), Positives = 214/444 (48%), Gaps = 21/444 (4%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+ V     +  FY+FFE+++ P N P++LWLNGGPGCSS+  G   ELGP  + +N
Sbjct: 143  YSGYLDV-VDEDKHFFYYFFESRNDPKNDPVILWLNGGPGCSSL-TGLFFELGPSSIDKN 200

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
             +   +N +SWN  A+++F++ P+ VG+SY++          K    D Y FL  + + F
Sbjct: 201  -LKPVYNPHSWNANASVIFLDQPINVGYSYSSQSVSNTIAAGK----DVYAFLQLFFKNF 255

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVF---DRNRDRGIYPRINLKGFIVGNPETNDYYD 1003
            P++   DF IAGESYAGHY+P  A  +    +RN         NL   ++GN  T+    
Sbjct: 256  PEYANLDFHIAGESYAGHYIPAFASEILTHPERN--------FNLTSVLIGNGLTDP--- 304

Query: 1002 YKGLLEYAWSHAIISDQQYDKA---KEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIY 832
               L++Y +   +   +  + +    E CD       +     +S++ + YE   +++  
Sbjct: 305  ---LVQYEYYEPMACGEGGEPSVLEPEECD----GMLNSLPRCLSLIESCYESGSVWSCV 357

Query: 831  GPRCLLN----GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS--PYAEEYF 670
                  N    G    TG R V D+              + +  G   CYS   Y ++Y 
Sbjct: 358  PATIYCNNGQMGPYQKTG-RNVYDI--------------RTMCEGSSLCYSQLEYIDQYL 402

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEK----LIKGGLKIWI 502
            N  +V+KA  A +        +++C+  + R + +    + P Y+K    L++  L + I
Sbjct: 403  NLPEVKKALGAEVD------EYQSCNFDINRNFMFAGDWMKP-YQKNVIDLLEKELPVLI 455

Query: 501  YSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRG 337
            Y+GD D     +G++     L+        K+P +SW       G +  Y   TF+ V G
Sbjct: 456  YAGDKDFICNWLGNQAWTNRLEWSGSKGFTKAPVKSWKVGKNAAGEVKNYKHFTFLRVFG 515

Query: 336  AGHLVPLNKPSEALALIHSFLSGE 265
             GH+VP ++P  AL +++ ++SG+
Sbjct: 516  GGHMVPYDQPENALDMVNRWISGD 539



>gb:AY093044_1574998 Arabidopsis thaliana serine carboxypeptidase
            (At5g36180) mRNA, complete cds.>gb:AY128925_1581005
            Arabidopsis thaliana serine carboxypeptidase (At5g36180)
            mRNA, complete cds.
          Length = 441

 Score =  172 bits (437), Expect = 1e-41
 Identities = 126/431 (29%), Positives = 198/431 (45%), Gaps = 7/431 (1%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK--- 1360
            +GYI V +     LFY+F +++ +P   PL+LWL GGPGCS+I  G   E GPL +K   
Sbjct: 49   TGYIGVGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPGCSAIS-GLLFENGPLTMKLDV 107

Query: 1359 RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    YSW K ++++F++ PVG GFSY+              A+  + FL  W
Sbjct: 108  YNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTQQFNKPSDSG-EAKRIHEFLQKW 166

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
            L +   F  + F++AG+SY+G  VP   + +   N +    P INL+G+++GNP T+   
Sbjct: 167  LGKHQVFSSNPFYVAGDSYSGLVVPATVQEISKGNYE-CCNPPINLQGYVLGNPLTDYTT 225

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
                 + +A   A+ISD+ Y+  K+ C     N   +  + +  V    EE         
Sbjct: 226  GSNSRIPFAHGMALISDELYESLKKTCKGEYTNVHPRNTQCLKFV----EE--------- 272

Query: 825  RCLLNGSSSATGIRGVLD-LALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQK 649
                N  ++    + +LD L  T     Y YR +                 + N   V++
Sbjct: 273  ---FNKCTNRIFQQLILDPLCETETPDCYIYRYL-------------LTTYWANDATVRE 316

Query: 648  AFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPV 469
            A   N  + G    W  C   +   Y     S +P +      G +  IYSGD D  VP 
Sbjct: 317  ALQINKESIG---EWVRCYYSI--PYNNDIKSSMPYHVNNSISGYRSLIYSGDHDFEVPY 371

Query: 468  IGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALA 292
            +G++  I +L   +   WR W   +Q+ G    Y + +TF T++G GH    +KP EA  
Sbjct: 372  LGTQAWIRSLNYSIIDDWRPWMVKNQIAGYTRTYANKMTFATIKGGGHTAE-SKPEEASI 430

Query: 291  LIHSFLSGEEL 259
            +   +++G+ L
Sbjct: 431  MFQRWINGQPL 441



>gb:HS337O18_1998143 Human DNA sequence from clone RP3-337O18 on
            chromosome 20q12-13.1 Contains the PLPT gene for
            phospholipid transfer protein, the PPGB gene for
            protective protein for beta-galactosidase
            (galactosialidosis), the PTE1 gene for peroxisomal
            acyl-CoA thioesterase, the C20orf161 gene, the C20orf162
            gene, the C20orf163, the C20orf164 gene, the C20orf165
            gene, the 5' end of an variant of the TNNC2 gene for fast
            troponin C2 and three CpG islands, complete sequence.
          Length = 289

 Score =  172 bits (436), Expect = 2e-41
 Identities = 105/296 (35%), Positives = 161/296 (54%), Gaps = 9/296 (3%)
 Frame = -2

Query: 1686 VEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            +  APP    LL   L++ +L + +S  +AA + D+I  LPG    P    +SGY+    
Sbjct: 2    IRAAPPPLFLLL---LLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYL--KG 56

Query: 1506 SHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKY 1327
            S  + L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  V+ +GV L +N Y
Sbjct: 57   SGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLVQPDGVTLEYNPY 115

Query: 1326 SWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFF 1147
            SWN  AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F
Sbjct: 116  SWNLIANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLF 173

Query: 1146 IAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHA 967
            + GESYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H 
Sbjct: 174  LTGESYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG 226

Query: 966  IISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI---------DIYNIYGP 826
            ++ ++ +   +  C  +Q   +   N+ +  V T  +E+         +IYN+Y P
Sbjct: 227  LLGNRLWSSLQTHC-CSQNKCNFYDNKDLECV-TNLQEVARIVGNSGLNIYNLYAP 280



>gb:CR382136_1668687 Debaryomyces hansenii chromosome D of strain
            CBS767 of Debaryomyces hansenii.
          Length = 557

 Score =  172 bits (435), Expect = 3e-41
 Identities = 132/442 (29%), Positives = 215/442 (48%), Gaps = 19/442 (4%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            ++GY+ VN    +  FYWFFE+++ P N P++LWLNGGPGCSS   G   ELGP  +   
Sbjct: 154  YTGYLDVNDLD-KHFFYWFFESRNDPENDPVILWLNGGPGCSS-ATGLFFELGPSLINAT 211

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
             +   +N YSWN  A+++F++ PVGVG+SYTN             A+D + FL  + ++F
Sbjct: 212  -LQPEYNPYSWNSNASVIFLDQPVGVGYSYTNGEEVKSTAS---AAKDVFVFLELFFQKF 267

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETND-----Y 1009
            PQF  + F IAGESYAGHY+P  A  + + + DR      +L   ++GN  T+      Y
Sbjct: 268  PQFVKNPFHIAGESYAGHYIPSFASEIIN-HADRS----FDLSSVLIGNGITDSLIQSAY 322

Query: 1008 YDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIY--NI 835
            Y      E  +   +I+D++       C+  ++++  +C     I +     +     N 
Sbjct: 323  YKPMACGEGGYKQ-VITDKE-------CERMEKDY-PRCAALTKICYDAPNALTCVPANF 373

Query: 834  YGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSP--YAEEYFNRI 661
            Y    L  G    TG+    D+  T K                D CY    Y +EY N +
Sbjct: 374  YCEERLF-GPFQKTGL-NPYDIRTTCKG---------------DLCYEALGYVDEYLN-L 415

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKIWIYSGD 490
            D    F  N+    +   + +C D VFR + ++     P  +   +L+   + + IY+GD
Sbjct: 416  D----FVKNVVGASNIEMFNSCDDTVFRNFLFSGDGPKPFQQYVAELLDKNIPVLIYAGD 471

Query: 489  ADGRVPVIGSRYCIEAL------KLPLKSPWRSWFHNHQVGGRIVEYHGL-TFVTVRGAG 331
             D     +G+    +AL      +  LK P + W+ + +     V+ HG+ TF+ +  AG
Sbjct: 472  KDFICNWLGNHGWSDALEYTGHGEFELK-PLQPWYTSDKKLAGEVKNHGIFTFLRIYDAG 530

Query: 330  HLVPLNKPSEALALIHSFLSGE 265
            H+VP ++P  AL +++ ++ G+
Sbjct: 531  HMVPYDQPENALDMVNRWIQGD 552



>gb:TCA313514_1724861 Theobroma cacao mRNA for carboxypeptidase type
            III (CP-III gene).
          Length = 508

 Score =  171 bits (434), Expect = 3e-41
 Identities = 127/442 (28%), Positives = 212/442 (47%), Gaps = 8/442 (1%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            +PG  S   L H +GY  +  SH   +FY+FFE+++   + P+V+WL GGPGCSS     
Sbjct: 87   VPGGVSVEDLGHHAGYYKLANSHDARMFYFFFESRNSKKD-PVVIWLTGGPGCSS-ELAL 144

Query: 1389 AAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQD 1210
              E GP  +  N + L +N+Y W+  +NLL+V+ P+G GFSY++         D+ V+ D
Sbjct: 145  FYENGPFTIAEN-MSLIWNQYGWDMASNLLYVDQPIGTGFSYSSDRRDIRHNEDE-VSND 202

Query: 1209 TYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR-GIYPRINLKGFIV 1033
             Y+FL  +    P+F+ +DF+I GESYAGHY+P  A  V   N+ + GI+  INLKGF +
Sbjct: 203  LYDFLQAFFAEHPEFEKNDFYITGESYAGHYIPAFAARVHQGNKAKDGIH--INLKGFAI 260

Query: 1032 GNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEE 853
            GN  T+    YK   +YA    +I    Y++  ++           C  A+ +  T    
Sbjct: 261  GNGLTDPAIQYKAYTDYALDMGVIKKSDYNRINKLVPV--------CEMAIKLCGTDGTI 312

Query: 852  IDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEE 676
              + + +    +  G  +  G     D+      RT     +         CY     E 
Sbjct: 313  SCMASYFVCNAIFTGIMALAGDTNYYDI------RTKCEGSL---------CYDFSNMET 357

Query: 675  YFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIY 499
            + N+  V+ A          ++++ +CS  V++A        L V    L++ G+K+ +Y
Sbjct: 358  FLNQESVRDALGV------GSIDFVSCSPTVYQAMLVDWMRNLEVGIPALLEDGVKLLVY 411

Query: 498  SGDADGRVPVIGSRYCIEAL-----KLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGA 334
            +G+ D     +G+   + A+     K  + SP   +  +    G +  +  L F+ V  A
Sbjct: 412  AGEYDLICNWLGNSRWVHAMEWSGQKEFVASPEVPFVVDGSEAGVLRTHGPLGFLKVHDA 471

Query: 333  GHLVPLNKPSEALALIHSFLSG 268
            GH+VP+++P  AL ++  +  G
Sbjct: 472  GHMVPMDQPKAALEMLKRWTKG 493



>gb:AY033947_1559549 Arabidopsis thaliana sinapoylglucose:choline
            sinapoyltransferase (SNG2) mRNA, complete cds.
          Length = 464

 Score =  171 bits (433), Expect = 4e-41
 Identities = 131/440 (29%), Positives = 200/440 (45%), Gaps = 16/440 (3%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK--- 1360
            +GY+++ +S    LFY+F +++ +P N PL++WL GGPGCSSI  G     GPL  K   
Sbjct: 43   TGYVSIGESGDVELFYYFVKSERNPENDPLMIWLTGGPGCSSI-CGLLFANGPLAFKGDE 101

Query: 1359 RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    +SW K AN+L++E+P G G+SY            K + Q    FL +W
Sbjct: 102  YNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFESSDTKQMHQ-IDQFLRSW 160

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
              + P+F  + F++ G+SY+G  VP   + +   N ++G+ P IN++G+++GNP T+   
Sbjct: 161  FVKHPEFISNPFYVGGDSYSGKIVPGAVQQILLGN-EKGLTPLINIQGYVLGNPVTDKNI 219

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
            +    + +A    +ISD+ ++  +  C     N  D  N   S     Y+   +  IY  
Sbjct: 220  ETNYRVPFAHGMGLISDELFESLERSCGGKFFN-VDPSNARCSNNLQAYDHC-MSEIYSE 277

Query: 825  RCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSP---YAEEYFNRIDV 655
              LL         +    LA T   RT   R MK           P   +   YF     
Sbjct: 278  HILLR------NCKVDYVLADTPNIRTDRRRVMKEFSVNDSSSLPPPSCFTYRYF----- 326

Query: 654  QKAFHAN----IRAPG--STVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSG 493
              AF AN     RA G      W  C+      Y +  F+ +P +      G +  IYSG
Sbjct: 327  LSAFWANDENVRRALGVKKVGKWNRCNSQNI-PYTFEIFNAVPYHVNNSLKGFRSLIYSG 385

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRSW-FHNHQVGGRIVEY-HGLTFVTVRGAGHLVP 319
            D D  VP   ++  I AL   +   WR W   ++QV G    Y + +TF T++G GH   
Sbjct: 386  DHDSMVPFSSTQAWIRALNYSIVDDWRPWMMSSNQVAGYTRTYANKMTFATIKGGGHTAE 445

Query: 318  LNKPSEALALIHSFLSGEEL 259
               P +   +   ++ GE L
Sbjct: 446  YT-PDQCSLMFRRWIDGEPL 464



>pir|S51516|S51516 serine-type carboxypeptidase (EC 3.4.16.-) Z
            precursor - Absidia zychae>gb:ABGSCPZ_1529858 Absibia
            zychae scpZ gene for carboxypeptidase Z (CPZ), complete
            cds.
          Length = 460

 Score =  171 bits (432), Expect = 6e-41
 Identities = 137/473 (28%), Positives = 220/473 (46%), Gaps = 18/473 (3%)
 Frame = -2

Query: 1629 VLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYI-TVNQSHGRALFYWFFEAKSHPS 1453
            VL  +  +  ++  + ++ Y   +   P +  +SGY+   N  H    F+WFFE+K+ P 
Sbjct: 33   VLRRQDGNDTSSGNTTQLKYTSPKLCDPDVKQYSGYLDAANDEH---YFFWFFESKNDPK 89

Query: 1452 NKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVG 1273
            N PL +WLNGGPGCSS+  G   ELGP +  +NG     N +SW+  +N+LF + P GVG
Sbjct: 90   NDPLTIWLNGGPGCSSL-IGLWEELGPCQ--QNGSA---NPHSWHHSSNMLFFDQPDGVG 143

Query: 1272 FSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVV 1093
            FSY               A+  + FL  + E FPQ+   D    GESY GHY+P  A  V
Sbjct: 144  FSYGKQTVSTTEDA----AERAWTFLQAFYETFPQYSKLDVHYFGESYGGHYIPGFASHV 199

Query: 1092 FDRNR------DRGIYPRINLKGFIVGNPETN---DYYDYKGLLEYAWSHAIISDQQYDK 940
             D N+      ++G+   + LK   VGN   +    Y  Y  +  ++   A++S+++   
Sbjct: 200  VDMNKKVQSGEEKGVV--VPLKSIGVGNGFIDAVIQYKSYPKMTCHSTYPAVLSEEE--- 254

Query: 939  AKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALT 760
                CD  Q+ + + C  A        E+ D          +N +     I G+      
Sbjct: 255  ----CDKMQQIYENDCKPAAEQCAESDEDSDC---------VNANQQCGQIEGIY----- 296

Query: 759  NKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVF 580
              +  Y++  +++     D    P+ +E  N+  V       I+  G+  ++  CSD V 
Sbjct: 297  -AQSGYSFYDIRQQG---DDTPHPFVDE-LNKASV-------IKEVGARGHFSMCSDSVG 344

Query: 579  RAYKYT---TFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLP-----LK 424
             A+  T     S +P  EKL+K G+ + IY GDAD      G+    ++LK        K
Sbjct: 345  TAFAQTGDGARSYIPAVEKLLKEGIPVLIYVGDADVICNWYGNLDVADSLKWDGSDAFSK 404

Query: 423  SPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
            +   +W  + +  G+      LTFV V  AGH VP+ +P  AL++  +++SG+
Sbjct: 405  TKLEAWKADGKEVGQFRSADKLTFVRVYEAGHEVPMYQPEAALSMFQTWISGK 457



>gb:AY063833_1565782 Arabidopsis thaliana putative carboxypeptidase
            (At5g09640) mRNA, complete cds.>gb:AY091309_1574513
            Arabidopsis thaliana putative carboxypeptidase
            (At5g09640) mRNA, complete cds.
          Length = 465

 Score =  170 bits (430), Expect = 1e-40
 Identities = 130/441 (29%), Positives = 199/441 (45%), Gaps = 17/441 (3%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK--- 1360
            +GY+++ +S    LFY+F +++ +P N PL++WL GGPGCSSI  G     GPL  K   
Sbjct: 43   TGYVSIGESGDVELFYYFVKSERNPENDPLMIWLTGGPGCSSI-CGLLFANGPLAFKGDE 101

Query: 1359 RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    +SW K AN+L++E+P G G+SY            K + Q    FL +W
Sbjct: 102  YNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFESSDTKQMHQ-IDQFLRSW 160

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
              + P+F  + F++ G+SY+G  VP   + +     ++G+ P IN++G+++GNP T+   
Sbjct: 161  FVKHPEFISNPFYVGGDSYSGKIVPGAVQQI-SLGNEKGLTPLINIQGYVLGNPVTDKNI 219

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
            +    + +A    +ISD+ ++  +  C     N  D  N   S     Y+   +  IY  
Sbjct: 220  ETNYRVPFAHGMGLISDELFESLERSCGGKFFN-VDPSNARCSNNLQAYDHC-MSEIYSE 277

Query: 825  RCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSP---YAEEYFNRIDV 655
              LL         +    LA T   RT   R MK           P   +   YF     
Sbjct: 278  HILLR------NCKVDYVLADTPNIRTDRRRVMKEFSVNDSSSLPPPSCFTYRYF----- 326

Query: 654  QKAFHAN----IRAPG---STVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYS 496
              AF AN     RA G       W  C+      Y +  F+ +P +      G +  IYS
Sbjct: 327  LSAFWANDENVRRALGVKKEVGKWNRCNSQNI-PYTFEIFNAVPYHVNNSLKGFRSLIYS 385

Query: 495  GDADGRVPVIGSRYCIEALKLPLKSPWRSW-FHNHQVGGRIVEY-HGLTFVTVRGAGHLV 322
            GD D  VP   ++  I AL   +   WR W   ++QV G    Y + +TF T++G GH  
Sbjct: 386  GDHDSMVPFSSTQAWIRALNYSIVDDWRPWMMSSNQVAGYTRTYANKMTFATIKGGGHTA 445

Query: 321  PLNKPSEALALIHSFLSGEEL 259
                P +   +   ++ GE L
Sbjct: 446  EYT-PDQCSLMFRRWIDGEPL 465



>pir|JC7666|JC7666 serine-type carboxypeptidase homolog precursor -
            Emericella nidulans>gb:AB051820_1521152 Aspergillus
            nidulans cpyA gene for carboxypeptidase, complete cds.
          Length = 552

 Score =  170 bits (430), Expect = 1e-40
 Identities = 128/460 (27%), Positives = 215/460 (46%), Gaps = 32/460 (6%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +  ++GY+  N++  + LFYWFFE+++ P N P+VLWLNGGPGCSS+  G   ELGP 
Sbjct: 144  PDVKQYTGYLDDNEND-KHLFYWFFESRNDPKNDPVVLWLNGGPGCSSL-TGLFMELGPS 201

Query: 1368 RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVN 1189
             +  N +   +N Y+WN  A+++F++ PV VG+SY+           K    D Y  L  
Sbjct: 202  SIDEN-IKPVYNPYAWNSNASVIFLDQPVNVGYSYSGSTVSDTVAAGK----DVYALLTL 256

Query: 1188 WLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETN-- 1015
            + ++FP++   DF IAGESYAGHY+P     +    +       INLK  ++GN  T+  
Sbjct: 257  FFKQFPEYAEQDFHIAGESYAGHYIPVFTSEILSHQK-----RNINLKSVLIGNGLTDGL 311

Query: 1014 -DYYDYKGLLEYAWSHAIISDQQYDKAK-----------EVCDFTQENW-----SDKCNE 886
              Y  Y+ +      +  + D+   ++            E C  ++  W     S  CN 
Sbjct: 312  TQYEYYRPMACGEGGYPAVLDESSCRSMDNALGRCQSMIESCYNSESAWVCVPASIYCNN 371

Query: 885  AMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGY 706
            A+   + +  + ++Y++ G +C                      E    Y+ M       
Sbjct: 372  ALLAPYQRTGQ-NVYDVRG-KC--------------------EDESNLCYKGM------- 402

Query: 705  DPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLI 526
                  Y  EY N+ +V+ A  A +        + +C+  + R + +    + P Y +L+
Sbjct: 403  -----GYVSEYLNKPEVRAAVGAEVD------GYDSCNFDINRNFLFHGDWMKP-YHRLV 450

Query: 525  KGGLK---IWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRS-------WFHNHQVGGRI 376
             G L+   + IY+GDAD     +G++   EAL+ P    + +          N   G +I
Sbjct: 451  PGILEQIPVLIYAGDADFICNWLGNKAWTEALEWPGHKEFAAAPMEDLKIVDNEHTGKKI 510

Query: 375  --VEYHG-LTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
              ++ HG  TF+ + G GH+VP+++P  +L   + +L GE
Sbjct: 511  GQIKTHGNFTFMRLYGGGHMVPMDQPEASLEFFNRWLGGE 550



>sp|P21529|CBP3_HORVU Serine carboxypeptidase III precursor (EC
            3.4.16.5) (CP-MIII).>gb:HVCPMIII_1682324 H.vulgare mRNA
            for serine carboxypeptidase III, CP-MIII.
          Length = 508

 Score =  170 bits (430), Expect = 1e-40
 Identities = 128/450 (28%), Positives = 207/450 (46%), Gaps = 15/450 (3%)
 Frame = -2

Query: 1569 LPGQPSAPL-LTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYG 1393
            LPG P     L H +GY  +  +H   +FY+FFE++    + P+V+WL GGPGCSS    
Sbjct: 81   LPGLPEGVADLGHHAGYYRLPNTHDARMFYFFFESRGKKED-PVVIWLTGGPGCSS-ELA 138

Query: 1392 AAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQ 1213
               E GP  +  N + L +NK+ W+K +N++FV+ P G GFSY++            V+ 
Sbjct: 139  VFYENGPFTIANN-MSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETG-VSN 196

Query: 1212 DTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIV 1033
            D Y+FL  + ++ P+F  +DFFI GESYAGHY+P  A  V   N+ +     INLKGF +
Sbjct: 197  DLYDFLQVFFKKHPEFIKNDFFITGESYAGHYIPAFASRVHQGNK-KNEGTHINLKGFAI 255

Query: 1032 GNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEV---CDFTQE----NWSDKCNEAMSI 874
            GN  T+    YK   +YA    +I    Y++  +    C+F  +    N    C  A  +
Sbjct: 256  GNGLTDPAIQYKAYTDYALEMNLIQKADYERINKFIPPCEFAIKLCGTNGKASCMAAYMV 315

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
              T +  I                          + L   +  Y  R  K   G    CY
Sbjct: 316  CNTIFNSI--------------------------MKLVGTKNYYDVR--KECEGKL--CY 345

Query: 693  S-PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKG 520
                 E++F    V++A           + + +CS  V++A        L V    L++ 
Sbjct: 346  DFSNLEKFFGDKAVRQAIGV------GDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLED 399

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLT 355
            G+ + IY+G+ D     +G+   + +++        K+   S+  +    G +  +  L+
Sbjct: 400  GINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKSHGALS 459

Query: 354  FVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
            F+ V  AGH+VP+++P  AL ++  F  G+
Sbjct: 460  FLKVHNAGHMVPMDQPKAALEMLRRFTQGK 489



>gb:AP004299_1839763 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0434A03.>gb:AP005261_1849800 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0640E12.
          Length = 429

 Score =  169 bits (429), Expect = 1e-40
 Identities = 124/440 (28%), Positives = 207/440 (47%), Gaps = 8/440 (1%)
 Frame = -2

Query: 1563 GQPSAPLLTHFSGYITVNQSHGRALFYWFFEAK-SHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            G  SA  L H +GY  +  +H   LFY+FFE++ S   + P+V+WL GGPGCSS      
Sbjct: 7    GGSSAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSS-ELALF 65

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             E GP  +  N + L +N + W++E+NL++V+ P G GFSY++            V+ D 
Sbjct: 66   YENGPFHIADN-MSLVWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDEAG-VSNDL 123

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD-RGIYPRINLKGFIVG 1030
            Y FL  +    P F  +DF+I GESYAGHY+P  A  V+  N++  GI+  INLKGF +G
Sbjct: 124  YAFLQAFFTEHPNFAKNDFYITGESYAGHYIPAFASRVYKGNKNSEGIH--INLKGFAIG 181

Query: 1029 NPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI 850
            N  T+    YK   +Y+    +I+  Q+++  ++           C  A+ +        
Sbjct: 182  NGLTDPAIQYKAYTDYSLDMGLITKSQFNRINKIV--------PTCELAIKL-------- 225

Query: 849  DIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYF 670
                     C  +G+ S  G   V +L  ++ E     +    I     PC      +  
Sbjct: 226  ---------CGTSGTISCLGAYVVCNLIFSSIETIIGKKNYYDI---RKPCVGSLCYDLS 273

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSG 493
            N     +            + + +CS  V++A        L V   +L++  +K+ IY+G
Sbjct: 274  NMEKFLQLKSVRESLGVGDIQFVSCSPTVYQAMLLDWMRNLEVGIPELLENDIKVLIYAG 333

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRS-----WFHNHQVGGRIVEYHGLTFVTVRGAGH 328
            + D     +G+   + +++   K  + S     +  + +  G +  Y  L+F+ V  AGH
Sbjct: 334  EYDLICNWLGNSRWVNSMEWSGKEAFVSSSEEPFTVDGKEAGILKSYGPLSFLKVHDAGH 393

Query: 327  LVPLNKPSEALALIHSFLSG 268
            +VP+++P  AL ++  + SG
Sbjct: 394  MVPMDQPKVALEMLMRWTSG 413



>gb:CR382121_1654697 Kluyveromyces lactis strain NRRL Y-1140
            chromosome A of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 535

 Score =  169 bits (429), Expect = 1e-40
 Identities = 123/445 (27%), Positives = 217/445 (48%), Gaps = 17/445 (3%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +  +SGY+ V +   +  FYWFFE+++ P N P++LWLNGGPGCSS+  G   ELGP 
Sbjct: 125  PDVKQYSGYLDV-EDEDKHFFYWFFESRNDPKNDPIILWLNGGPGCSSLT-GLFFELGPS 182

Query: 1368 RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVN 1189
             V    +   +N +SWN  A+++F++ PV VG+SY++              +D Y FL  
Sbjct: 183  SVGEE-IKPIYNPHSWNSNASVIFLDQPVNVGYSYSSSEGVSNTVAA---GKDVYAFLQL 238

Query: 1188 WLERFPQF-KGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETND 1012
            + ++FP++  G DF IAGESYAGHY+P  A  +     +   +   NL   ++GN  T+ 
Sbjct: 239  FFQQFPEYASGQDFHIAGESYAGHYIPVFATEILSHPTEERSF---NLTSVLIGNGLTDP 295

Query: 1011 YYDYKGLLEYAWSHAIISDQQYDKA---KEVCDFTQENWSDKCNEAMSIVFTKYEEIDIY 841
                  L +Y +   +   +  + +    E CD    N  +     ++++ + YE   ++
Sbjct: 296  ------LSQYPYYEPMACGEGGEPSVLEPEQCD----NMLETLPRCLNLIQSCYEYESVW 345

Query: 840  NIYGPRCLLN----GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEY 673
            +        N    G   +TG + V D+     +    Y  MK            Y +EY
Sbjct: 346  SCVPASIYCNNAQMGPYQSTG-KNVYDIR-KECQGELCYDEMK------------YMDEY 391

Query: 672  FNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKIWI 502
             N   V++A  A +       N+++C+  + R + +    + P ++   +L++  L + I
Sbjct: 392  LNLDFVKEAVGAEVD------NYESCNFDINRNFLFAGDWMKPYHKHVTELLEQDLPVLI 445

Query: 501  YSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHN-HQVGGRIVEYHGLTFVTVR 340
            Y+GD D     +G++     L         K P ++W  +  +  G++  +   TF+ V 
Sbjct: 446  YAGDKDFICNWLGNQAWTNLLPYKDAEEFAKQPVKNWVTSVGKKAGKVKNFDKFTFLRVY 505

Query: 339  GAGHLVPLNKPSEALALIHSFLSGE 265
            GAGH+VP ++P  AL +++ +++G+
Sbjct: 506  GAGHMVPFDQPENALDMVNDWVNGK 530



>gb:AC069472_1540872 Arabidopsis thaliana chromosome 3 BAC F28J15
            genomic sequence, complete sequence.
          Length = 435

 Score =  169 bits (429), Expect = 1e-40
 Identities = 132/458 (28%), Positives = 207/458 (45%), Gaps = 10/458 (2%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNG 1423
            K A  S  I YLPG          +GYI V +     +FY+F +++S+P   PL+LWL+G
Sbjct: 19   KHADSSSIIKYLPGFEGPLPFELETGYIGVGEEDEDQMFYYFIKSESNPKTDPLLLWLSG 78

Query: 1422 GPGCSSIGYGAAAELGPLRVKRNGVG-----LHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            GPGCSS   G   E GPL  K          L    YSW K AN+++++ PVG GFSY+ 
Sbjct: 79   GPGCSSF-TGLIYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSR 137

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                         A+    FL  WL + P++  + F+  G SY+G  VP + + + + N 
Sbjct: 138  NPLADIPSDTG-SAKRVDEFLRKWLTKHPEYFSNPFYAGGNSYSGKMVPVIVQEISNGNC 196

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSD 898
              G  P+I L+G+++G+P T+   D    +++A   A+IS++ Y+  K  C         
Sbjct: 197  IYG-KPQIRLQGYVLGSPVTDYDLDRNSRIQFAHGMALISNELYESMKRTCG-------- 247

Query: 897  KCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLA----LTNKERTYAYRR 730
                        Y  +D  N      + +  +  +GI   L L     LT+ +  ++YR 
Sbjct: 248  ----------GNYIFVDPLNTECLELIKDYDNCVSGIYENLILVPKCDLTSPD-CHSYRS 296

Query: 729  MKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSL 550
            M              ++ + N   V++A        G+T  W+ C   +         S 
Sbjct: 297  M-------------LSDYWANNESVRRALKV---VEGTTGRWERCKWTL--QNNKDIKSS 338

Query: 549  LPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVE 370
            +P ++K    G +  I+SGD D   P +G++  I +L   +   WR W    QV G    
Sbjct: 339  IPYHKKNSIQGYRSLIFSGDHDMLTPYVGTQDWIRSLNYSIIDKWRPWMILDQVAGYTTT 398

Query: 369  Y-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            Y + +TF TV+G GH +   KP E   L   ++SG+ L
Sbjct: 399  YANKMTFATVKGGGHTLDY-KPDENSILFKRWISGQLL 435



>pir|A35275|A35275 carboxypeptidase C (EC 3.4.16.5) - barley
          Length = 411

 Score =  169 bits (429), Expect = 1e-40
 Identities = 128/450 (28%), Positives = 207/450 (46%), Gaps = 15/450 (3%)
 Frame = -2

Query: 1569 LPGQPSAPL-LTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYG 1393
            LPG P     L H +GY  +  +H   +FY+FFE++    + P+V+WL GGPGCSS    
Sbjct: 1    LPGLPEGVADLGHHAGYYRLPNTHDARMFYFFFESRGKKED-PVVIWLTGGPGCSS-ELA 58

Query: 1392 AAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQ 1213
               E GP  +  N + L +NK+ W+K +N++FV+ P G GFSY++            V+ 
Sbjct: 59   VFYENGPFTIANN-MSLVWNKFGWDKISNIIFVDQPTGTGFSYSSDDRDTRHDETG-VSN 116

Query: 1212 DTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIV 1033
            D Y+FL  + ++ P+F  +DFFI GESYAGHY+P  A  V   N+ +     INLKGF +
Sbjct: 117  DLYDFLQVFFKKHPEFIKNDFFITGESYAGHYIPAFASRVHQGNK-KNEGTHINLKGFAI 175

Query: 1032 GNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEV---CDFTQE----NWSDKCNEAMSI 874
            GN  T+    YK   +YA    +I    Y++  +    C+F  +    N    C  A  +
Sbjct: 176  GNGLTDPAIXYKAYTDYALEMNLIQKADYERINKFIPPCEFAIKLCGTNGKASCMAAYMV 235

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
              T +  I                          + L   +  Y  R  K   G    CY
Sbjct: 236  CNTIFNSI--------------------------MKLVGTKNYYDVR--KECEGKL--CY 265

Query: 693  S-PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKG 520
                 E++F    V++A           + + +CS  V++A        L V    L++ 
Sbjct: 266  DFSNLEKFFGDKAVRQAIGV------GDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLED 319

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLT 355
            G+ + IY+G+ D     +G+   + +++        K+   S+  +    G +  +  L+
Sbjct: 320  GINVLIYAGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKSHGALS 379

Query: 354  FVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
            F+ V  AGH+VP+++P  AL ++  F  G+
Sbjct: 380  FLKVHNAGHMVPMDQPKAALEMLRRFTQGK 409



>gb:CR382135_1668312 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 548

 Score =  169 bits (428), Expect = 2e-40
 Identities = 122/435 (28%), Positives = 209/435 (48%), Gaps = 12/435 (2%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            ++GY+ V +   +  FYWFFE+++ P N P++LWLNGGPGCSS+  G   ELGP  +  +
Sbjct: 149  YTGYLDV-KDEDKHFFYWFFESRNDPKNDPVILWLNGGPGCSSL-TGLFFELGPSSIGAD 206

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               +  N +SWN  A+++F++ PV VGFSY++          K    D Y FL  + ++F
Sbjct: 207  LKPIR-NPHSWNNNASIIFLDQPVNVGFSYSSDSITNTIAAGK----DVYAFLELFFKQF 261

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
            P++K  DF IAGESYAGHY+P  A  +   + DR      NL   ++GN  T+    Y  
Sbjct: 262  PEYKKPDFHIAGESYAGHYIPVFATEILSHD-DRS----FNLSSVLIGNGLTDPLTQY-- 314

Query: 993  LLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLL 814
              EY   +  ++  +  +   +     ++ +D     +S++ + Y+   I++        
Sbjct: 315  --EY---YEPMACGKGGEPSVLEPGECQSMTDSIPRCLSLIESCYDSGSIWSCVPATIYC 369

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS--PYAEEYFNRIDVQKAFH 640
            N         G +     +    Y  R M     G   CYS   Y ++Y N+ +V+    
Sbjct: 370  N--------NGQMGPYQKSGRNVYDIRTMCE---GSSLCYSDLEYIDQYLNQDEVKSKLG 418

Query: 639  ANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKIWIYSGDADGRVPV 469
              + A      +++C+  + R +      + P ++    L++  L I IY+GD D     
Sbjct: 419  VEVDA------YESCNFDINRNFLLAGDWMKPYHKAVVDLLEQELPILIYAGDKDFICNW 472

Query: 468  IGSRYCIEALKLP-------LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNK 310
            +G++   +  KLP        + P R W    +  G +  Y   TF+ + G GH+VP ++
Sbjct: 473  LGNQAWTD--KLPWSGQEKFAEQPIREWKVGKETAGEVKNYKHFTFLRIFGGGHMVPYDQ 530

Query: 309  PSEALALIHSFLSGE 265
            P  AL +++ ++ G+
Sbjct: 531  PENALDMVNRWVKGD 545



>gb:AY497024_1609150 Trichophyton rubrum carboxypeptidase Y gene,
            complete cds.
          Length = 536

 Score =  169 bits (428), Expect = 2e-40
 Identities = 130/449 (28%), Positives = 214/449 (47%), Gaps = 21/449 (4%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +  +SGY+  N +  + LFYWFFE+++ P N P+VLWLNGGPGCSS+  G   ELGP 
Sbjct: 128  PGVKQYSGYLDDNDAD-KHLFYWFFESRNDPKNDPVVLWLNGGPGCSSL-TGLFLELGPA 185

Query: 1368 RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVN 1189
             + +N + +  N YSWN  A+++F++ PV VGFSY+           K    D Y  L  
Sbjct: 186  TIDKN-LKVVSNPYSWNSNASVIFLDQPVNVGFSYSGSSVSDTVAAGK----DVYALLTL 240

Query: 1188 WLERFPQFKGHDFFIAGESYAGHYVPQL-AEVVFDRNRDRGIYPRINLKGFIVGNPETN- 1015
            + ++FP++   DF I+GESYAGHY+P   AE++  +N +      INLK  ++GN  T+ 
Sbjct: 241  FFKQFPEYATQDFHISGESYAGHYIPVFAAEILSHKNTN------INLKSALIGNGLTDP 294

Query: 1014 --DYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIY 841
               Y  Y+ +      +  + DQ   +       + +N  ++C   +S++ T Y     +
Sbjct: 295  LTQYPQYRPMACGEGGYPAVLDQGTCR-------SMDNSLERC---LSLIETCYSSESAW 344

Query: 840  NIYGPRCLLNGSSSA----TGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEY 673
                     N +  A    TG+             +  Y ++  I             E+
Sbjct: 345  VCVPAAMYCNSAILAPYQQTGMNPYDVRTKCEDMASLCYPQLNAI------------TEW 392

Query: 672  FNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLK---IWI 502
             N+  V +A    +       ++++C+  + R + +    + P Y +L+   L+   + I
Sbjct: 393  LNQKPVMQALGVEVE------SYESCNSGINRDFLFHGDWMKP-YHRLVPSVLEKIPVLI 445

Query: 501  YSGDADGRVPVIGSRYCIEALKLP-------LKSPWRSWFHNHQVG---GRIVEYHGLTF 352
            Y+GDAD     +G++   EAL+ P        K        N   G   G++      TF
Sbjct: 446  YAGDADFICNWLGNKAWTEALEWPGHKKFAETKLEDLKIVDNKNKGKKIGQVKSSGNFTF 505

Query: 351  VTVRGAGHLVPLNKPSEALALIHSFLSGE 265
            + + GAGH+VPLN+P  +L  ++ +L GE
Sbjct: 506  MRIFGAGHMVPLNQPEASLEFLNRWLRGE 534



>sp|P52712|CBPX_ORYSA Serine carboxypeptidase-like precursor (EC
            3.4.16.-).>pir|T03607|T03607 probable carboxypeptidase C
            (EC 3.4.16.5) cbp31 - rice>gb:RICCBP31_1703564 Oryza
            sativa (japonica cultivar-group) mRNA for serine
            carboxypeptidase-like protein, complete cds.
          Length = 429

 Score =  169 bits (428), Expect = 2e-40
 Identities = 124/440 (28%), Positives = 207/440 (47%), Gaps = 8/440 (1%)
 Frame = -2

Query: 1563 GQPSAPLLTHFSGYITVNQSHGRALFYWFFEAK-SHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            G  SA  L H +GY  +  +H   LFY+FFE++ S   + P+V+WL GGPGCSS      
Sbjct: 7    GGSSAEDLGHHAGYYRLPNTHDARLFYFFFESRGSKGEDDPVVIWLTGGPGCSS-ELALF 65

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             E GP  +  N + L +N + W++E+NL++V+ P G GFSY++            V+ D 
Sbjct: 66   YENGPFHIADN-MSLVWNDFGWDQESNLIYVDQPTGTGFSYSSNPRDTRHDEAG-VSNDL 123

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD-RGIYPRINLKGFIVG 1030
            Y FL  +    P F  +DF+I GESYAGHY+P  A  V+  N++  GI+  INLKGF +G
Sbjct: 124  YAFLQAFFTEHPNFAKNDFYITGESYAGHYIPAFASRVYKGNKNSEGIH--INLKGFAIG 181

Query: 1029 NPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI 850
            N  T+    YK   +Y+    +I+  Q+++  ++           C  A+ +        
Sbjct: 182  NGLTDPAIQYKAYTDYSLDMGLITKSQFNRINKIV--------PTCELAIKL-------- 225

Query: 849  DIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYF 670
                     C  +G+ S  G   V +L  ++ E     +    I     PC      +  
Sbjct: 226  ---------CGTSGTISCLGAYVVCNLICSSIETIIGKKNYYDI---RKPCVGSLCYDLS 273

Query: 669  NRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSG 493
            N     +            + + +CS  V++A        L V   +L++  +K+ IY+G
Sbjct: 274  NMEKFLQLKSVRESLGVGDIQFVSCSPTVYQAMLLDWMRNLEVGIPELLENDIKVLIYAG 333

Query: 492  DADGRVPVIGSRYCIEALKLPLKSPWRS-----WFHNHQVGGRIVEYHGLTFVTVRGAGH 328
            + D     +G+   + +++   K  + S     +  + +  G +  Y  L+F+ V  AGH
Sbjct: 334  EYDLICNWLGNSRWVNSMEWSGKEAFVSSSEEPFTVDGKEAGILKSYGPLSFLKVHDAGH 393

Query: 327  LVPLNKPSEALALIHSFLSG 268
            +VP+++P  AL ++  + SG
Sbjct: 394  MVPMDQPKVALEMLMRWTSG 413



>gb:A75535_1450610 Sequence 2 from Patent
            WO9400579.>gb:CR382125_1658017 Kluyveromyces lactis
            strain NRRL Y-1140 chromosome E of strain NRRL Y-1140 of
            Kluyveromyces lactis.
          Length = 491

 Score =  168 bits (426), Expect = 3e-40
 Identities = 130/437 (29%), Positives = 207/437 (47%), Gaps = 17/437 (3%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+    S  +  FYWFFE+++ P N P++LWLNGGPGCSS   G   ELGP  +   
Sbjct: 83   WSGYLDYQDS--KHFFYWFFESRNDPENDPVILWLNGGPGCSSF-VGLFFELGPSSI--- 136

Query: 1353 GVGLH--FNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE 1180
            G  L   +N YSWN  A+++F++ PVGVGFSY +             A+D Y FL  + E
Sbjct: 137  GADLKPIYNPYSWNSNASVIFLDQPVGVGFSYGDSKVSTTDD----AAKDVYIFLDLFFE 192

Query: 1179 RFPQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYD 1003
            RFP  + +DF I+GESYAGHY+P++A E+      D       NL   ++GN  T+    
Sbjct: 193  RFPHLRNNDFHISGESYAGHYLPKIAHEIAVVHAEDSS----FNLSSVLIGNGFTDPLTQ 248

Query: 1002 YKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPR 823
            Y+      +      +  Y    E  D    N        +S+V   Y+   +++     
Sbjct: 249  YQ-----YYEPMACGEGGYPAVLEPEDCLDMN--RNLPLCLSLVDRCYKSHSVFS----- 296

Query: 822  CLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSP--YAEEYFNRIDVQK 649
            C+L        I GV + +  N    Y  R           CY    Y  +Y N+ +VQ+
Sbjct: 297  CVLADRYCEQQITGVYEKSGRN---PYDIRSKCEAEDDSGACYQEEIYISDYLNQEEVQR 353

Query: 648  AFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKIWIYSGDADGR 478
            A   ++       +++ CS  V   + +T     P ++   +L+   + + IY+GD D  
Sbjct: 354  ALGTDVS------SFQGCSSDVGIGFAFTGDGPSPFHQYVAELLDQDINVLIYAGDKDYI 407

Query: 477  VPVIGS---------RYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHL 325
               +G+         RY  E  K  L++ W+S   +  + G    Y  LT++ +  AGH+
Sbjct: 408  CNWLGNLAWTEKLEWRYNEEYKKQVLRT-WKSEETDETI-GETKSYGPLTYLRIYDAGHM 465

Query: 324  VPLNKPSEALALIHSFL 274
            VP ++P  +L +++S++
Sbjct: 466  VPHDQPENSLQMVNSWI 482



>sp|O13849|CBPY_SCHPO Carboxypeptidase Y precursor (EC 3.4.16.5)
            (CPY).>pir|T43236|T43236 carboxypeptidase C (EC 3.4.16.5)
            precursor [validated] - fission yeast
            (Schizosaccharomyces pombe)>gb:D86560_1675004
            Schizosaccharomyces pombe cpy1 gene for carboxypeptidase
            Y, complete cds.>gb:SPAC19G12_1716935 S.pombe chromosome
            I cosmid c19G12.
          Length = 1002

 Score =  168 bits (425), Expect = 4e-40
 Identities = 123/446 (27%), Positives = 216/446 (48%), Gaps = 24/446 (5%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            ++GY+ V     R LF+WFFE+++ P N P+VLWLNGGPGCSS+  G   ELGP  +   
Sbjct: 589  YTGYLDVEDD--RHLFFWFFESRNDPENDPVVLWLNGGPGCSSL-TGLFMELGPSSINIE 645

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
             +   +N +SWN  A+++F++ P+  GFS  +          K    D Y FL  +  +F
Sbjct: 646  TLKPEYNPHSWNSNASVIFLDQPINTGFSNGDDSVLDTVTAGK----DVYAFLNLFFAKF 701

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY---------PRINLKGFIVGNPE 1021
            PQ+   DF IAGESYAGHY+PQ A+ + + N+    +           INLK  ++GN  
Sbjct: 702  PQYAHLDFHIAGESYAGHYIPQFAKEIMEHNQGANFFVASGYEMEKQYINLKSVLIGNGL 761

Query: 1020 TNDYYDYKGLLEYAWSHAIISDQQYD--KAKEVCDFTQENWSDKCNEAMSIVF-TKYEEI 850
            T+       L++Y +   +  +  Y    ++E CD     + D C + ++  + T +  +
Sbjct: 762  TDP------LVQYYFYGKMACESPYGPIMSQEECDRITGAY-DTCAKLITGCYQTGFTPV 814

Query: 849  DI-YNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY--SPYAE 679
             I  ++Y    ++ G  + TG+  + D+    +++ +              CY  +   E
Sbjct: 815  CIGASLYCNNAMI-GPFTKTGL-NIYDIREECRDQEHL-------------CYPETGAIE 859

Query: 678  EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE----KLIKGGLK 511
             Y N+  VQ+A        G   ++K C+  V   + +    +   +      +++ GL 
Sbjct: 860  SYLNQEFVQEAL-------GVEYDYKGCNTEVNIGFLFKGDWMRKTFRDDVTAILEAGLP 912

Query: 510  IWIYSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTFVT 346
            + IY+GDAD     +G+    +AL+        ++  + W  N +  GR   +    ++ 
Sbjct: 913  VLIYAGDADYICNYMGNEAWTDALEWAGQREFYEAELKPWSPNGKEAGRGKSFKNFGYLR 972

Query: 345  VRGAGHLVPLNKPSEALALIHSFLSG 268
            +  AGH+VP N+P  +L +++S++ G
Sbjct: 973  LYEAGHMVPFNQPEASLEMLNSWIDG 998



>gb:NCB7H23_1690174 Neurospora crassa DNA linkage group V BAC contig
            B7H23.
          Length = 659

 Score =  167 bits (424), Expect = 5e-40
 Identities = 131/485 (27%), Positives = 219/485 (45%), Gaps = 24/485 (4%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGY-LPGQPSAPLLTHFSGYITVNQSHGRALFYW 1480
            L+  F + W     SS   AA  +D   + LPG P  PL+   +G+I V   +   LF+W
Sbjct: 23   LIAAFTLSWT----SSFVAAAGSADYFVHDLPGAPDGPLVKMHAGHIEVTPDNNGNLFFW 78

Query: 1479 FFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLL 1300
             F+ K   + +  V+WLNGGPGCSS   GA  E+GP R+K     L +N  +WN+ AN+L
Sbjct: 79   HFQNKHIANKQRTVIWLNGGPGCSSED-GALMEIGPYRLKDENT-LVYNDGAWNEFANVL 136

Query: 1299 FVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGH 1120
            FV++PVG GFSY +         +  +A +   FL  W   FP+++  D +IAGESYAG 
Sbjct: 137  FVDNPVGTGFSYVDTNAYIHELTE--MAANFVTFLERWFALFPEYEHDDLYIAGESYAGQ 194

Query: 1119 YVPQLAEVVFDRNRDRG-IYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYD 943
            ++P +A+ + +RN++ G +  + NL G ++GN   +    Y   L++A+   I+  +  D
Sbjct: 195  HIPYIAQAILERNKNAGPVNRKWNLSGLLIGNGWVSPKEQYDAYLQFAYEKDIVK-KGTD 253

Query: 942  KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRC------LLNGSSSATGIRG 781
             A ++     E     C + +++   K ++ID      P C      +L  ++   G  G
Sbjct: 254  LANKL-----EIQQRICQKEIAV---KPDKIDY-----PECEAILQDMLQLTAGGVGASG 300

Query: 780  VLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEE------YFNRIDVQKAFHANIRAPG 619
                    K + Y    + R+   Y  C   +  +      Y  + +V KA + N     
Sbjct: 301  --------KNQCYNMYDV-RLKDDYPSCGMAWPPDLKSVTPYLRKKEVIKALNIN---DN 348

Query: 618  STVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIE-- 445
             +  W  C+  V   +   T   + +   ++  G+ I ++SG  D     +G+   I   
Sbjct: 349  KSTGWTECNGQVGMNFNPKTKPSITLLPDILSAGVPILLFSGAEDLICNHLGTEALISNM 408

Query: 444  --------ALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALAL 289
                     L     +P R W    +  G   +   LT+V    + H+VP + P     +
Sbjct: 409  EWNGGKGFELTPGTWAPRRDWTFEGEPAGFWQQARNLTYVLFYNSSHMVPFDYPRRTRDM 468

Query: 288  IHSFL 274
            +  F+
Sbjct: 469  LDRFM 473



>gb:AB018112_1513782 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MAB16.
          Length = 512

 Score =  167 bits (424), Expect = 5e-40
 Identities = 124/418 (29%), Positives = 191/418 (45%), Gaps = 7/418 (1%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK--- 1360
            +GYI V +     LFY+F +++ +P   PL+LWL GGPGCS+I  G   E GPL +K   
Sbjct: 49   TGYIGVGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPGCSAIS-GLLFENGPLTMKLDV 107

Query: 1359 RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    YSW K ++++F++ PVG GFSY+              A+  + FL  W
Sbjct: 108  YNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTQQFNKPSDSG-EAKRIHEFLQKW 166

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
            L +   F  + F++AG+SY+G  VP   + +   N +    P INL+G+++GNP T+   
Sbjct: 167  LGKHQVFSSNPFYVAGDSYSGLVVPATVQEISKGNYE-CCNPPINLQGYVLGNPLTDYTT 225

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
                 + +A   A+ISD+ Y+  K+ C     N   +  + +  V    EE         
Sbjct: 226  GSNSRIPFAHGMALISDELYESLKKTCKGEYTNVHPRNTQCLKFV----EE--------- 272

Query: 825  RCLLNGSSSATGIRGVLD-LALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQK 649
                N  ++    + +LD L  T     Y YR +                 + N   V++
Sbjct: 273  ---FNKCTNRIFQQLILDPLCETETPDCYIYRYL-------------LTTYWANDATVRE 316

Query: 648  AFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPV 469
            A   N  + G    W  C   +   Y     S +P +      G +  IYSGD D  VP 
Sbjct: 317  ALQINKESIG---EWVRCYYSI--PYNNDIKSSMPYHVNNSISGYRSLIYSGDHDFEVPY 371

Query: 468  IGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEA 298
            +G++  I +L   +   WR W   +Q+ G    Y + +TF T++G GH    +KP EA
Sbjct: 372  LGTQAWIRSLNYSIIDDWRPWMVKNQIAGYTRTYANKMTFATIKGGGHTAE-SKPEEA 428



>sp|P37891|CBP3_ORYSA Serine carboxypeptidase III precursor (EC
            3.4.16.5).>pir|S22530|S22530 carboxypeptidase C (EC
            3.4.16.5) precursor - rice>gb:RICCBP3_1703563 Oryza
            sativa (japonica cultivar-group) cbp3 gene for serine
            carboxypeptidase III, complete cds.>gb:AP004090_1837555
            Oryza sativa (japonica cultivar-group) genomic DNA,
            chromosome 2, BAC clone:OJ1399_H05.>gb:AP004867_1846251
            Oryza sativa (japonica cultivar-group) genomic DNA,
            chromosome 2, PAC clone:P0036E06.
          Length = 500

 Score =  166 bits (421), Expect = 1e-39
 Identities = 135/465 (29%), Positives = 218/465 (46%), Gaps = 25/465 (5%)
 Frame = -2

Query: 1569 LPGQPSAPL-LTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYG 1393
            LPG P     L H +GY  +  +H   +FY+ FE++    + P+V+WL GGPGCSS    
Sbjct: 74   LPGLPQGVGDLGHHAGYYRLPNTHDARMFYFLFESRGKKED-PVVIWLTGGPGCSS-ELA 131

Query: 1392 AAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQ 1213
               E GP  +  N + L +NK+ W+  +N++FV+ P G GFSY++            V+ 
Sbjct: 132  VFYENGPFTISNN-MSLAWNKFGWDTISNIIFVDQPTGTGFSYSSDDRDTRHDETG-VSN 189

Query: 1212 DTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR-DRGIYPRINLKGFI 1036
            D Y+FL  + ++ P+F  +DFFI GESYAGHY+P  A  V   N+ + GI+  INLKGF 
Sbjct: 190  DLYSFLQVFFKKHPEFAKNDFFITGESYAGHYIPAFASRVHQGNKANEGIH--INLKGFA 247

Query: 1035 VGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYE 856
            +GN  T+    YK   +YA    +I    YD+  +        +   C  A+ +      
Sbjct: 248  IGNGLTDPAIQYKAYTDYALDMNLIKKSDYDRINK--------FIPPCEFAIKL------ 293

Query: 855  EIDIYNIYGPRCLLNGSSSATGIRGVLD------LALTNKERTYAYRRMKRIPGGYDPCY 694
                       C  NG +S      V +      + L   +  Y  R  K   G    CY
Sbjct: 294  -----------CGTNGKASCMAAYMVCNSIFSSIMKLVGTKNYYDVR--KECEGKL--CY 338

Query: 693  S-PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKG 520
                 E++F    V++A           + + +CS  V++A        L V    L++ 
Sbjct: 339  DFSNLEKFFGDKAVKEAIGV------GDLEFVSCSTTVYQAMLTDWMRNLEVGIPALLED 392

Query: 519  GLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQ----VGGR---IVEYHG 361
            G+ + IY+G+ D     +G+   + +++    S  + +  +H+    V G    +++ HG
Sbjct: 393  GINVLIYAGEYDLICNWLGNSRWVHSMEW---SGQKDFVSSHESPFVVDGAEAGVLKSHG 449

Query: 360  -LTFVTVRGAGHLVPLNKPSEALALIHSFLSGE-------ELPAQ 250
             L+F+ V  AGH+VP+++P  +L ++  F  G+       ELP Q
Sbjct: 450  PLSFLKVHNAGHMVPMDQPKASLEMLRRFTQGKLKEEWLAELPEQ 494



>gb:AC120983_1739976 Oryza sativa chromosome 3 BAC OSJNBb0011H13
            genomic sequence, complete sequence.
          Length = 476

 Score =  166 bits (420), Expect = 1e-39
 Identities = 139/478 (29%), Positives = 211/478 (44%), Gaps = 10/478 (2%)
 Frame = -2

Query: 1692 SRVEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITV 1513
            S +++ P     L +  L++ + C+ SSS         I +LPG          +GY++V
Sbjct: 10   SLLQLQPLRTCILFLLLLLLLLPCSASSSV--------ITHLPGFHGRLRFYLETGYVSV 61

Query: 1512 NQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAA-ELGPLR---VKRNG-- 1351
            ++  G  LFY+F E++  PS  P++LWL GGP CS  G+ A   E+GP+       NG  
Sbjct: 62   DEETGTELFYYFVESERSPSTDPVILWLTGGPLCS--GFTALVFEVGPMNFVLAPYNGSL 119

Query: 1350 VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFP 1171
              L  N+YSW K A+++F+++PVG GFSY                Q    FL  W    P
Sbjct: 120  PRLVNNQYSWTKIASIIFLDTPVGSGFSYARDPKGYNVGDISSSLQ-VVTFLKKWFNDHP 178

Query: 1170 QFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGL 991
             +  + F++ G SYAG                         KG++VG+P T+  YD   +
Sbjct: 179  SYLSNHFYVGGSSYAG-------------------------KGYMVGSPLTDPKYDRNSI 213

Query: 990  LEYAWSHAIISDQQYDKAKEVCDFTQENWSDK-CNEAMSIVFTKYEEIDIYNIYGPRCLL 814
            + YA    IISDQ Y+ A   C     N +++ C   ++ V     E+D  +I   +C  
Sbjct: 214  IPYAHGVGIISDQLYEAAVANCKGDYVNPTNEICANVLNAVDNLMSELDNGDILLDKCA- 272

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYD-PCYSPYAEEYFNRIDVQKAFHA 637
             G      I GV   AL  +     Y R+          C+S Y     N     KA   
Sbjct: 273  -GRLIPKPINGVSSRALLEE-----YSRLSEPTARPTINCFS-YRFYLLNIWMNDKATRD 325

Query: 636  NIRAPGSTVN-WKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGS 460
             ++    TV  W  C+  VF  Y     S +  +  L   G +  ++ GD D  VP +G+
Sbjct: 326  ALKIKKGTVGVWTRCNTEVF-PYARDVPSTIQYHLNLTTRGYRALVFCGDHDLMVPFLGT 384

Query: 459  RYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALAL 289
            +  I +L   +   WR+W  + Q  G  V Y + LTF T++G+GH     KP +  A+
Sbjct: 385  QAWIRSLNFTIIDDWRAWHLDGQAAGFTVMYDNNLTFATLKGSGHAPISYKPKQGFAM 442



>pir|A29412|A29412 carboxypeptidase C (EC 3.4.16.5) precursor - wheat
          Length = 499

 Score =  166 bits (420), Expect = 1e-39
 Identities = 124/443 (27%), Positives = 204/443 (46%), Gaps = 8/443 (1%)
 Frame = -2

Query: 1569 LPGQPSAPL-LTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYG 1393
            LPG P     L H +GY  +  +H   +FY+FFE++    + P+V+WL GGPGCSS    
Sbjct: 74   LPGLPEGVGDLGHHAGYYRLPNTHDARMFYFFFESRGKKED-PVVIWLTGGPGCSS-ELA 131

Query: 1392 AAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQ 1213
               E GP  +  N + L +NK+ W+K +N++FV+   G GFSY++            V+ 
Sbjct: 132  VFYENGPFTIANN-MSLVWNKFGWDKISNIIFVDPATGTGFSYSSDDRDTRHDEAG-VSN 189

Query: 1212 DTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIV 1033
            D Y+FL  + ++ P+F  +DFFI GESYAGHY+P  A  V   N+ +     INLKGF +
Sbjct: 190  DLYDFLQVFFKKHPEFVKNDFFITGESYAGHYIPAFASRVHQGNK-KNEGTHINLKGFAI 248

Query: 1032 GNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEE 853
            GN  T+    YK   +YA    +I    YD+  +        +   C  A+ +  T  + 
Sbjct: 249  GNGLTDPAIQYKAYTDYALDMNLIQKADYDRINK--------FIPPCEFAIKLCGTDGKA 300

Query: 852  IDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEE 676
              +        + N      G +   D+              K   G    CY     E+
Sbjct: 301  SCMAAYMVCNSIFNSIMKLVGTKNYYDV-------------RKECEGKL--CYDFSNLEK 345

Query: 675  YFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIY 499
            +F    V++A           + + +CS  V++A        L V    L++ G+ + IY
Sbjct: 346  FFGDKAVRQAIGV------GDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDGINVLIY 399

Query: 498  SGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGA 334
            +G+ D     +G+   + +++        K+   S+  +    G +  +  L+F+ V  A
Sbjct: 400  AGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKSHGALSFLKVHNA 459

Query: 333  GHLVPLNKPSEALALIHSFLSGE 265
            GH+VP+++P  AL ++  F  G+
Sbjct: 460  GHMVPMDQPKAALEMLRRFTQGK 482



>sp|P11515|CBP3_WHEAT Serine carboxypeptidase III precursor (EC
            3.4.16.5) (CP-WIII).>gb:WHTGIR_1727634 Wheat gibberellin
            responsive protein gene, complete cds.
          Length = 500

 Score =  166 bits (420), Expect = 1e-39
 Identities = 124/443 (27%), Positives = 204/443 (46%), Gaps = 8/443 (1%)
 Frame = -2

Query: 1569 LPGQPSAPL-LTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYG 1393
            LPG P     L H +GY  +  +H   +FY+FFE++    + P+V+WL GGPGCSS    
Sbjct: 74   LPGLPEGVGDLGHHAGYYRLPNTHDARMFYFFFESRGKKED-PVVIWLTGGPGCSS-ELA 131

Query: 1392 AAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQ 1213
               E GP  +  N + L +NK+ W+K +N++FV+   G GFSY++            V+ 
Sbjct: 132  VFYENGPFTIANN-MSLVWNKFGWDKISNIIFVDPATGTGFSYSSDDRDTRHDEAG-VSN 189

Query: 1212 DTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIV 1033
            D Y+FL  + ++ P+F  +DFFI GESYAGHY+P  A  V   N+ +     INLKGF +
Sbjct: 190  DLYDFLQVFFKKHPEFVKNDFFITGESYAGHYIPAFASRVHQGNK-KNEGTHINLKGFAI 248

Query: 1032 GNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEE 853
            GN  T+    YK   +YA    +I    YD+  +        +   C  A+ +  T  + 
Sbjct: 249  GNGLTDPAIQYKAYTDYALDMNLIQKADYDRINK--------FIPPCEFAIKLCGTDGKA 300

Query: 852  IDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEE 676
              +        + N      G +   D+              K   G    CY     E+
Sbjct: 301  SCMAAYMVCNSIFNSIMKLVGTKNYYDV-------------RKECEGKL--CYDFSNLEK 345

Query: 675  YFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIY 499
            +F    V++A           + + +CS  V++A        L V    L++ G+ + IY
Sbjct: 346  FFGDKAVRQAIGV------GDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDGINVLIY 399

Query: 498  SGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGA 334
            +G+ D     +G+   + +++        K+   S+  +    G +  +  L+F+ V  A
Sbjct: 400  AGEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKSHGALSFLKVHNA 459

Query: 333  GHLVPLNKPSEALALIHSFLSGE 265
            GH+VP+++P  AL ++  F  G+
Sbjct: 460  GHMVPMDQPKAALEMLRRFTQGK 482



>gb:AP004096_1837657 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1743_B12.
          Length = 448

 Score =  166 bits (419), Expect = 2e-39
 Identities = 122/415 (29%), Positives = 186/415 (44%), Gaps = 7/415 (1%)
 Frame = -2

Query: 1605 PKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLN 1426
            P  AQ +  + +LPG          +GY+ V +  G  LFY+F E++  P +  ++LWL+
Sbjct: 37   PPPAQAATVVTHLPGFDGPLPFYLETGYVGVEEETGTELFYYFVESERSPRSDVVLLWLS 96

Query: 1425 GGPGCSSIGYGAAAELGPLR--VKRNGVG----LHFNKYSWNKEANLLFVESPVGVGFSY 1264
            GGP CS    G   E+GP+    +R   G    L +N YSW K A++LFV+SPVG GFSY
Sbjct: 97   GGPRCSVFS-GFVYEIGPVMFVAERYSGGTVPRLEYNPYSWTKLASILFVDSPVGSGFSY 155

Query: 1263 TNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDR 1084
             +              Q    FL  WL+  P++  + F+I G+SYAG  VP + + + + 
Sbjct: 156  AHDPKGYDVGDISSSMQ-IVKFLRKWLDDHPKYLSNPFYIGGDSYAGKVVPLITQYLSEG 214

Query: 1083 NRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENW 904
              +   +P INLKG++VGNP   D  D    + Y+ S  +ISDQ Y+ A   C    EN 
Sbjct: 215  IEEMR-HPIINLKGYLVGNPSAGDKIDVNSRVPYSHSFGVISDQLYEAALANCKGDYENP 273

Query: 903  SDK-CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRM 727
            ++K C + M  +     E     +  P C  +      G R   +     +E  +     
Sbjct: 274  TNKPCTDVMQTINNLMSE-----VLEPACPFDWPWPMPG-RDASNRKSLTEEHYWLGDPP 327

Query: 726  KRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLL 547
               P      Y  Y   ++   +  +A  A     G+   W  C  P    Y     S +
Sbjct: 328  VEPPFSCFAAYRYYLSYFWANDNATRA--ALGIKEGTVTEWIRC--PTGLPYTRDLPSSI 383

Query: 546  PVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGG 382
              +  +   G +  +YSGD D  VP  G++  I +L   +   WR+W  + Q  G
Sbjct: 384  ECHFNVTTRGYRALVYSGDHDPIVPFSGTQAWIRSLNFSIVDDWRAWHLDGQAAG 438



>gb:AF141384_1771585 Matricaria chamomilla serine carboxypeptidase
            precursor, mRNA, complete cds.
          Length = 501

 Score =  166 bits (419), Expect = 2e-39
 Identities = 122/438 (27%), Positives = 209/438 (47%), Gaps = 13/438 (2%)
 Frame = -2

Query: 1542 LTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRV 1363
            L H +GY  +  SH   +FY+FFE++++  + P+V+WL GGPGCSS       E GP ++
Sbjct: 88   LGHHAGYYQIQHSHAAKMFYFFFESRNNKKD-PVVIWLTGGPGCSS-ELALFYENGPFKI 145

Query: 1362 KRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWL 1183
              N + L +N+Y W++ +NL++V+ P G GFSY++          + V+ D Y+FL  + 
Sbjct: 146  ADN-MTLVWNEYGWDQASNLIYVDQPTGTGFSYSSDKRDIRHDE-QGVSDDLYDFLQAFF 203

Query: 1182 ERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR-GIYPRINLKGFIVGNPETNDYY 1006
               P+F  +DF+I GESYAGHY+P +A  V   N+ + GI+  INLKGF +GN  T+   
Sbjct: 204  TEHPEFVDNDFYITGESYAGHYIPAIAARVHQGNKAKEGIH--INLKGFGIGNGLTDPAI 261

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
             Y+   +YA    +I + QY +   +           C  A+ +                
Sbjct: 262  QYQAYTDYALDMGLIKESQYKRINLIVPL--------CEAAIKL---------------- 297

Query: 825  RCLLNGSSSATGIRGVLD------LALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNR 664
             C  +G+ S      V +      L++      Y  R+       YD  +S   E   N+
Sbjct: 298  -CGTDGTVSCMAAYVVCNTIFSSILSIAGNINYYDIRKECVTSMCYD--FSD-METLLNK 353

Query: 663  IDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSGDA 487
              V++A           + + +CS  V+ A        L     +L++ G+K+ +Y+G+ 
Sbjct: 354  KSVRQALGV------GDIEFVSCSTTVYTAMLVDLMRNLEAGIPELLEDGIKMLVYAGEY 407

Query: 486  DGRVPVIGSRYCIEALKLPLKSPWRSWFH-----NHQVGGRIVEYHGLTFVTVRGAGHLV 322
            D     +G+   + A++   K  + +        +    G +  Y  L+F+ V  AGH+V
Sbjct: 408  DVICNWLGNSRWVHAMEWNGKEQFNALSEAPFEVDGSEAGLLKSYGPLSFLKVHDAGHMV 467

Query: 321  PLNKPSEALALIHSFLSG 268
            P+++P  AL ++  ++ G
Sbjct: 468  PMDQPKAALEMLKRWMDG 485



>gb:AF083796_1767026 Arabidopsis thaliana clone sps894 unknown mRNA.
          Length = 411

 Score =  166 bits (419), Expect = 2e-39
 Identities = 121/430 (28%), Positives = 191/430 (44%), Gaps = 9/430 (2%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A     + +LPG          +GYI + +     LFY+F +++ +P   PL+LWL+GGP
Sbjct: 20   AHSGSIVKFLPGFEGPLSFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSGGP 79

Query: 1416 GCSSIGYGAAAELGPLRVK---RNG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            GCSS+  G   E GP+ +K    NG    L    YSW K AN++F++ PVG GFSY+   
Sbjct: 80   GCSSL-TGLLFENGPVALKFEVYNGSVPSLVSTAYSWTKMANIIFLDQPVGAGFSYSRTP 138

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                      V +  Y FL  WL +  QF  + F++ G+SY+G  VP L + +   N   
Sbjct: 139  LVDKTSDTGEVKR-IYEFLQKWLSKHQQFFSNPFYVGGDSYSGMIVPPLVQEIAKGNY-- 195

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWS 901
                +INL+G+I+GNP T+   +    + YA   A+ISD+ Y   + +C       ++ +
Sbjct: 196  ----QINLQGYILGNPITDTESEQNYQIPYAHGMALISDELYKSMERICKGNYVNVDSLN 251

Query: 900  DKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKR 721
             KC + +        +++ Y+I  P C +                       Y Y  M  
Sbjct: 252  TKCYKLIKDYQKCLHKLNKYHILLPDCDITSPDCF----------------LYRYTLM-- 293

Query: 720  IPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPV 541
                           + N   V++A   N    GS   W  C+     +Y Y   S +  
Sbjct: 294  -------------TFWANNKSVREALQVN---KGSIGEWVQCNYKNI-SYNYDIKSSVAY 336

Query: 540  YEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-H 364
            + K    G +  IY+GD D  VP + ++  I +L   +   WR W  N Q+ G    Y +
Sbjct: 337  HMKNSIDGYRSLIYNGDHDMMVPFLATQAWIRSLNYSITDDWRPWMINDQIAGYTRSYSN 396

Query: 363  GLTFVTVRGA 334
             +TF T++ +
Sbjct: 397  KMTFATIKAS 406



>gb:AE017354_461243 Legionella pneumophila subsp. pneumophila str.
            Philadelphia 1, complete genome.
          Length = 423

 Score =  166 bits (419), Expect = 2e-39
 Identities = 138/463 (29%), Positives = 215/463 (46%), Gaps = 13/463 (2%)
 Frame = -2

Query: 1608 SPKAAQESDKIGYLPGQPSAPLLTH-FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLW 1432
            S   A   D++ YLPG    P+  + ++GY  VN   G  LFYWF E+ +   + P+VLW
Sbjct: 15   SSAMAATPDQVTYLPGW--GPIKNNQYAGYFPVNPKAG--LFYWFVESNNPSMDAPIVLW 70

Query: 1431 LNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            LNGGPG +S+ YG   E GP +V +NG  L   K SW K AN L ++ P GVG+SY +  
Sbjct: 71   LNGGPGAASL-YGFFMENGPYQVDKNG-KLTARKDSWTKAANYLVIDQPAGVGYSYGSSK 128

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRD 1075
                        Q     +    ++ P+  G   F+AGESYAG Y+PQLA  ++ D+N  
Sbjct: 129  SYGSEGEAIDQLQGALQLI---FKKHPELYGKPLFLAGESYAGKYLPQLAIRLLKDKN-- 183

Query: 1074 RGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDK 895
                  +NLKG ++G+P  N     K  ++YA+ H +I ++   + + + +   +   DK
Sbjct: 184  ------MNLKGLLLGDPWINPRLQQKANIDYAYYHGLIDNKARKRVRVLYENCVKE-IDK 236

Query: 894  CNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP 715
             + + S      E+I  + I      LN ++ ATG+    D  + N              
Sbjct: 237  QSPSTSKANKTCEQIQEF-IKQESGGLNLANIATGVEPE-DTNMVN-------------- 280

Query: 714  GGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKY-TTFSLLPVY 538
                         Y N+  V++A H     P +   +KT S    +  +     S+  +Y
Sbjct: 281  -------------YLNQKVVREALH----IPVTVSEFKTFSTAAAKKLEIGEQDSVADLY 323

Query: 537  EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLP----------LKSPWRSWFHNHQV 388
             +L+  G++I IY+G  DG+     S +    L L            K+P   W  N++V
Sbjct: 324  PQLLAAGIRILIYNGLEDGK----DSNFLSTELLLASLDWHGKNAFAKAPTCIWRTNNEV 379

Query: 387  GGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
             G      GLT V +RGAGHL P+++P+    L   F++ + L
Sbjct: 380  SGYAKGAVGLTQVKIRGAGHLAPIDQPARVFDLFKHFINDKPL 422



>gb:AE016820_1749627 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VII, complete sequence.
          Length = 563

 Score =  165 bits (417), Expect = 3e-39
 Identities = 131/450 (29%), Positives = 209/450 (46%), Gaps = 22/450 (4%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +  +SGY+ V ++  +  FYWFFE+++ P N P+VLWLNGGPGCSS+  G   ELGP 
Sbjct: 152  PDVKQYSGYLDV-EAEDKHFFYWFFESRNDPKNDPIVLWLNGGPGCSSMT-GLFFELGPS 209

Query: 1368 RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVN 1189
             + +    +  N YSWN  A+++F++ PV  G+SY++          K    D Y FL  
Sbjct: 210  SIDQKLKPVR-NPYSWNTNASVIFLDQPVNAGYSYSSNSVANTVAASK----DVYAFLEL 264

Query: 1188 WLERFPQFK-GHDFFIAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVGNPETN 1015
            +  +FP+++ G  F IAGESYAGHY+P +A E++   + +R       L   ++GN  T+
Sbjct: 265  FFRQFPEYQAGQKFHIAGESYAGHYIPAIAAEILSHPDEERSF----KLSSVLIGNGLTD 320

Query: 1014 DYYDYKGLLEYAWSH----AIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEID 847
                Y      A       AI+  +Q     E                + ++ T Y   +
Sbjct: 321  PLTQYPYYERMACGGGGEPAILGPEQCSAMNETLP-----------RCLRLIRTCYTLQN 369

Query: 846  IYNIYGPRCLLNGSSSATGIRGVLDLALTNKERT--YAYRRMKRIPGGYDPCYSP--YAE 679
            +++        NG+             LT  +RT    Y   K   G    CY    Y+E
Sbjct: 370  VWSCVPASLYCNGNQ------------LTPFQRTGKNVYDVRKECEGQL--CYDDMKYSE 415

Query: 678  EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKI 508
            EY N  +V KA  A + +      + +C+  V R +      + P      +++  GL +
Sbjct: 416  EYLNTPEVIKAVGAEVDS------FTSCNFDVNRNFLLNGDWMKPYQRHVTEILDKGLPV 469

Query: 507  WIYSGDADGRVPVIGSRYCIEAL---------KLPLKSPWRSWFHNHQVGGRIVEYHGLT 355
             IY+GD D     +G+R   + L         K P+K PW     +    G +  Y   T
Sbjct: 470  LIYAGDKDFICNWLGNRAWTDELPWKHHDDFTKQPIK-PWNG--PSGDQAGEVKNYKHFT 526

Query: 354  FVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
            ++ V GAGH+VP + P  +L +++++L G+
Sbjct: 527  YLRVFGAGHMVPYDVPENSLDMLNTWLQGD 556



>gb:AE017346_1757516 Cryptococcus neoformans var. neoformans JEC21
            chromosome 6, complete sequence.
          Length = 539

 Score =  164 bits (416), Expect = 4e-39
 Identities = 131/461 (28%), Positives = 210/461 (45%), Gaps = 31/461 (6%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +   SGY+ ++++  R LF+WF E++ +P   PLVLWLNGGPGCSS   G   ELG  
Sbjct: 106  PSVKQLSGYLDISET--RHLFFWFQESRENPDEDPLVLWLNGGPGCSST-TGLLFELGGC 162

Query: 1368 RVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVN 1189
             ++  G    FN++SWN  AN+L+++ P+GVG+SY +             A+D Y FLV 
Sbjct: 163  NIRDKGENTTFNEHSWNSVANVLYLDQPIGVGYSYADEGEVNNSPA---AAEDVYAFLVL 219

Query: 1188 WLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGI-----YPRINLKGFIVGNP 1024
            ++ +F ++   DF +AGESYAG Y+P +A VV   N    +      P+INLK  ++GN 
Sbjct: 220  FISKFREYSKLDFHVAGESYAGTYIPNIASVVHKNNIALDLVPTPSVPKINLKSVMIGNG 279

Query: 1023 ETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDI 844
             T+ Y  +  + ++A +        YD     CD    +   + N    ++   Y+    
Sbjct: 280  LTDPYAQFGSVPDWACNSPY---APYDDPSPECD----SLRTRANRCQGLISGCYKTNSR 332

Query: 843  YNIYGPR--CLLNGSSSATGIRGVLDLALT-----NKERTYAYRRMKRIPGGYDPCYSPY 685
            +        C    +      R + D+  T      K+    YR M             +
Sbjct: 333  FTCVPAALYCWSMFNELQDLGRNMYDVRKTCDKSPEKDGPLCYREM------------GW 380

Query: 684  AEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAY------KYTTFSLLPVYEKLIK 523
             E Y N+ +V+K   A  R     V +++C+  + + +       +    LLP    L++
Sbjct: 381  METYLNKPEVKKELGAPER-----VTFQSCNMQINQNFLLHGDGMHYAGGLLP---DLVE 432

Query: 522  GGLKIWIYSGDADGRVPVIGSRYCIEALKLP-LKSPWRSWFHNH-QVGGRIVEY------ 367
              +++ IY+G AD  V  IG    ++ L+   L S   + F N     G +  Y      
Sbjct: 433  DDIRVLIYAGQADMLVNYIGCASVLDNLQTSYLASYLAAPFVNFTSPDGEVSGYTKSASK 492

Query: 366  -----HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
                   + FV    AGH+VP + P  AL ++  +L  E L
Sbjct: 493  DGKGSGNVAFVAFHNAGHMVPHDDPEGALRMVGRWLKNEPL 533



>gb:AP002047_1821632 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MQC3.
          Length = 436

 Score =  164 bits (414), Expect = 7e-39
 Identities = 132/459 (28%), Positives = 204/459 (44%), Gaps = 13/459 (2%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A  S  I YLPG          +GYI V Q     LFY+F +++++P   PL++WL GGP
Sbjct: 22   ADSSSIIRYLPGFEGPLPFELETGYIGVGQKEEDQLFYYFIKSENNPEEDPLLVWLTGGP 81

Query: 1416 GCSSIGYGAAAELGPLRVK---RNG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            GCSS   G   E GPL  K    NG    L    YSW K AN+++++ PVG GFSY+   
Sbjct: 82   GCSSFS-GLVYENGPLAFKVETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNP 140

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                      V +    F+  WL + P++  + F++ G SY+G  +P + + + + N   
Sbjct: 141  FADIPSDTGSVKR-VNEFVRKWLAKHPEYFSNPFYVTGNSYSGKVIPAIVQEISNGNY-I 198

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSH--AIISDQQYDKAKEVCDFTQENWSD 898
               P+INL+G+++GNP    YYD+       ++H  A+ISD+ ++  K  C         
Sbjct: 199  CCKPQINLQGYVIGNPVA--YYDHDKDFRIPFAHGVALISDELFESLKASCG-------- 248

Query: 897  KCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNK-ERT----YAYR 733
                        Y  +D  N    + + +     +GI    +L L +K E T    Y YR
Sbjct: 249  ----------GSYSVVDPLNTECLKLIEDYDKCVSGI--YEELILKSKCEHTSPDCYTYR 296

Query: 732  RMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS 553
             +              +E + +   V++A        GS   W+ C   V         S
Sbjct: 297  YL-------------LSEYWADNETVRRALKV---VKGSKGTWERCDYRVLS--NQDIKS 338

Query: 552  LLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIV 373
             +P +      G +  + SGD D  +P +G++  I +L   +   WR W    QV G   
Sbjct: 339  SIPFHINNSIRGYRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTK 398

Query: 372  EY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
             Y + +T  TV+G GH +   KP E   L   ++SG+ L
Sbjct: 399  TYANKMTLATVKGGGHTLEY-KPEENSVLFKRWISGQPL 436



>sp|P52716|YPP3_CAEEL Putative serine carboxypeptidase F32A5.3
            precursor (EC 3.4.16.-).>pir|T16230|T16230 hypothetical
            protein F32A5.3 - Caenorhabditis
            elegans>gb:U20864_1401934 Caenorhabditis elegans cosmid
            F32A5, complete sequence.
          Length = 574

 Score =  164 bits (414), Expect = 7e-39
 Identities = 141/535 (26%), Positives = 224/535 (41%), Gaps = 71/535 (13%)
 Frame = -2

Query: 1665 RTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALF 1486
            RT L V FLV+ VL        +  E D I  LPG         +SGY+  N +    + 
Sbjct: 3    RTLLGVAFLVVTVL--------SQGEKDLIQNLPGLLFKANFKSYSGYVDANANGTWKMH 54

Query: 1485 YWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEAN 1306
            Y   E++S+P   PL++W NGGPGCSS+G G   ELGP  V  +G  L+ N Y+WN +AN
Sbjct: 55   YMLTESRSNPDTDPLLVWFNGGPGCSSLG-GLFEELGPFYVNFDGQTLYENPYAWNAKAN 113

Query: 1305 LLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE-RFPQFKGHDFFIAGESY 1129
            +L++ESP+GVG+SY           D   A   Y  L N+     P++    F+++GESY
Sbjct: 114  VLYLESPIGVGYSYDTTTPGYFQANDDQSAAQNYQALTNFFNVAQPKYTNRTFYLSGESY 173

Query: 1128 AGHYVPQLAEVVFDR-NRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQ 952
            AG Y+P L +++    N     +P  N +G  +GN   N       L  ++  H  +S+Q
Sbjct: 174  AGIYIPMLTDLIVQGINNPNQPFPNKNFQGSAIGNGFMNVAGLLNALTLWSAYHGRVSEQ 233

Query: 951  QYDKAKEVC---------DFTQENWSDK----------CNEAMSIVFTK----YEEIDIY 841
             +   K  C         DF+Q   S            C   +  + ++     E  D Y
Sbjct: 234  NWADIKANCSKGADVDSFDFSQFTTSQNKIDYVGDGSYCGNLIQPLISQNALGNEGFDQY 293

Query: 840  NIYG---PRCLLNGSSSATGIRGVLDL--ALTNKERTYAYRRMKRIPG------------ 712
            N Y     + +      A G R        +++ ++   Y+++    G            
Sbjct: 294  NFYQECYDKSVFQAPPPAGGKRHKRSAMQGVSSVQKNLQYQQLGNFQGTSNLAKNTATLV 353

Query: 711  ---------GYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAY--KY 565
                     GY         +Y N  +VQ A +           W+ C   ++  Y  KY
Sbjct: 354  NRFSNDNQFGYFCWNEDAVSKYLNSDNVQNALNIPQAWKDQKNTWEDCRMSIYNNYTLKY 413

Query: 564  TTFSLLPVYEKLIKG---GLKIWIYSGDADGRVPVIGSRYCI------EALKLPLKSPWR 412
             T +    +  +I       +  IY+GD D     +G    I        L    ++PW 
Sbjct: 414  NTTNRF--FNNIITNLTTDFRFLIYNGDVDTVCNYLGDAKHILQVAKDNGLTSGPRTPW- 470

Query: 411  SWFHNHQVGGRIVEYHG---------LTFVTVRGAGHLVPLNKPSEALALIHSFL 274
             + +N Q+ G +  Y G         +  +TV+GAGH+VP ++   ++ +I +F+
Sbjct: 471  YYSNNQQLAGYVQTYSGKNKNNAMITIDLLTVKGAGHMVPYDRAGPSVQMISNFV 525



>gb:AC120983_1739972 Oryza sativa chromosome 3 BAC OSJNBb0011H13
            genomic sequence, complete sequence.
          Length = 458

 Score =  162 bits (409), Expect = 3e-38
 Identities = 129/491 (26%), Positives = 213/491 (43%), Gaps = 14/491 (2%)
 Frame = -2

Query: 1689 RVEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVN 1510
            R  +  P R    V FL++ +L   S+S      S  I +LPG          +GY+ V+
Sbjct: 8    RCMLLQPPRLATCVLFLLLPLLLPCSAS------SSVITHLPGFHGRLPFHLETGYVGVD 61

Query: 1509 QSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRV---KRNG--VG 1345
            +  G  LFY+F E++  PS  P++LWL GGPGCS    G   E+GP++      NG    
Sbjct: 62   EETGTELFYYFVESERSPSTGPVILWLTGGPGCSGFS-GVVFEVGPMKYVLEPYNGSLPR 120

Query: 1344 LHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQF 1165
            L +N+YSW + A++LF+++PVG GFSY +              Q    FL  W    P++
Sbjct: 121  LVYNQYSWTQMASILFLDTPVGSGFSYAHDPKGYNVGDISSSLQ-VVTFLKKWFNDHPRY 179

Query: 1164 KGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLE 985
              + F++ G SYAG  +P + + + +                 VGNP T    D    + 
Sbjct: 180  LSNHFYVGGSSYAGKVIPIIMKFISE-----------------VGNPITGSKIDDNFKIP 222

Query: 984  YAWSHAIISDQQYDKAKEVC--DFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLN 811
            Y+    IISDQ Y+ A   C  D+     ++ C +A++ +     E+D  NI   +C+  
Sbjct: 223  YSHGVGIISDQLYEAAVANCNGDYVTTT-NELCAKALNAIDNLMSEVDYGNILDDKCVRA 281

Query: 810  GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYF------NRIDVQK 649
                   +         ++ R+     ++       P  + ++  Y+      N    ++
Sbjct: 282  TPKPINEV---------SRSRSLQEDYIRLSEPTVRPTINCFSYRYYLSFLWMNNNLTRE 332

Query: 648  AFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPV 469
            A        G+   W  C   +   Y     S +  +  L  GG +  ++SGD D  +P 
Sbjct: 333  ALKIK---KGTVGEWIRCKTGL--PYVQDVASSIKYHFDLTTGGYRALVFSGDHDLILPF 387

Query: 468  IGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALA 292
            + ++  I +L   +   WR+W  + Q  G  + Y + LTF TV+G GH      P +  A
Sbjct: 388  LSTQAWIRSLNFSIVDEWRAWHVDGQAAGFTILYANNLTFATVKGGGHTSIETNPKQGFA 447

Query: 291  LIHSFLSGEEL 259
            +   +L  + L
Sbjct: 448  MGKRWLDNKPL 458



>gb:AC069472_1540873 Arabidopsis thaliana chromosome 3 BAC F28J15
            genomic sequence, complete sequence.
          Length = 435

 Score =  161 bits (408), Expect = 3e-38
 Identities = 126/457 (27%), Positives = 197/457 (43%), Gaps = 9/457 (1%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNG 1423
            K A  S  I YLPG          +GYI V       +FY+F +++S+P   PL++WL+G
Sbjct: 19   KHADSSSIIKYLPGFEGPLPFELETGYIGVGDEDEDQMFYYFIKSESNPEEDPLLVWLSG 78

Query: 1422 GPGCSSIGYGAAAELGPLRVKRNGVG-----LHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            GPGCSS   G   E GPL  K          L    YSW K AN+++++ PVG GFSY+ 
Sbjct: 79   GPGCSSF-TGLVYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGAGFSYSR 137

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                         A+    F+  WL + P +  + F++ G SY+G  +P + + + + N 
Sbjct: 138  NPFADRPSDTG-SAKLVNEFVRKWLAKHPDYFSNPFYVTGNSYSGKVIPAIVQEISNGNY 196

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSD 898
                 P+INL+G+++GNP     +D    + +A   A+ISD+ ++  K  C  +      
Sbjct: 197  -ICCKPQINLQGYVIGNPVAYYDHDKDSRIPFAHGVALISDELFESLKRSCGGSYSIVDP 255

Query: 897  KCNEAMSIVFTKYEEID-IYN--IYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRM 727
               E + ++   ++ +  IY   I  P+C                   T     Y YR +
Sbjct: 256  LNTECLKLIKDYHKCVSGIYQELILKPKC------------------ETTSPDCYTYRYL 297

Query: 726  KRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLL 547
              I              + N   V++A        GS   W+ C   V         S +
Sbjct: 298  LSI-------------YWANNEIVRRALKV---VEGSKGKWERCDLSV--RSNQDIKSSI 339

Query: 546  PVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY 367
            P +      G +  + SGD D  +P +G++  I +L   +   WR W    QV G    Y
Sbjct: 340  PYHMNNSIKGYRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTKTY 399

Query: 366  -HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
             + +T  TV+G GH +   KP E   L   ++SG+ L
Sbjct: 400  ANKMTLATVKGGGHTLEY-KPEENSILFKRWISGQPL 435



>gb:AY184244_1308371 Trypanosoma cruzi serine carboxypeptidase
            precursor (CBP) gene, complete cds.
          Length = 466

 Score =  161 bits (408), Expect = 3e-38
 Identities = 136/469 (28%), Positives = 206/469 (43%), Gaps = 33/469 (7%)
 Frame = -2

Query: 1575 GYLPGQPSAPLLTHFSGYITVNQSHG-RALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            G+ P  P  P    +SGY  +    G +  FYW F  ++     P++LW+ GGPGCSS+ 
Sbjct: 40   GWHPCDPDVP---QWSGYFDIPGREGDKHYFYWAFGPRNGNPEAPVLLWMTGGPGCSSM- 95

Query: 1398 YGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFV 1219
            +   AE GP  V      ++ N YSWN EA +++V+ P GVGFSY           ++ V
Sbjct: 96   FALLAENGPCLVNETTGDIYKNNYSWNNEAYVIYVDQPAGVGFSYAE--VEDYDSNEEEV 153

Query: 1218 AQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGF 1039
            ++D Y+FL  +     + + +  F+ GESY GHY P  A  +   NR+    P I L G 
Sbjct: 154  SEDMYHFLQAFFRAHQKLRKNKLFVVGESYGGHYAPATAHHINKANREHVGLP-IRLAGL 212

Query: 1038 IVGNPETNDYYDYKGLLEYAW-------SHAIISDQQYDKAKEVCDFTQENWSDKCNEAM 880
             VGN  T+ Y  Y     +AW           +S++ Y +   +           C +A+
Sbjct: 213  AVGNGLTDPYTQYAAYPSFAWGWCREKLGEPCVSEEGYQQMSSMV--------PPCQKAI 264

Query: 879  SIVFTKYEEIDIYNIYGPRCLLN---GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGG 709
             I  +    I        R L N   G  SATG+              Y  R+    P  
Sbjct: 265  EICNSDNNFIAKVACVTARVLCNPIIGVYSATGL------------NNYDIRK----PCI 308

Query: 708  YDPCYSPYA-EEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPV--------FRAYKYTTF 556
               CY+  A   + NR DVQ +  A  +       W++C+  V        F+ + YT  
Sbjct: 309  GTLCYNFDALNAFMNREDVQSSLGAKRQV------WQSCNMEVNLMFLMDWFKNFNYTVP 362

Query: 555  SLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKS--------PWRSWFH 400
            +LL       + G+ + IY+G+ D     IG++    AL  P K+        P+R+   
Sbjct: 363  TLL-------EDGVSVMIYAGEMDFICNWIGNKQWTTALNWPGKAVFNAAPDEPFRA--P 413

Query: 399  NHQVGGRI-----VEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
            +  V G +          LTFV V  AGH+VP+++P+ A  +I +FL G
Sbjct: 414  DGTVAGLVRTAAAASTSNLTFVQVYNAGHMVPMDQPASAFVMISNFLQG 462



>sp|P00729|CBPY_YEAST Carboxypeptidase Y precursor (EC 3.4.16.5)
            (Carboxypeptidase YSCY).>pir|A26597|CPBYY
            carboxypeptidase C (EC 3.4.16.5) precursor [validated] -
            yeast (Saccharomyces cerevisiae)>gb:SC8175_1705512
            S.cerevisiae chromosome XIII cosmid
            8175.>gb:YSCPRCCPY_1730346 Yeast vacuolar PRC1 gene
            encoding preproprotein carboxypeptidase Y (CPY), complete
            cds.
          Length = 532

 Score =  159 bits (403), Expect = 1e-37
 Identities = 121/449 (26%), Positives = 205/449 (45%), Gaps = 22/449 (4%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +T ++GY+ V +   +  F+W FE+++ P+  P++LWLNGGPGCSS+  G   ELGP 
Sbjct: 123  PNVTQYTGYLDV-EDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSL-TGLFFELGPS 180

Query: 1368 RV--KRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFL 1195
             +      +G   N YSWN  A ++F++ PV VGFSY+               +D YNFL
Sbjct: 181  SIGPDLKPIG---NPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVA---AGKDVYNFL 234

Query: 1194 VNWLERFPQF--KGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPE 1021
              + ++FP++  KG DF IAGESYAGHY+P  A  +   ++DR      NL   ++GN  
Sbjct: 235  ELFFDQFPEYVNKGQDFHIAGESYAGHYIPVFASEILS-HKDR----NFNLTSVLIGNGL 289

Query: 1020 TNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIY 841
            T+    Y      A        +      E C   +    D     + ++ + Y+   ++
Sbjct: 290  TDPLTQYNYYEPMACGE---GGEPSVLPSEECSAME----DSLERCLGLIESCYDSQSVW 342

Query: 840  NIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPY--AEEYFN 667
            +        N +           LA   +     Y   K   GG + CY      ++Y N
Sbjct: 343  SCVPATIYCNNA----------QLAPYQRTGRNVYDIRKDCEGG-NLCYPTLQDIDDYLN 391

Query: 666  RIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVY---EKLIKGGLKIWIYS 496
            +  V++A  A +       ++++C+  + R + +    + P +     L+   L I +Y+
Sbjct: 392  QDYVKEAVGAEVD------HYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYA 445

Query: 495  GDADGRVPVIGSRYCIEALKLPLKSPW-----------RSWFHN--HQVGGRIVEYHGLT 355
            GD D     +G++   + L      PW           R+W  +   +V G +  Y   T
Sbjct: 446  GDKDFICNWLGNKAWTDVL------PWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFT 499

Query: 354  FVTVRGAGHLVPLNKPSEALALIHSFLSG 268
            ++ V   GH+VP + P  AL++++ ++ G
Sbjct: 500  YLRVFNGGHMVPFDVPENALSMVNEWIHG 528



>gb:CR382129_1662267 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 458

 Score =  158 bits (399), Expect = 4e-37
 Identities = 133/452 (29%), Positives = 207/452 (45%), Gaps = 18/452 (3%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P       +  FSGY+ V +   +  FYWFFE+++ P+  P+VLWL+GGPGCSS+  G  
Sbjct: 38   PSSLGVDTVKQFSGYLDVGKDK-KHFFYWFFESRNDPAKDPIVLWLSGGPGCSSMS-GLF 95

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             E GP  +  +   +  N +SWN  A+++F++ PVG GFSY++             A D 
Sbjct: 96   FENGPSSIGADIKPIK-NDFSWNSNASVIFLDQPVGSGFSYSDEPVDTTAA----AAIDV 150

Query: 1206 YNFLVNWLERFPQF-KGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVG 1030
            Y FL  +   FPQ+ KG  F I  ESY GHY    AE +   ++   ++   +L    VG
Sbjct: 151  YAFLNLFFTSFPQYNKGQSFHITSESYGGHYAHVFAEEILKHSKPERVF---DLASIAVG 207

Query: 1029 NPETNDYYDYKGLLEYAWSH----AIISDQ----QYDKAKEVCDFTQENWSDKCNEAMSI 874
            N   +  +   G            AI  D       D   +V    Q+ ++D  N  +  
Sbjct: 208  NGIWDSLHQAAGYEPMGCGKGGVPAIFDDNTCKGMQDVLPQVVSEIQQCYNDPQNSNVC- 266

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
                 + +  YN         G  S TG+  V D  +T K  T        +P G   CY
Sbjct: 267  ----QQAVGDYN-----DAFLGPISQTGL-NVYD--ITKKCDT-------SVPSGL--CY 305

Query: 693  S--PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKL--I 526
            +   Y+ +Y N+ +VQKA   +   PG  + + +CS  V  A+   +  +LP  +    +
Sbjct: 306  AGMEYSVQYLNKPEVQKALGVH---PG--ITFSSCSGQVNGAFYDQSDEVLPYIKAFPAL 360

Query: 525  KGGLKIWIYSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHG 361
               + + IY+GD D     +G++Y    L         K    SW    +  G I  +  
Sbjct: 361  LEKIPVLIYAGDRDYICNWVGNQYWTGNLTWSGQDEFNKQQLSSWKVEGEASGEIKNHGH 420

Query: 360  LTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             TF+ V GAGH+VP +KP +ALA+++ ++ G+
Sbjct: 421  FTFLRVFGAGHMVPHDKPKQALAILNRWIGGD 452



>gb:AB020752_1514673 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MTH16.
          Length = 443

 Score =  157 bits (398), Expect = 5e-37
 Identities = 118/431 (27%), Positives = 191/431 (44%), Gaps = 7/431 (1%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKR-- 1357
            +GY+++ +S    LFY+F +++ +P N PL++WL GGPGCSSI  G     GPL  K   
Sbjct: 43   TGYVSIGESGDVELFYYFVKSERNPENDPLMIWLTGGPGCSSI-CGLLFANGPLAFKGDE 101

Query: 1356 -NGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    +SW K AN+L++E+P G G+SY            K + Q    FL +W
Sbjct: 102  YNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFESSDTKQMHQID-QFLRSW 160

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
              + P+F  + F++ G+SY+G  VP   + +         +  I  +G+++GNP T+   
Sbjct: 161  FVKHPEFISNPFYVGGDSYSGKIVPGAVQQI-----SLVTHSYIIEQGYVLGNPVTDKNI 215

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
            +    + +A    +ISD+ ++  +  C     N  D  N   S     Y+   +  IY  
Sbjct: 216  ETNYRVPFAHGMGLISDELFESLERSCGGKFFN-VDPSNARCSNNLQAYDHC-MSEIYSE 273

Query: 825  RCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKA 646
              LL        +    ++  T++ RTY Y         +   +    E     + V+K 
Sbjct: 274  HILLRNCKVDYVLADTPNIR-TDRRRTYRY---------FLSAFWANDENVRRALGVKKV 323

Query: 645  FHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVI 466
                      T  W  C+      Y +  F+ +P +      G +  IYSGD D  VP  
Sbjct: 324  ---------PTGKWNRCNSQNI-PYTFEIFNAVPYHVNNSLKGFRSLIYSGDHDSMVPFS 373

Query: 465  GSRYCIEALKLPLKSPWRSW-FHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALA 292
             ++  I AL   +   WR W   ++QV G    Y + +TF T++G GH      P +   
Sbjct: 374  STQAWIRALNYSIVDDWRPWMMSSNQVAGYTRTYANKMTFATIKGGGHTAEYT-PDQCSL 432

Query: 291  LIHSFLSGEEL 259
            +   ++ GE L
Sbjct: 433  MFRRWIDGEPL 443



>gb:AX083419_1460838 Sequence 111 from Patent WO0112660.
          Length = 476

 Score =  157 bits (397), Expect = 6e-37
 Identities = 124/466 (26%), Positives = 219/466 (46%), Gaps = 15/466 (3%)
 Frame = -2

Query: 1617 ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLV 1438
            E+   +  +E   +G  PG      +  ++G++TVN+++   LF+WFF A+  P + P+V
Sbjct: 50   EAGKIQKGRELSLVGPFPGLN----MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVV 105

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            LWL GGPG SS+ +G   E GP  V  N + L    + W    ++L++++PVG GFS+T+
Sbjct: 106  LWLQGGPGGSSM-FGLFVEHGPYVVTSN-MTLRDRDFPWTTTLSMLYIDNPVGTGFSFTD 163

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     D  VA+D Y+ L+ + + FP++K +DF++ GESYAG YVP +A ++   N 
Sbjct: 164  DTHGYAVNEDD-VARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNP 222

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-----DFTQ 913
             R +  +INL G  +G+  ++      G  E+ +   ++ ++Q    ++ C        +
Sbjct: 223  VREV--KINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK 280

Query: 912  ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNG--SSSATGIRGVLDLALTNKERTYA 739
            +NW           F  +E +D         LL+G  +S  +  + V     T     Y 
Sbjct: 281  QNW-----------FEAFEILD--------KLLDGDLTSDPSYFQNV-----TGCSNYYN 316

Query: 738  YRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTT 559
            + R        +P    Y  ++ +  +V++A H        T N  T  +   R  + T 
Sbjct: 317  FLRCT------EPEDQLYYVKFLSLPEVRQAIHVG----NQTFNDGTIVEKYLR--EDTV 364

Query: 558  FSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI--------EALKLPLKSPWRSWF 403
             S+ P   + I    K+ IY+G  D  V    + + +        +  K   K  W+ + 
Sbjct: 365  QSVKPWLTE-IMNNYKVLIYNGQLDIIVAAALTEHSLMGMDWKGSQEYKKAEKKVWKIFK 423

Query: 402  HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             + +V G I +      V +RG GH++P ++P  A  +I+ F+ G+
Sbjct: 424  SDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGK 469



>gb:CR857214_1181461 Pongo pygmaeus mRNA; cDNA DKFZp469A0432 (from
            clone DKFZp469A0432).
          Length = 476

 Score =  157 bits (397), Expect = 6e-37
 Identities = 120/438 (27%), Positives = 204/438 (46%), Gaps = 15/438 (3%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            ++G++TVN+++   LF+WFF A+  P + P+VLWL GGPG SS+ +G   E GP  V  N
Sbjct: 74   YAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGFSSM-FGLFVEHGPYVVTSN 132

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
             + L    + W    ++L++++PVG GFS+T+         D  VAQD Y+ L+ + + F
Sbjct: 133  -MTLRDRDFPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDD-VAQDLYSALIQFFQIF 190

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
            P++K +DF++ GESYAG YVP +A ++   N  R +  +INLKG  +G+  ++      G
Sbjct: 191  PEYKNNDFYVTGESYAGKYVPAIAHLIHSLNPVREV--KINLKGIAIGDGYSDPESIIGG 248

Query: 993  LLEYAWSHAIISDQQYDKAKEVC-----DFTQENWSDKCNEAMSIVFTKYEEIDIYNIYG 829
              E+ +   ++ ++Q    ++ C        ++NW           F  +E +D      
Sbjct: 249  YAEFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNW-----------FQAFEILD------ 291

Query: 828  PRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQK 649
               LL+G  ++            N      Y    R     D  Y  YA ++ +  +V++
Sbjct: 292  --KLLDGDLTSD------PSYFQNVTGCSNYCNFLRCTEPEDQLY--YA-KFLSLPEVRQ 340

Query: 648  AFHANIRA--PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRV 475
            A H   R    G+TV      D V     + T          I    K+ IY+G  D  V
Sbjct: 341  AIHVGNRTFNDGTTVEKYLREDTVQSVKPWLT---------EIMNNYKVLIYNGQLDIIV 391

Query: 474  PVIGSRYCI--------EALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVP 319
                + + +        +  K   K  W+ +  + +V G + +      V +RG GH++P
Sbjct: 392  AAALTEHSLMGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYVRQVGDFHQVIIRGGGHILP 451

Query: 318  LNKPSEALALIHSFLSGE 265
              +P  A  +I+ F+ G+
Sbjct: 452  YIQPLRAFDMINRFIYGK 469



>sp|Q9H3G5|CPVL_HUMAN Probable serine carboxypeptidase CPVL precursor
            (EC 3.4.16.-) (Carboxypeptidase, vitellogenic-like)
            (Vitellogenic carboxypeptidase- like protein) (VCP-like
            protein).>gb:AF106704_1884032 Homo sapiens putative
            serine carboxypeptidase CPVL mRNA, complete cds.
          Length = 476

 Score =  157 bits (397), Expect = 6e-37
 Identities = 122/461 (26%), Positives = 221/461 (47%), Gaps = 10/461 (2%)
 Frame = -2

Query: 1617 ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLV 1438
            E+   +  +E   +G  PG      +  ++G++TVN+++   LF+WFF A+  P + P+V
Sbjct: 50   EAGKIQKGRELSLVGPFPGLN----MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVV 105

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            LWL GGPG SS+ +G   E GP  V  N + L    + W    ++L++++PVG GFS+T+
Sbjct: 106  LWLQGGPGGSSM-FGLFVEHGPYVVTSN-MTLRDRDFPWTTTLSMLYIDNPVGTGFSFTD 163

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     D  VA+D Y+ L+ + + FP++K +DF++ GESYAG YVP +A ++   N 
Sbjct: 164  DTHGYAVNEDD-VARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNP 222

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSD 898
             R +  +INL G  +G+  ++      G  E+ +   ++ ++Q           ++ +  
Sbjct: 223  VREV--KINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQ-----------KKYFQK 269

Query: 897  KCNEAMSIVFTKYEEIDIYNIYGPRCLLNG--SSSATGIRGVLDLALTNKERTYAYRRMK 724
            +C+E +  +  K   ++ + I     LL+G  +S  +  + V     T     Y + R  
Sbjct: 270  QCHECIEHI-RKQNWLEAFEILDK--LLDGDLTSDPSYFQNV-----TGCSNYYNFLRCT 321

Query: 723  RIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLP 544
                  +P    Y  ++ +  +V++A H        T N  T  +   R  + T  S+ P
Sbjct: 322  ------EPEDQLYYVKFLSLPEVRQAIHVG----NQTFNDGTIVEKYLR--EDTVQSVKP 369

Query: 543  VYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI--------EALKLPLKSPWRSWFHNHQV 388
               + I    K+ IY+G  D  V    + + +        +  K   K  W+ +  + +V
Sbjct: 370  WLTE-IMNNYKVLIYNGQLDIIVAAALTEHSLMGMDWKGSQEYKKAEKKVWKIFKSDSEV 428

Query: 387  GGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             G I +      V +RG GH++P ++P  A  +I+ F+ G+
Sbjct: 429  AGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGK 469



>gb:AP002047_1821630 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MQC3.
          Length = 440

 Score =  157 bits (396), Expect = 8e-37
 Identities = 119/408 (29%), Positives = 188/408 (46%), Gaps = 13/408 (3%)
 Frame = -2

Query: 1524 YITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVG 1345
            YI V +     +FY+F +++S+P   PL+LWL+GGPGCSS   G   E GPL  K     
Sbjct: 15   YIGVGEEDEDQMFYYFIKSESNPKTDPLLLWLSGGPGCSSF-TGLIYENGPLGFKVEAYN 73

Query: 1344 -----LHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE 1180
                 L    YSW K AN+++++ PVG GFSY+              A+    FL  WL 
Sbjct: 74   GSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNPLADIPSDTG-SAKRVDEFLRKWLT 132

Query: 1179 RFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDY 1000
            + P++  + F+  G SY+G  VP + + + + N   G  P+I L+G+++G+P T+   D 
Sbjct: 133  KHPEYFSNPFYAGGNSYSGKMVPVIVQEISNGNCIYG-KPQIRLQGYVLGSPVTDYDLDR 191

Query: 999  KGLLEYAWSHAIISDQQYDKAKEVCD---FTQENWSDKCNEAM----SIVFTKYEEIDIY 841
               +++A   A+IS++ Y+  K  C       +  + +C E +    + V   YE +   
Sbjct: 192  NSRIQFAHGMALISNELYESMKRTCGGNYIFVDPLNTECLELIKDYDNCVSGIYENL--- 248

Query: 840  NIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRI 661
             I  P+C L        I  ++D AL  K         K +   Y    S Y   + N  
Sbjct: 249  -ILVPKCDLTSPDCHVSI--LVDFALATKLNHKRRIFTKLLSQSYRSMLSDY---WANNE 302

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADG 481
             V++A        G+T  W+ C   +         S +P ++K    G +  I+SGD D 
Sbjct: 303  SVRRALKV---VEGTTGRWERCKWTL--QNNKDIKSSIPYHKKNSIQGYRSLIFSGDHDM 357

Query: 480  RVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVR 340
              P +G++  I +L   +   WR W    QV G    Y + +TF TV+
Sbjct: 358  LTPYVGTQDWIRSLNYSIIDKWRPWMILDQVAGYTTTYANKMTFATVK 405



>gb:BC016838_1975749 Homo sapiens carboxypeptidase, vitellogenic-like,
            transcript variant 2, mRNA (cDNA clone MGC:10029
            IMAGE:3888647), complete cds.
          Length = 476

 Score =  156 bits (394), Expect = 1e-36
 Identities = 124/466 (26%), Positives = 218/466 (46%), Gaps = 15/466 (3%)
 Frame = -2

Query: 1617 ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLV 1438
            E+   +  +E   +G  PG      +  ++G++TVN+++   LF+WFF A+  P + P+V
Sbjct: 50   EAGKIQKGRELSLVGPFPGLN----MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVV 105

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            LWL GGPG SS+ +G   E GP  V  N + L    + W    ++L++++PVG GFS+T+
Sbjct: 106  LWLQGGPGGSSM-FGLFVEHGPYVVTSN-MTLRDRDFPWTTTLSMLYIDNPVGTGFSFTD 163

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     D  VA+D Y+ L+ + + FP++K +DF++ GESYAG YVP +A ++   N 
Sbjct: 164  DTHGYAVNEDD-VARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNP 222

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-----DFTQ 913
             R +  +INL G  +G+  ++      G  E+ +   ++ ++Q    ++ C        +
Sbjct: 223  VREV--KINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK 280

Query: 912  ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNG--SSSATGIRGVLDLALTNKERTYA 739
            +NW           F  +E +D         LL+G  +S  +  + V     T     Y 
Sbjct: 281  QNW-----------FEAFEILD--------KLLDGDLTSDPSYFQNV-----TGCSNYYN 316

Query: 738  YRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTT 559
            + R        +P    Y  ++ +  +V++A H        T N  T  +   R  + T 
Sbjct: 317  FLRCT------EPEDQLYYVKFLSLPEVRQAIHVG----NQTFNDGTIVEKYLR--EDTV 364

Query: 558  FSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI--------EALKLPLKSPWRSWF 403
             S+ P   + I    K+ IY+G  D  V    +   +        +  K   K  W+ + 
Sbjct: 365  QSVKPWLTE-IMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIFK 423

Query: 402  HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             + +V G I +      V +RG GH++P ++P  A  +I+ F+ G+
Sbjct: 424  SDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGK 469



>gb:AY358549_1947428 Homo sapiens clone DNA33206 CPVL (UNQ197) mRNA,
            complete cds.
          Length = 476

 Score =  155 bits (393), Expect = 2e-36
 Identities = 124/466 (26%), Positives = 218/466 (46%), Gaps = 15/466 (3%)
 Frame = -2

Query: 1617 ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLV 1438
            E+   +  +E   +G  PG      +  ++G++TVN+++   LF+WFF A+  P + P+V
Sbjct: 50   EAGKIQKGRELSLVGPFPGLN----MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVV 105

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            LWL GGPG SS+ +G   E GP  V  N + L    + W    ++L++++PVG GFS+T+
Sbjct: 106  LWLQGGPGGSSM-FGLFVEHGPYVVTSN-MTLRDRDFPWTTTLSMLYIDNPVGTGFSFTD 163

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     D  VA+D Y+ L+ + + FP++K +DF++ GESYAG YVP +A ++   N 
Sbjct: 164  DTHGYAVNEDD-VARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNP 222

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-----DFTQ 913
             R +  +INL G  +G+  ++      G  E+ +   ++ ++Q    ++ C        +
Sbjct: 223  VREV--KINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK 280

Query: 912  ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNG--SSSATGIRGVLDLALTNKERTYA 739
            +NW           F  +E +D         LL+G  +S  +  + V     T     Y 
Sbjct: 281  QNW-----------FEAFEILD--------KLLDGDLTSDPSYFQNV-----TGCSNYYN 316

Query: 738  YRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTT 559
            + R        +P    Y  ++ +  +V++A H        T N  T  +   R  + T 
Sbjct: 317  FLRCT------EPEDQLYYVKFLSLPEVRQAIHVG----NQTFNDGTIVEKYLR--EDTV 364

Query: 558  FSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI--------EALKLPLKSPWRSWF 403
             S+ P   + I    K+ IY+G  D  V    +   +        +  K   K  W+ + 
Sbjct: 365  QSVKPWLTE-IMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIFK 423

Query: 402  HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             + +V G I +      V +RG GH++P ++P  A  +I+ F+ G+
Sbjct: 424  SDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGK 469



>gb:AF282617_1894630 Homo sapiens vitellogenic carboxypeptidase-like
            protein (HVLP) mRNA, complete cds.
          Length = 476

 Score =  155 bits (392), Expect = 2e-36
 Identities = 122/461 (26%), Positives = 220/461 (47%), Gaps = 10/461 (2%)
 Frame = -2

Query: 1617 ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLV 1438
            E+   +  +E   +G  PG      +  ++G++TVN+++   LF+WFF A+  P + P+V
Sbjct: 50   EAGKIQKGRELSLVGPFPGLN----MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVV 105

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            LWL GGPG SS+ +G   E GP  V  N + L    + W    ++L++++PVG GFS+T+
Sbjct: 106  LWLQGGPGGSSM-FGLFVEHGPYVVTSN-MTLRDRDFPWTTTLSMLYIDNPVGTGFSFTD 163

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     D  VA+D Y+ L+ + + FP++K +DF++ GESYAG YVP +A ++   N 
Sbjct: 164  DTHGYAVNEDD-VARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNP 222

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSD 898
             R +  +INL G  +G+  ++      G  E+ +   ++ ++Q           ++ +  
Sbjct: 223  VREV--KINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQ-----------KKYFQK 269

Query: 897  KCNEAMSIVFTKYEEIDIYNIYGPRCLLNG--SSSATGIRGVLDLALTNKERTYAYRRMK 724
            +C+E +  +  K   ++ + I     LL+G  +S  +  + V     T     Y + R  
Sbjct: 270  QCHECIEHI-RKQNWLEAFEILDK--LLDGDLTSDPSYFQNV-----TGCSNYYNFLRCT 321

Query: 723  RIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLP 544
                  +P    Y  ++ +  +V++A H        T N  T  +   R  + T  S+ P
Sbjct: 322  ------EPEDQLYYVKFLSLPEVRQAIHVG----NQTFNDGTIVEKYLR--EDTVQSVKP 369

Query: 543  VYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI--------EALKLPLKSPWRSWFHNHQV 388
               + I    K+ IY+G  D  V    + + +        +  K   K  W+    + +V
Sbjct: 370  WLTE-IMNNYKVLIYNGQLDIIVAAALTEHSLMGMDWKGSQEYKKAEKKVWKILKSDSEV 428

Query: 387  GGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             G I +      V +RG GH++P ++P  A  +I+ F+ G+
Sbjct: 429  AGYIRQAGDSHQVIIRGGGHILPYDQPLRAFDMINRFIYGK 469



>gb:AX136207_1461983 Sequence 129 from Patent
            EP1067182.>gb:AK075433_1913104 Homo sapiens cDNA PSEC0124
            fis, clone PLACE1003378, weakly similar to VITELLOGENIC
            CARBOXYPEPTIDASE PRECURSOR (EC 3.4.16.-).
          Length = 476

 Score =  155 bits (392), Expect = 2e-36
 Identities = 123/466 (26%), Positives = 219/466 (46%), Gaps = 15/466 (3%)
 Frame = -2

Query: 1617 ESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLV 1438
            E+   +  +E   +G  PG      +  ++G++TVN+++   LF+WFF A+  P + P+V
Sbjct: 50   EAGKIQKGRELSLVGPFPGLN----MKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVV 105

Query: 1437 LWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            LWL GGPG SS+ +G   E GP  V  N + L    + W    ++L++++PVG GFS+T+
Sbjct: 106  LWLQGGPGGSSM-FGLFVEHGPYVVTSN-MTLRDRDFPWTTTLSMLYIDNPVGTGFSFTD 163

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                     D  VA+D Y+ L+ + + FP++K +DF++ GESYAG YVP +A ++   N 
Sbjct: 164  DTHGYAVNEDD-VARDLYSALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNP 222

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC-----DFTQ 913
             R +  +INL G  +G+  ++      G  E+ +   ++ ++Q    ++ C        +
Sbjct: 223  VREV--KINLNGIAIGDGYSDPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRK 280

Query: 912  ENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNG--SSSATGIRGVLDLALTNKERTYA 739
            +NW              +E ++I +      LL+G  +S  +  + V     T     Y 
Sbjct: 281  QNW--------------FEALEILD-----KLLDGDLTSDPSYFQNV-----TGCSNYYN 316

Query: 738  YRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTT 559
            + R        +P    Y  ++ +  +V++A H        T N  T  +   R  + T 
Sbjct: 317  FLRCT------EPEDQLYYVKFLSLPEVRQAIHVG----NQTFNDGTIVEKYLR--EDTV 364

Query: 558  FSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI--------EALKLPLKSPWRSWF 403
             S+ P   + I    K+ IY+G  D  V    +   +        +  K   K  W+ + 
Sbjct: 365  QSVKPWLTE-IMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWKIFK 423

Query: 402  HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             + +V G I +      V +RG GH++P ++P  A  +I+ F+ G+
Sbjct: 424  SDSEVAGYIRQVGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGK 469



>gb:CR382128_1660399 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 554

 Score =  155 bits (391), Expect = 3e-36
 Identities = 125/453 (27%), Positives = 210/453 (46%), Gaps = 30/453 (6%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+ + +   +  FYWFFE+++ P N P++LWLNGGPGCSS+  G   ELGP  +  +
Sbjct: 144  YSGYVDIEEED-KHFFYWFFESRNDPKNDPVLLWLNGGPGCSSM-TGQFFELGPSSINED 201

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
             + L +N  SWN+ A+++F++ PV VGFSY++          +  A+D + FL  + ++F
Sbjct: 202  -LTLTWNPSSWNQNASVIFLDQPVNVGFSYSS----NRVKNSRAAAEDVHKFLSLFFDKF 256

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETN-----DY 1009
            P++   DF IAGESYAGHY+P +A  +   + D+      NL   ++GN  T+     +Y
Sbjct: 257  PKYAKQDFHIAGESYAGHYIPAIATEI-QSHSDK----NYNLTSILIGNGITDERTQVEY 311

Query: 1008 YDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIY--NI 835
            Y      E  +  A+I+ ++ DK         E    KC   + + ++    I     N 
Sbjct: 312  YRPMACGEGGYP-AVITPEECDK--------MERDVPKCQRLVDLCYSTNNRIACVAPNF 362

Query: 834  YGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY--SPYAEEYFNRI 661
            Y    +  G+   TG R V D+              +   G  D CY    +   Y N+ 
Sbjct: 363  Y-CNAVTMGAYQQTG-RNVYDI--------------REQCGDSDLCYEQEDWITAYLNQP 406

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVY---EKLIKGGLKIWIYSGD 490
             V +A  A +        ++ C + V   + +      P +     L+  GL + IY+GD
Sbjct: 407  HVLEAIGAEVEV------FEGCKNDVGIDFVFDGDHNRPFHYDVADLLDDGLPVLIYAGD 460

Query: 489  ADGRVPVIGSRYCIEAL------------------KLPLKSPWRSWFHNHQVGGRIVEYH 364
             D     +G++   + L                  ++P K       H     G +    
Sbjct: 461  KDFICNWLGNQAWTDTLDWTDAESFFLAETRNWTAQVPTKHGKTKAVH----AGTVKNAG 516

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             LT++ V  AGH+VP N+P  +L +++ +++G+
Sbjct: 517  KLTYLRVFDAGHMVPFNQPETSLDMVNRWIAGD 549



>gb:CR382130_1662680 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 461

 Score =  153 bits (386), Expect = 1e-35
 Identities = 135/489 (27%), Positives = 221/489 (45%), Gaps = 23/489 (4%)
 Frame = -2

Query: 1662 TFLLVGFLVIWVLCAESSSPKAAQESDKIGYL-------PGQPSAPLLTHFSGYITVNQS 1504
            +F LV  LV  V   ES+    +  +   G+        P       +  ++GY+  +  
Sbjct: 5    SFALVALLVSTV-ATESNYTTFSNSTSAPGFSIRSKAQDPSALGVDTVKQYTGYLDADDG 63

Query: 1503 HGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYS 1324
              +  FYWFFE++  P N P+VLWL+GGPGCSS+G G   E GP  +  N + +  N +S
Sbjct: 64   -SKHFFYWFFESRGDPQNDPVVLWLSGGPGCSSLG-GLFYENGPSSIDEN-LKVVRNPHS 120

Query: 1323 WNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQF-KGHDFF 1147
            WN  AN+++++ PVG GFSY++          K  A+D Y+FL  + + FP++ KG  F 
Sbjct: 121  WNNNANVIYLDQPVGTGFSYSD---KGPVDTSKKAAEDLYSFLTLFFQNFPEYNKGQKFH 177

Query: 1146 IAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSH 970
            IA ESY GHY P  A E++   ++         L   +VGN   +  +   G    A   
Sbjct: 178  IASESYGGHYAPISALEILSHADKP------FRLDSILVGNGIWDPLHQAAGFQPMACGK 231

Query: 969  AIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI--DIYNIYGPRCLLNGSSSA 796
              +          V + T+    D          T Y E+  +I   Y  +  ++  + A
Sbjct: 232  GGV--------PPVLNSTECQQMD----------TNYHEMIDEIQTCYDSKS-VSDCTDA 272

Query: 795  TGIRGVLDLALTNKERTYAYRRMKRI-PGGYDPCYSP--YAEEYFNRIDVQKAFHANIRA 625
             G    L L    ++    Y   K+  P     CY    Y E +  +  V++A   + + 
Sbjct: 273  QGDFNYLFLNPVGQKFINIYDLTKKCDPEAKGLCYKAMNYPETWLQQDHVKQALGVDTK- 331

Query: 624  PGSTVNWKTCSDPVFRAYKYTTFSLLPV---YEKLIKG-GLKIWIYSGDADGRVPVIGSR 457
                + ++TC+  V + ++     + P    Y KL+    L + +Y+GD D     +G+ 
Sbjct: 332  ----IQFQTCNGFVNQLFQRKGDEIYPYVDDYHKLLDDYKLPVLVYAGDHDYICNWLGNY 387

Query: 456  YCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALA 292
            Y   AL+        K+P+  W    +  G I  Y   TF+ V  AGH+VP ++P  +L 
Sbjct: 388  YWTNALQWSGKESFNKAPYTYWRVGGKPVGEIKNYDKFTFLRVYDAGHMVPHDQPEVSLQ 447

Query: 291  LIHSFLSGE 265
            L++ ++SG+
Sbjct: 448  LLNRWISGK 456



>gb:AF085063_1767107 Pichia angusta carboxypeptidase Y precursor (CPY)
            gene, complete cds.
          Length = 541

 Score =  152 bits (383), Expect = 3e-35
 Identities = 122/453 (26%), Positives = 206/453 (45%), Gaps = 19/453 (4%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            PG         +SGY+ V +   +  FYW FE+++ P+N P++LWLNGGPGCSS+  G  
Sbjct: 126  PGALGLDHTRQYSGYLDV-EDEDKHFFYWMFESRNDPANDPVILWLNGGPGCSSL-TGML 183

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             ELG   +  +   ++ N YSWN  A ++F++ PV VGFSY++          K    D 
Sbjct: 184  FELGSASIGPDLKPIN-NPYSWNSNATVIFLDQPVNVGFSYSSKSVSNTVAAGK----DV 238

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN 1027
            Y FL  + ++FP    +DF IAGESY GHY+P  A  +   + DR      NL   ++GN
Sbjct: 239  YAFLELFYQQFPHLLKNDFHIAGESYGGHYIPVFASEIL-THADRS----FNLTSVLIGN 293

Query: 1026 PETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEID 847
              T+    Y      A S    +D  Y+   +  +   E   +     +S++ + Y    
Sbjct: 294  GLTDPLNQYPFYERMACS----TDGGYEPTLDESEC--EGMLETLPRCLSLIESCYSSQS 347

Query: 846  IYNIYGPRCLLN----GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAE 679
            +++        N    G    TG R V D+     E T  Y+ M+            Y +
Sbjct: 348  VFSCVPASIYCNNAQLGPFQKTG-RNVYDVR-KMCEGTLCYKDME------------YID 393

Query: 678  EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKI 508
            +Y N+  V++   A +        +++C+  V R + +    + P ++    L++ GL +
Sbjct: 394  QYLNQDFVKEKIGAEVE------TYESCNFDVNRNFLFAGDWMKPYHKNVINLLEQGLPV 447

Query: 507  WIYSGDADGRVPVIGSRYCIEALKLPLKSPW--RSWFHNHQV----------GGRIVEYH 364
             IY+GD D     +G++     L      PW     F + ++           G +    
Sbjct: 448  LIYAGDKDFICNWLGNQAWSNEL------PWSGHEEFESAELYNLTLKDGTKVGEVKNAG 501

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
              TF  +   GH+VP ++P  +LA+++ +++G+
Sbjct: 502  KFTFARMFDGGHMVPYDQPESSLAMVNRWIAGD 534



>gb:CR382132_1665434 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 457

 Score =  150 bits (380), Expect = 6e-35
 Identities = 125/447 (27%), Positives = 204/447 (45%), Gaps = 12/447 (2%)
 Frame = -2

Query: 1569 LPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGA 1390
            +PG      +  ++GY+T N++ G   FYW  E+++ PS  P++LWL GGPGCSS+  G 
Sbjct: 37   VPGDLGLDDVQQYTGYLTANET-GEHFFYWTVESRNDPSKDPVILWLQGGPGCSSM-TGL 94

Query: 1389 AAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQD 1210
              E GP  +    +    N +SWN  A +++++ PV  GFS+               A++
Sbjct: 95   LYENGPSFIDNATLTPIHNPHSWNNNATVVYLDQPVDSGFSWGQTNNTDTSAKG---AKE 151

Query: 1209 TYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQL-AEVVFDRNRDRGIYPRINLKGFIV 1033
             Y FL  + +RFPQ+      +AGESYAGHY+P + AE++  R+ +R      +LK  ++
Sbjct: 152  VYAFLELFFQRFPQYP-KTLHVAGESYAGHYIPSVGAEIL--RHPERS----FDLKSVVI 204

Query: 1032 GNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEE 853
            GN   +    YK   EY                EVCD   +  +  CN+ +   +     
Sbjct: 205  GNGLVDVLQQYK---EYQPMFCGGGGVPAVVGPEVCDHLDDTLA-ACNKLVETCYN---- 256

Query: 852  IDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKE-RTYAYRRMKRIPGGYD-PCYSPYAE 679
                N+    C+  G    +     L L   N+      Y   K+     D  CY+  ++
Sbjct: 257  ----NVTSANCVPVGGELCSN----LTLPFYNETLNINPYDITKKCEPALDNGCYNE-SD 307

Query: 678  EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEK---LIKGGLKI 508
                 +++ +     + A G+   W  CSD V   +  T     P       +++ GL +
Sbjct: 308  GMTRWLELPRV----LTAIGAEHAWNGCSDNVSDLFYSTGDPFRPAQRDVTFMLQHGLPV 363

Query: 507  WIYSGDADGRVPVIGSRYCIEAL------KLPLKSPWRSWFHNHQVGGRIVEYHGLTFVT 346
             IY+G  D     +G R   +AL      K  LK   R W  + +V G +  + G TF+ 
Sbjct: 364  LIYAGAHDIICNWLGQRAWTDALPWHGHFKFRLKK-LRPWHVDGKVAGAVKSHAGFTFLR 422

Query: 345  VRGAGHLVPLNKPSEALALIHSFLSGE 265
            +  AGH+VP ++P  AL +I+ ++SG+
Sbjct: 423  IEDAGHMVPHDQPKPALEMINRWISGD 449



>gb:AE016959_1020563 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC079632_1732623 Oryza sativa
            chromosome 10 clone OSJNBa0046L02, complete
            sequence.>gb:AC108883_1738640 Genomic sequence for
            (japonica cultivar-group) cultivar Nipponbare clone
            OJ1136E01, from chromosome 10, complete
            sequence.>gb:AE017047_1750382 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 1 of 77 of the
            complete sequence.
          Length = 394

 Score =  150 bits (379), Expect = 8e-35
 Identities = 109/383 (28%), Positives = 176/383 (45%), Gaps = 9/383 (2%)
 Frame = -2

Query: 1392 AAAELGPLRVKRNGVG-----LHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXD 1228
            + AE GPL+    G       L + + SW K +N++F+++PVG GFSY            
Sbjct: 29   SVAETGPLKFDVAGYTEGFPQLFYFQDSWTKVSNVIFLDAPVGTGFSYAREEQGYNVTLT 88

Query: 1227 KFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINL 1048
            +   Q    FL  WL   P+F  +  +I G+SY+G+ VP  A  + + +  R    R+NL
Sbjct: 89   Q-TGQQLVVFLTKWLGDHPEFASNPLYIGGDSYSGYTVPVTALQIANDDDARA---RLNL 144

Query: 1047 KGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC--DFTQENWSDKCNEAMSI 874
            KG++VGN  T+  YD  G + +     +ISD+ Y+ A+  C  D+     +  C  A+  
Sbjct: 145  KGYLVGNAATDVKYDSGGKVPFMHGMGLISDEMYEAARSSCRGDYVSTPTNADCANALQA 204

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY 694
            +      I+  +I  P C          +RG      T  +R      ++    GY   Y
Sbjct: 205  ISMATFAINPVHILEPIC-------GFALRGRAMPETTMDQRLRLGLPVECRDNGYRLSY 257

Query: 693  SPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSD-PVFRAYKYTTFSLLPVYEKLIKGG 517
              +A++    +      H      GS  +W  C+  P+FR   +   S +P + +L + G
Sbjct: 258  L-WADD--PEVRATLGIH-----EGSIASWSRCTALPLFR---HDVDSAIPYHAELTQRG 306

Query: 516  LKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVR 340
             +  +Y+GD D  +  +G++  I  L   + + WR W+ N QV G    Y H LTF TV+
Sbjct: 307  YRALVYNGDHDLDMTFVGTQQWIRTLGYNVVTAWRPWYSNRQVAGFTTVYDHNLTFATVK 366

Query: 339  GAGHLVPLNKPSEALALIHSFLS 271
            G GH  P  +P E L ++  + S
Sbjct: 367  GGGHTAPEYRPKECLDMLDRWTS 389



>gb:CR382128_1660547 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 614

 Score =  150 bits (378), Expect = 1e-34
 Identities = 120/453 (26%), Positives = 202/453 (44%), Gaps = 18/453 (3%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKP-LVLWLNGGPGCSSI 1402
            + ++PG  S    T  SG I  + +H   LF+W  EA+   + +P  ++W NGGPGCSS+
Sbjct: 31   VRHIPGLDSVDNYTMHSGNILTDAAHNGNLFFWLVEAQYKITERPKTIVWFNGGPGCSSM 90

Query: 1401 GYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKF 1222
              GA  E+GP R+  + + +  NK SW+K AN+LFV+ P G G+SY++            
Sbjct: 91   D-GALLEVGPFRIVDDKLRVDPNKGSWHKYANVLFVDQPYGTGYSYSDTDSYLTGLGQ-- 147

Query: 1221 VAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKG 1042
            V  +  +F+  +L+ FP+    DF++AGESYAG Y+P +A  +            ++LKG
Sbjct: 148  VGDEMDSFMTQFLKLFPERAHDDFYLAGESYAGQYIPYIATKLQQTRT-------VDLKG 200

Query: 1041 FIVGN---PETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIV 871
             ++GN      N YY Y   + YA  + +I   + +  K++ + T     D C  A++I 
Sbjct: 201  LLIGNGWMDPANQYYQY---VPYALDYGVIEKTE-EHVKDLKELT-----DTCERAINIA 251

Query: 870  FTKYEEIDIYNIYGPRCLLNG-------SSSATGIRGV-LDLALTNKERTYAYRRMKRIP 715
              K       +I     ++NG         SA    G+ ++    +KE  +    M    
Sbjct: 252  KDKNNGRLPVHIRACEDIMNGIVELSRNERSAPESEGICVNYYDVSKEDKWPSCGMNW-- 309

Query: 714  GGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE 535
                P   PY  ++  +    +A + N     S   W+ C+  V    +           
Sbjct: 310  ----PEILPYVTDWLRQDATVQALNVNNDKQES---WQECNGAVGSRMRQGNDDAAVYLL 362

Query: 534  KLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRS------WFHNHQVGGRIV 373
              +   ++I  ++GD D      G+   IE L+   K  W        W  +    G+  
Sbjct: 363  PDLLESMEILFFNGDRDLICNHYGNERMIEQLEWNGKKGWTEGLELDDWVVDGVSKGKKQ 422

Query: 372  EYHGLTFVTVRGAGHLVPLNKPSEALALIHSFL 274
                LT+V +  A H+VP ++P   L +++ F+
Sbjct: 423  SDRNLTYVRIYNASHMVPYDEPEACLTMLNDFI 455



>gb:PAU67174_1698928 Pichia angusta carboxypeptidase Y (CPY) gene,
            complete cds.
          Length = 537

 Score =  149 bits (377), Expect = 1e-34
 Identities = 122/453 (26%), Positives = 205/453 (45%), Gaps = 19/453 (4%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            PG         +SGY+ V +   +  FYW FE+++ P N P++LWLNGGPGCSS+  G  
Sbjct: 122  PGALGLDHTRQYSGYLDV-EDEDKHFFYWMFESRNDPVNDPVILWLNGGPGCSSL-TGML 179

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             ELG   +  +   ++ N YSWN  A ++F++ PV VGFSY++          K    D 
Sbjct: 180  FELGSASIGPDLKPIN-NPYSWNSNATVIFLDQPVNVGFSYSSKSVSNTVAAGK----DV 234

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN 1027
            Y FL  + ++FP    +DF IAGESY GHY+P  A  +   + DR      NL   ++GN
Sbjct: 235  YAFLELFYQQFPHLLKNDFHIAGESYGGHYIPVFASEIL-THADRS----FNLTSVLIGN 289

Query: 1026 PETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEID 847
              T+    Y      A S    +D  Y+   +  +   E   +     +S++ + Y    
Sbjct: 290  GLTDPLNQYPFYERMACS----TDGGYEPTLDESEC--EGMLETLPRCLSLIESCYSSQS 343

Query: 846  IYNIYGPRCLLN----GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAE 679
            +++        N    G    TG R V D+     E T  Y+ M+            Y +
Sbjct: 344  VFSCVPASIYCNNAQLGPFQKTG-RNVYDVR-KMCEGTLCYKDME------------YID 389

Query: 678  EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKI 508
            +Y N+  V++   A +        +++C+  V R + +    + P ++    L++ GL +
Sbjct: 390  QYLNQDFVKEKVGAEVD------TYESCNFDVNRNFLFAGDWMKPYHKNVINLLEQGLPV 443

Query: 507  WIYSGDADGRVPVIGSRYCIEALKLPLKSPW--RSWFHNHQV----------GGRIVEYH 364
             IY+GD D     +G++     L      PW     F + ++           G +    
Sbjct: 444  LIYAGDKDFICNWLGNQAWSNEL------PWSGHDEFESAELYNLTLKDGTKVGEVKNAG 497

Query: 363  GLTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
              TF  +   GH+VP ++P  +LA+++ +++G+
Sbjct: 498  KFTFARMFDGGHMVPYDQPESSLAMVNRWIAGD 530



>gb:AC069472_1540874 Arabidopsis thaliana chromosome 3 BAC F28J15
            genomic sequence, complete sequence.
          Length = 449

 Score =  149 bits (375), Expect = 2e-34
 Identities = 122/432 (28%), Positives = 190/432 (43%), Gaps = 13/432 (3%)
 Frame = -2

Query: 1596 AQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGP 1417
            A  S  I YLPG          +GYI V Q     LFY+F +++++P   PL++WL GGP
Sbjct: 22   ADSSSIIRYLPGFEGPLPFELETGYIGVGQKEEDQLFYYFIKSENNPEEDPLLVWLTGGP 81

Query: 1416 GCSSIGYGAAAELGPLRVK---RNG--VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXX 1252
            GCSS   G   E GPL  K    NG    L    YSW K AN+++++ PVG GFSY+   
Sbjct: 82   GCSSFS-GLVYENGPLAFKVETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRNP 140

Query: 1251 XXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDR 1072
                      V +    F+  WL + P++  + F++ G SY+G  +P + + + + N   
Sbjct: 141  FADIPSDTGSVKR-VNEFVRKWLAKHPEYFSNPFYVTGNSYSGKVIPAIVQEISNGNY-I 198

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSH--AIISDQQYDKAKEVCDFTQENWSD 898
               P+INL+G+++GNP    YYD+       ++H  A+ISD+ ++  K  C         
Sbjct: 199  CCKPQINLQGYVIGNPVA--YYDHDKDFRIPFAHGVALISDELFESLKASCG-------- 248

Query: 897  KCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNK-ERT----YAYR 733
                        Y  +D  N    + + +     +GI    +L L +K E T    Y YR
Sbjct: 249  ----------GSYSVVDPLNTECLKLIEDYDKCVSGI--YEELILKSKCEHTSPDCYTYR 296

Query: 732  RMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS 553
             +              +E + +   V++A        GS   W+ C   V         S
Sbjct: 297  YL-------------LSEYWADNETVRRALKV---VKGSKGTWERCDYRVLS--NQDIKS 338

Query: 552  LLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIV 373
             +P +      G +  + SGD D  +P +G++  I +L   +   WR W    QV G   
Sbjct: 339  SIPFHINNSIRGYRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTK 398

Query: 372  EY-HGLTFVTVR 340
             Y + +T  TV+
Sbjct: 399  TYANKMTLATVK 410



>gb:AP002047_1821631 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MQC3.
          Length = 441

 Score =  147 bits (370), Expect = 9e-34
 Identities = 116/430 (26%), Positives = 183/430 (42%), Gaps = 9/430 (2%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNG 1423
            K A  S  I YLPG          +GYI V       +FY+F +++S+P   PL++WL+G
Sbjct: 19   KHADSSSIIKYLPGFEGPLPFELETGYIGVGDEDEDQMFYYFIKSESNPEEDPLLVWLSG 78

Query: 1422 GPGCSSIGYGAAAELGPLRVKRNGVG-----LHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            GPGCSS   G   E GPL  K          L    YSW K AN+++++ PVG GFSY+ 
Sbjct: 79   GPGCSSF-TGLVYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGAGFSYSR 137

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                         A+    F+  WL + P +  + F++ G SY+G  +P + + + + N 
Sbjct: 138  NPFADRPSDTG-SAKLVNEFVRKWLAKHPDYFSNPFYVTGNSYSGKVIPAIVQEISNGNY 196

Query: 1077 DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSD 898
                 P+INL+G+++GNP     +D    + +A   A+ISD+ ++  K  C  +      
Sbjct: 197  -ICCKPQINLQGYVIGNPVAYYDHDKDSRIPFAHGVALISDELFESLKRSCGGSYSIVDP 255

Query: 897  KCNEAMSIVFTKYEEID-IYN--IYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRM 727
               E + ++   ++ +  IY   I  P+C                   T     Y YR +
Sbjct: 256  LNTECLKLIKDYHKCVSGIYQELILKPKC------------------ETTSPDCYTYRYL 297

Query: 726  KRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLL 547
              I              + N   V++A        GS   W+ C   V         S +
Sbjct: 298  LSI-------------YWANNEIVRRALKV---VEGSKGKWERCDLSV--RSNQDIKSSI 339

Query: 546  PVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY 367
            P +      G +  + SGD D  +P +G++  I +L   +   WR W    QV G    Y
Sbjct: 340  PYHMNNSIKGYRSLVISGDHDMTIPFLGTQAWIRSLNYSITEKWRPWMILDQVAGYTKTY 399

Query: 366  -HGLTFVTVR 340
             + +T  TV+
Sbjct: 400  ANKMTLATVK 409



>pir|D96759|D96759 probable serine carboxypeptidase T9L24.47
            [imported] - Arabidopsis thaliana>gb:AE005173_894878
            Arabidopsis thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC012396_1537663 Arabidopsis thaliana
            chromosome 1 BAC T9L24 genomic sequence, complete
            sequence.
          Length = 415

 Score =  147 bits (370), Expect = 9e-34
 Identities = 120/447 (26%), Positives = 187/447 (41%), Gaps = 7/447 (1%)
 Frame = -2

Query: 1578 IGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIG 1399
            + +LPG          +GYI V +     LFY+F +++ +P   PL+LWL GGPGCS+I 
Sbjct: 33   VKFLPGFEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPGCSAIS 92

Query: 1398 YGAAAELGPLRVK---RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXX 1234
             G   + GPL +K    NG    L    YSW K ++++F++ PVG GFSY+         
Sbjct: 93   -GLLYQNGPLAMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSRTQLFNKPS 151

Query: 1233 XDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRI 1054
                 A+  + FL  WL +  +F  + F++ G+SY+G  VP   + +   N      P I
Sbjct: 152  DTG-EAKRIHEFLQKWLGKHQEFSSNPFYVGGDSYSGLVVPATVQEISKGNCQCCNRP-I 209

Query: 1053 NLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSI 874
            NL+G+++GNP T+  YD    + +A   A+ISD+ Y++                      
Sbjct: 210  NLQGYVLGNPLTDCVYDCNYRVPFAHKMALISDELYERT--------------------- 248

Query: 873  VFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERT-YAYRRMKRIPGGYDPC 697
               + E ++++  +   CL          R +L     N E    A +  K   G +  C
Sbjct: 249  --CRGEYVNVHP-HDTECLKFVEEFNKSYRFMLTTYWANDETVRKALQINKESIGEWTRC 305

Query: 696  YSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGG 517
            Y      Y + I     +H N    G                          Y  LI  G
Sbjct: 306  YR--GIPYNHDIKSSVPYHMNNSIDG--------------------------YRSLIYSG 337

Query: 516  LKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEY-HGLTFVTVR 340
                    D D +VP +G++  I +L   +   WR W    Q+ G    Y + +TF TV 
Sbjct: 338  --------DHDIQVPFLGTQAWIRSLNYSIIDDWRPWMIKDQIAGYTTSYVNKMTFATVT 389

Query: 339  GAGHLVPLNKPSEALALIHSFLSGEEL 259
            G GH      P E   +   +++G+ L
Sbjct: 390  GGGHTAEFT-PKETFMMFQRWINGQPL 415



>gb:BT003126_1636707 Arabidopsis thaliana At3g63470 mRNA, complete
           cds.
          Length = 234

 Score =  145 bits (367), Expect = 2e-33
 Identities = 86/251 (34%), Positives = 132/251 (52%), Gaps = 4/251 (1%)
 Frame = -2

Query: 996 GLLEYAWSHAIISDQQYDKAKEVCDFTQENWS---DKCNEAMSIVFTKYEEIDIYNIYGP 826
           G+ ++  SHA+IS+    + K  CD   E+ S   ++C      +      +DIYNIY P
Sbjct: 2   GMYDFFESHALISEDSLARLKSNCDLKTESASVMTEECAVVSDQIDMDTYYLDIYNIYAP 61

Query: 825 RCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKA 646
            CL N + +    RG      T +E              +DPC   Y + Y NR +VQ A
Sbjct: 62  LCL-NSTLTRRPKRGT-----TIRE--------------FDPCSDHYVQAYLNRPEVQAA 101

Query: 645 FHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVI 466
            HAN  A      W+ CS  V + +  +  +++P+ ++L+  G+++W++SGD DGR+PV 
Sbjct: 102 LHAN--ATKLPYEWQPCSS-VIKKWNDSPTTVIPLIKELMGQGVRVWVFSGDTDGRIPVT 158

Query: 465 GSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHG-LTFVTVRGAGHLVPLNKPSEALAL 289
            ++Y ++ + L  K+ W  W+   +VGG   EY G LTF TVRGAGH VP  +P  +L+L
Sbjct: 159 STKYSLKKMNLTAKTAWHPWYLGGEVGGYTEEYKGKLTFATVRGAGHQVPSFQPKRSLSL 218

Query: 288 IHSFLSGEELP 256
              FL+   LP
Sbjct: 219 FIHFLNDTPLP 229



>gb:HS337O18_1998142 Human DNA sequence from clone RP3-337O18 on
            chromosome 20q12-13.1 Contains the PLPT gene for
            phospholipid transfer protein, the PPGB gene for
            protective protein for beta-galactosidase
            (galactosialidosis), the PTE1 gene for peroxisomal
            acyl-CoA thioesterase, the C20orf161 gene, the C20orf162
            gene, the C20orf163, the C20orf164 gene, the C20orf165
            gene, the 5' end of an variant of the TNNC2 gene for fast
            troponin C2 and three CpG islands, complete sequence.
          Length = 345

 Score =  144 bits (364), Expect = 4e-33
 Identities = 96/296 (32%), Positives = 150/296 (50%), Gaps = 9/296 (3%)
 Frame = -2

Query: 1686 VEMAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQ 1507
            +  APP    LL   L++ +L + +S  +AA + D+I  LPG    P    +SGY+    
Sbjct: 2    IRAAPPPLFLLL---LLLLLLVSWASRGEAAPDQDEIQRLPGLAKQPSFRQYSGYL--KG 56

Query: 1506 SHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKY 1327
            S  + L YWF E++  P N P+VLWLNGGPGCSS+  G   E GP  +            
Sbjct: 57   SGSKHLHYWFVESQKDPENSPVVLWLNGGPGCSSLD-GLLTEHGPFLI------------ 103

Query: 1326 SWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFF 1147
                 AN+L++ESP GVGFSY++         +  VAQ  +  L ++   FP++K +  F
Sbjct: 104  -----ANVLYLESPAGVGFSYSDDKFYATNDTE--VAQSNFEALQDFFRLFPEYKNNKLF 156

Query: 1146 IAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHA 967
            + GESYAG Y+P LA +V          P +NL+G  VGN  ++   +   L+ +A+ H 
Sbjct: 157  LTGESYAGIYIPTLAVLVMQD-------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHG 209

Query: 966  IISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI---------DIYNIYGP 826
            ++ ++ +   +  C  +Q   +   N+ +  V T  +E+         +IYN+Y P
Sbjct: 210  LLGNRLWSSLQTHC-CSQNKCNFYDNKDLECV-TNLQEVARIVGNSGLNIYNLYAP 263



>gb:CR382123_1656244 Kluyveromyces lactis strain NRRL Y-1140
            chromosome C of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 452

 Score =  143 bits (361), Expect = 1e-32
 Identities = 121/453 (26%), Positives = 205/453 (45%), Gaps = 19/453 (4%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P       +  +SGY+       +  FYWFFE+++ P+N P++L+LNGGPGCSS+     
Sbjct: 33   PASLGIDTVNQWSGYLDYQDK--KHSFYWFFESRNDPANDPVILYLNGGPGCSSMD-NLF 89

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             E GP  +  +   +H N YSWN  A+++F++ PV VGFSY+              A+D 
Sbjct: 90   FETGPASIGPDLKPIH-NPYSWNNNASIIFLDQPVNVGFSYSEERVKTTND----AARDV 144

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN 1027
            YNFL  +  +FP    + F IAGESYAGHY+P++A  +   ++D     + NL   ++GN
Sbjct: 145  YNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDD---TKFNLSSIVIGN 201

Query: 1026 PET-----NDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEA-MSIVFT 865
              T     N Y  +K +      +  I +    +   V +   +  +  C++  +++   
Sbjct: 202  GLTDPLVQNQY--FKPMACGEGGYPAILNPSKCRTMSVSNLACKGLTSLCSKTKLTLACV 259

Query: 864  KYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPY 685
                    ++  P    + + +   IRG  +    + E    ++ +             Y
Sbjct: 260  SASTFCWKSLIQP--AFDSAVNPCDIRGPCE----DPESGLCWKTL------------GY 301

Query: 684  AEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGL 514
               Y N+  VQ A    +       ++  C+  V   +  T  +  P  +   +L+   +
Sbjct: 302  IRSYLNQEFVQDALGTKVS------SYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNI 355

Query: 513  KIWIYSGDADGRVPVIGSRYCIEAL---------KLPLKSPWRSWFHNHQVGGRIVEYHG 361
             + IY+GD D     +G+    +AL          LPL +PW S   + Q G   V+ HG
Sbjct: 356  PVLIYAGDTDYICNWLGNMAWTDALTWKDHISYETLPL-NPWYSLNGSVQFGE--VKNHG 412

Query: 360  -LTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
              TF+ V  AGH VP  +P   + +I+ ++SG+
Sbjct: 413  PFTFLRVFEAGHTVPYYQPLATMEMINRWISGD 445



>gb:CR382128_1661203 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 488

 Score =  142 bits (359), Expect = 2e-32
 Identities = 125/447 (27%), Positives = 191/447 (42%), Gaps = 15/447 (3%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P       ++  SGY+ V  S G  LFYW FE+++ PS  P+VLWL GGPG SS+ +   
Sbjct: 53   PASLGLDTVSQHSGYLEVKSS-GENLFYWAFESRNDPSKDPVVLWLQGGPGSSSM-FALT 110

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             E GP       +    N +SWN  A +++++ P G GFSY +          K  A+  
Sbjct: 111  FENGPSWFNNPEITPVHNPWSWNNNATMIYLDQPAGAGFSYVS-AGGTAARTSKEAAKSV 169

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRDRGIYPRINLKGFIVG 1030
            + FL  + E++         I+GESYAGHYVPQ   E++   N+        +++  + G
Sbjct: 170  FAFLTLFFEKYMHLP-RKIHISGESYAGHYVPQTTLEILRTTNK------TFHVESMLCG 222

Query: 1029 NPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEI 850
            N  T+    Y     Y              + E C  T+    D+C   +   +      
Sbjct: 223  NGMTDPLNQYTEFSVYGCDSQASGVSPALYSNETCQQTKAA-QDRCIPLIQKCYDTGTNA 281

Query: 849  DIYNIYGPRCLLNGSSSATGIRGVLDLAL-TNKERTYAYRRMKRIPGGYDPCY--SPYAE 679
            D              S AT +     L+L  NK+  Y  RR    P     CY  S Y E
Sbjct: 282  D-------------CSYATSLCNAEILSLFDNKKNIYDVRRPCE-PSKSGTCYKESDYGE 327

Query: 678  EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPV---FRAYK---YTTFSLLPVYEKLIKGG 517
             + N    + A        G+ V WK  +  V   F AY        S+  V E L    
Sbjct: 328  AFLNNQTTRDAI-------GAVVPWKANNRTVYNDFTAYSGDWMRPDSVRAVTEILNGYN 380

Query: 516  LKIWIYSGDADGRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTF 352
            + + I++GD D     +G +  ++AL        LK+  R W  NHQ  G + ++  L+F
Sbjct: 381  VPVLIFAGDKDFICNWLGQKKWLDALPWDGHAKYLKARERPWKVNHQSRGVLKQFGKLSF 440

Query: 351  VTVRGAGHLVPLNKPSEALALIHSFLS 271
            + +  AGH+VP ++P  A  ++  +L+
Sbjct: 441  LRIFEAGHMVPHDQPEAASYMLQEWLT 467



>gb:BC051154_2550407 Danio rerio carboxypeptidase, vitellogenic-like,
            mRNA (cDNA clone MGC:55759 IMAGE:3816632), complete cds.
          Length = 478

 Score =  142 bits (358), Expect = 2e-32
 Identities = 120/483 (24%), Positives = 205/483 (42%), Gaps = 14/483 (2%)
 Frame = -2

Query: 1677 APPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHG 1498
            A P +  +L  +L       E    + A++   +G LPG      +  +SGY+TVN+++ 
Sbjct: 41   ADPGKPLMLTPYL-------EQGKIEEAKKLSLVGPLPGAN----VKSYSGYLTVNKTYN 89

Query: 1497 RALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWN 1318
              LF+WFF A+  P   P++LWL GGPG +S+ +G   E GP  V +N + L +  + W 
Sbjct: 90   SNLFFWFFPAQERPETAPVLLWLQGGPGGTSM-FGLFVEHGPYFVYKN-LTLGYRHFPWT 147

Query: 1317 KEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAG 1138
               ++L++++PVG G+S+T          D  V +D Y+ L  + + F +F+ + F+  G
Sbjct: 148  SRYSVLYIDNPVGTGWSFTEDDRGFAQNQDD-VGRDLYSALTQFFQIFREFQSNPFYATG 206

Query: 1137 ESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIIS 958
            ESYAG YVP +   +   N    +  +IN KG  +G+   +      G  ++ +   ++ 
Sbjct: 207  ESYAGKYVPAIGYYIHRNNPSAKV--KINFKGVAIGDGLCDPELMLGGYADFLYQTGLVD 264

Query: 957  DQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGS--------S 802
            + Q    K   D            A   +  +   ++ + ++    LLNG          
Sbjct: 265  ELQRQHVKMQTD------------AGVKLIQEQRWVEAFQVFD--SLLNGDLVPYPSYFQ 310

Query: 801  SATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRI----DVQKAFHAN 634
            + TG     +                     Y  C  P  +EYF+      +V+++ H  
Sbjct: 311  NVTGCTNYFN---------------------YMQCQEPPDQEYFSSFVTLPEVRRSIHVG 349

Query: 633  IRA--PGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGS 460
                  GS V      D V ++ K     L+  Y  LI  G    I +     R     S
Sbjct: 350  NLTFNDGSDVEKHLLQD-VMKSIKPWLGVLMENYRVLIYSGQLDVIVAAPLTERFLPTVS 408

Query: 459  RYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHS 280
                +  K   + PW+    + +V G + +      V VRG GH++P ++P  +  +I  
Sbjct: 409  WSGADEYKTAERFPWKVQPSDTEVAGYVRQVREFFQVIVRGGGHILPYDQPERSFDMIDR 468

Query: 279  FLS 271
            FLS
Sbjct: 469  FLS 471



>gb:KLA551275_1683559 Kluyveromyces lactis pcl1 gene for putative
            carboxypeptidase-related protein.
          Length = 453

 Score =  142 bits (358), Expect = 2e-32
 Identities = 121/452 (26%), Positives = 202/452 (44%), Gaps = 18/452 (3%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P       +  +SGY+       +  FYWFFE+++ P+N P++L+LNGGPGCSS+     
Sbjct: 33   PASLGIDTVNQWSGYLDYQDK--KHSFYWFFESRNDPANDPVILYLNGGPGCSSMD-NLF 89

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             E GP  +  +   +H N YSWN  A+++F++ PV VGFSY+              A+D 
Sbjct: 90   FETGPASIGPDLKPIH-NPYSWNNNASIIFLDQPVNVGFSYSEERVKTTND----AARDV 144

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN 1027
            YNFL  +  +FP    + F IAGESYAGHY+P++A  +   ++D     + NL   ++GN
Sbjct: 145  YNFLDLFFTKFPNLTANAFHIAGESYAGHYIPRIAHEIVSVHKDD---TKFNLSSIVIGN 201

Query: 1026 PET-----NDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTK 862
              T     N Y  +K +      +  I +    +   V +   +  +  C++        
Sbjct: 202  GLTDPLVQNQY--FKPMACGEGGYPAILNPSKCRTMSVSNLACKGLTSLCSKTKLTPGRA 259

Query: 861  YEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYA 682
            Y  +        +   + + +   IRG  +    + E    ++ +             Y 
Sbjct: 260  YLLLHFCWKSLIQPAFDSAVNPCDIRGPCE----DPESGLCWKTL------------GYI 303

Query: 681  EEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLK 511
              Y N+  VQ A    +       ++  C+  V   +  T  +  P  +   +L+   + 
Sbjct: 304  RSYLNQEFVQDALGTKVS------SYNGCNTSVGSDFFLTGDNSRPFQQYVTELLDLNIP 357

Query: 510  IWIYSGDADGRVPVIGSRYCIEAL---------KLPLKSPWRSWFHNHQVGGRIVEYHG- 361
            + IY+GD D     +G+    +AL          LPL +PW S   + Q G   V+ HG 
Sbjct: 358  VLIYAGDTDYICNWLGNMAWTDALTWKDHISYETLPL-NPWYSLNGSVQFGE--VKNHGP 414

Query: 360  LTFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
             TF+ V  AGH VP  +P   + +I+ ++SG+
Sbjct: 415  FTFLRVFEAGHTVPYYQPLATMEMINRWISGD 446



>gb:CR382130_1662637 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 468

 Score =  142 bits (358), Expect = 2e-32
 Identities = 116/454 (25%), Positives = 194/454 (42%), Gaps = 21/454 (4%)
 Frame = -2

Query: 1566 PGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAA 1387
            P +     +   SGY    Q++ + LF+WFFE+++ P   P+VLW+NGGPGCSSI  G  
Sbjct: 50   PAELGVDSVKQHSGYFDFEQNN-KHLFFWFFESRNDPKTDPVVLWINGGPGCSSI-KGMF 107

Query: 1386 AELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDT 1207
             E+G  +V+   + L  N Y+WN  A++++++ PV  G+SY++          +  A+D 
Sbjct: 108  FEMGSAKVEPE-LKLVDNPYAWNSNASVIYLDQPVNTGYSYSS--DEHRVNSTRQAAKDV 164

Query: 1206 YNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN 1027
            + FL  + E +P++   DF +AGESYAGHY+P +A  +              L   ++GN
Sbjct: 165  HRFLNKFFEVYPEYAELDFHVAGESYAGHYIPAIATEIQSHKE-----KNYELASVLIGN 219

Query: 1026 PETN-----DYYDYKGLLEYAWSHAIISD---QQYDKAKEVCDFTQENWSDKCNEAMSIV 871
              T+      Y+      E  +   +  D   Q  D   +     +  W +  N+     
Sbjct: 220  GVTDTKTQVPYFQAMACGEGGYPSVLSEDTCQQMKDAVGDCQKLIEHCWENPKNKLQCYA 279

Query: 870  FTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS 691
               Y      ++     +  G  +A  IR V       ++   A                
Sbjct: 280  TMNY----CLSVSVEPYMREGGRNAYDIRDVCSKTGCYEDENIA---------------- 319

Query: 690  PYAEEYFNRIDVQKAFHA----NIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIK 523
               E Y N   VQ         ++   GS  N    +      ++Y    LL        
Sbjct: 320  --IESYLNDEHVQTVLGVKDIEHVGCRGSVGNEFGLNGDYELPFQYDVADLL-------D 370

Query: 522  GGLKIWIYSGDADGRVPVIGSRYCIEAL-----KLPLKSPWRSWFHNHQ----VGGRIVE 370
             GL + +YSGD D R   +G++   + L     K   ++P + W  N        G + +
Sbjct: 371  SGLPVLLYSGDKDFRCNWLGNKAWSDKLEWKGAKEYSEAPIKRWHANVDGKDIAAGEVKQ 430

Query: 369  YHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
               LTF+ V  AGH+VP ++P  +L +++ ++SG
Sbjct: 431  SGELTFLRVFDAGHMVPHDQPETSLDMLNRWISG 464



>gb:AY143880_1583337 Arabidopsis thaliana At2g22990/T20K9.20 mRNA,
            complete cds.>gb:AF361601_1791347 Arabidopsis thaliana
            T20K9.20/T20K9.20 mRNA, complete cds.
          Length = 259

 Score =  142 bits (358), Expect = 2e-32
 Identities = 82/254 (32%), Positives = 132/254 (51%), Gaps = 9/254 (3%)
 Frame = -2

Query: 1656 LLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWF 1477
            L + FL++ VL     S    +      +LPG          +GYI + +      FY+F
Sbjct: 3    LKIKFLLLLVLYHHVDSASIVK------FLPGFEGPLPFELETGYIGIGEDENVQFFYYF 56

Query: 1476 FEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK-----RNGVGLHFNKYSWNKE 1312
             +++++P   PL++WLNGGPGCS +G G   E GP+ +K      +   L    YSW K 
Sbjct: 57   IKSENNPKEDPLLIWLNGGPGCSCLG-GIIFENGPVGLKFEVFNGSAPSLFSTTYSWTKM 115

Query: 1311 ANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGES 1132
            AN++F++ PVG GFSY+           +   + T+ FL  WL R PQ+  +  ++ G+S
Sbjct: 116  ANIIFLDQPVGSGFSYSKTPIDKTGDISE--VKRTHEFLQKWLSRHPQYFSNPLYVVGDS 173

Query: 1131 YAGHYVPQLAEVVFDRNRDRGIY----PRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI 964
            Y+G  VP L + +      +G Y    P INL+G+++GNP T   ++    + YA+   +
Sbjct: 174  YSGMIVPALVQEI-----SQGNYICCEPPINLQGYMLGNPVTYMDFEQNFRIPYAYGMGL 228

Query: 963  ISDQQYDKAKEVCD 922
            ISD+ Y+  K +C+
Sbjct: 229  ISDEIYEPMKRICN 242



>gb:AP002047_1821628 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MQC3.
          Length = 405

 Score =  141 bits (356), Expect = 4e-32
 Identities = 99/358 (27%), Positives = 163/358 (45%), Gaps = 1/358 (0%)
 Frame = -2

Query: 1329 YSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDF 1150
            Y+W K A++L+++ PVG GFSY+             VA+    FL  WL++ P+F  +  
Sbjct: 85   YAWTKVASILYLDQPVGTGFSYSRNPLADIPSDTG-VAKPVNEFLHKWLDKHPEFLSNPL 143

Query: 1149 FIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSH 970
            ++AG SY+G  +P + + + + N      P+INL+GF++GNP T+   D    + +A   
Sbjct: 144  YVAGNSYSGIVIPTIVQEISNGNH-LDSKPQINLQGFVLGNPATDTDIDLNSRIPFAHGK 202

Query: 969  AIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATG 790
            A+ISD+ Y+  K  C   Q N+                     N    +CL         
Sbjct: 203  ALISDEHYESLKRSC---QGNYIS------------------VNPRNTKCLKLLEDFKKC 241

Query: 789  IRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTV 610
            + G+ +  +   +  + Y  M  +           +E + N   V+KA   N    G+  
Sbjct: 242  VSGISEEYILKPDCMWLYSCMANL--------HSLSEYWANEKSVRKALLVN---EGTVR 290

Query: 609  NWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLP 430
             W  C+  +  AY     S +P ++ +   G +  ++SGD D  VP +G++  I +L   
Sbjct: 291  KWIRCNTEI--AYNKDIRSSVPYHKYISIEGYRSLVFSGDHDMLVPFLGTQAWIRSLNYS 348

Query: 429  LKSPWRSWFHNHQVGGRIVEY-HGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            +   WR W   +QV G    Y + +TF TV+G GH     KP E   +I  +LSG+ L
Sbjct: 349  IVDDWRPWMVQNQVAGYTRTYANKMTFATVKGGGHTSEY-KPVETYIMIKRWLSGQPL 405



>gb:AC116957_1206715 Dictyostelium discoideum chromosome 2 map
            1685067-2090751 strain AX4, complete sequence.
          Length = 500

 Score =  138 bits (348), Expect = 3e-31
 Identities = 118/444 (26%), Positives = 202/444 (45%), Gaps = 17/444 (3%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            F+G+ITVN+++    F+WF E+++   N PLV++L GGPG +S  +    E GP  +  N
Sbjct: 103  FTGFITVNETYNSNTFFWFLESQNGDKNSPLVIFLQGGPGGAST-FSLFVETGPYELLDN 161

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               L   + +WN E  +L++++PVG GFS+T+         D+ +A + Y FL  + + +
Sbjct: 162  -FTLVQREITWNSEFAMLYIDNPVGTGFSFTDSQEGYSNNEDE-IATNLYTFLQQFYKLY 219

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGN------PETND 1012
            P++  ++ +I GESYAG Y+P  +  +  +N++    P INLKG  +G+       +   
Sbjct: 220  PEYYTNELYITGESYAGKYIPAFSYHIIQQNQNSN-NPNINLKGIAIGDGLCDPITQVTQ 278

Query: 1011 YYD---YKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIY 841
            Y +   Y GL +      +   Q  DK  E     QE WS       + +FT     D+ 
Sbjct: 279  YANLAFYTGLADLQQQEVMFEYQ--DKIVEA--INQEQWS-----VANDLFT-----DLI 324

Query: 840  NIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRI 661
            N  GP    +   + TG     D+  T                  +P Y      + N+ 
Sbjct: 325  N--GPP---DYFQNITGESDYYDIRKT-----------------VEPTYGGDFTAFLNQS 362

Query: 660  DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADG 481
             ++   H          N+   ++ V+   +      +      I   +K+ +Y+G  D 
Sbjct: 363  SIRAMIHVG-------NNYFQNNNDVYIHLEQDIPKSVKQLFPTILDNIKVILYNGQFDF 415

Query: 480  RVPVIGSRYCI-----EALKLPLKSP---WRSWFHNHQVGGRIVEYHGLTFVTVRGAGHL 325
             V    +   I     E ++  L+SP   W+    N  V G + +++  T V VR AGH+
Sbjct: 416  IVGPSLTETMIRTIEWEGIQPFLESPKIIWKIPSDNVDVAGFVRQWNSFTQVVVRQAGHM 475

Query: 324  VPLNKPSEALALIHSFLSGEELPA 253
            VPL++P+ A  +I  F++ E  P+
Sbjct: 476  VPLDQPARAFDMIDRFINNEPFPS 499



>gb:AC098573_1736774 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1651_G11, complete
            sequence.>gb:AC134929_1741919 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone OSJNBb0035N21,
            complete sequence.
          Length = 442

 Score =  137 bits (346), Expect = 5e-31
 Identities = 135/483 (27%), Positives = 213/483 (44%), Gaps = 14/483 (2%)
 Frame = -2

Query: 1680 MAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSH 1501
            MAPP    LLV  L+I  + A + +P A   +         P   L T+ SGY+ +  ++
Sbjct: 1    MAPP---LLLVSLLLIGFVSARAITPSAEAAAVF-------PKEALPTN-SGYLPITTTN 49

Query: 1500 GRALFYWFFEAK---SHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNK 1330
              +LF+ ++EA    + P++ PL+LWL GGPGCS +  G   ELGP  V R+ + L  N 
Sbjct: 50   A-SLFFAYYEATHPLTPPASTPLLLWLQGGPGCSGLA-GNFFELGPYFVNRDALSLSPNP 107

Query: 1329 YSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDF 1150
            +SWN+   LLF+++P+G GFS               VA   +  L ++    P  +   F
Sbjct: 108  FSWNRRFGLLFIDNPLGTGFS-AAPSPAAIPTNQSVVAAHLFAALQSFFALQPGSRSRPF 166

Query: 1149 FIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSH 970
            F+ GESYAG Y+P     +   N       R+NL G  +GN  T+         + A+  
Sbjct: 167  FLTGESYAGKYIPAAGSYILAVNPTLPTRLRVNLHGVAIGNGLTHPVAQVATHADTAYFM 226

Query: 969  AIISDQQYD-----KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGS 805
             +I+ +Q       +A+ V       WS+   +A  +V +  E                 
Sbjct: 227  GLINAKQKRELEALQARAVELTNAARWSEAA-DARGLVLSWLE----------------- 268

Query: 804  SSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRA 625
             +ATG+  + D A   K+R Y     +  P G          ++ NR +V+ A  A    
Sbjct: 269  -NATGLATLFDAA---KKRPY-----ETGPVG----------KFVNRAEVKAALGAR--- 306

Query: 624  PGSTVNWKTCSDPVFRAYKYTTF-SLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCI 448
                V W+ CSD V  A       S+ P  E L++ G ++ +Y G  D R  V+ +   +
Sbjct: 307  --GDVEWEECSDAVGAAMHGDVMKSVKPEVEALLR-GTRVLLYQGIRDLRDGVVSTEAWM 363

Query: 447  EALK---LP--LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIH 283
              L+   LP  L +    W    ++ G +     L+ V V GAGHL+P +    A  +I 
Sbjct: 364  RELEWDGLPAFLDADRAVWRIGEELAGYVQRSGPLSHVVVYGAGHLMPADNGRAAQEMIE 423

Query: 282  SFL 274
             ++
Sbjct: 424  DWV 426



>gb:AP005514_1853228 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0035A24.
          Length = 331

 Score =  136 bits (343), Expect = 1e-30
 Identities = 89/289 (30%), Positives = 151/289 (52%), Gaps = 14/289 (4%)
 Frame = -2

Query: 1641 LVIWVLCAESSS------PKAAQESDKIGYLPGQPSAPLLTHFSGYITV-NQSHGRALFY 1483
            LV+ +LCA  +       P  A+ S+  G+    PS     H++GYITV +Q   R ++Y
Sbjct: 44   LVVVLLCAAPAPAAVEAVPAGAEVSEFPGFDGDLPSK----HYAGYITVGHQPLKRHMYY 99

Query: 1482 WFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAE-LGPLRVK------RNGVGLHFNKYS 1324
            +F  ++ + +  P+++W+NGGP CS  G+ A    +GPL+++      R+      N +S
Sbjct: 100  YFATSERNSTTDPVIIWINGGPACS--GFSAFLHSIGPLKIEGPMIHARDEPRTKLNPFS 157

Query: 1323 WNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFI 1144
            W K +++L V+SP GVG+SY+             V  D Y+FL  W   + +F  + F+I
Sbjct: 158  WTKMSSVLLVDSPAGVGYSYSENEDDYVTNDTSRVL-DLYDFLSKWFSEYLEFLSNPFYI 216

Query: 1143 AGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI 964
            AG SY+G  VP LA+ +  RN D G   +IN KG+ + NP  +   +    + YA+   +
Sbjct: 217  AGCSYSGVIVPVLAQEILKRNEDNGRI-KINFKGYSLCNPAVDVEIENNAFVPYAFRMGL 275

Query: 963  ISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCL 817
            ISD+ Y      C+   + W++K    ++ +  ++ +  + N+   RCL
Sbjct: 276  ISDELYQNLVSTCN--GKYWNNKGPSCLANL-EQFHKKPMRNMILVRCL 321



>gb:CR382129_1661351 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 520

 Score =  135 bits (339), Expect = 3e-30
 Identities = 120/444 (27%), Positives = 199/444 (44%), Gaps = 18/444 (4%)
 Frame = -2

Query: 1542 LTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRV 1363
            +T ++GY+T N++     FYW FE+++ P N P++LWL GGPG SS   G   E GP R+
Sbjct: 117  VTEYTGYLTANETEH--FFYWAFESRNDPKNDPVILWLQGGPGSSS-ELGNLFENGPSRI 173

Query: 1362 KRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWL 1183
             ++   +H N ++WN  A +++++ P  VGFSYT+             A + YNFL  + 
Sbjct: 174  GKDLKPIH-NPHAWNNNATIVYLDQPADVGFSYTDKPHSVVNSAQ--AATEVYNFLELFF 230

Query: 1182 ERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPET---ND 1012
             ++         +  ESY GHY P  A  +  ++ DR       L+  +VGN  T   N 
Sbjct: 231  AKYDHLP-KKLHVTAESYGGHYGPATAYEIL-QHPDRS----FTLESLVVGNGMTDPLNQ 284

Query: 1011 YYDYKGLLEYAWSHAIISD----QQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDI 844
            Y +Y  ++      A + D    QQ D+A + C         KC                
Sbjct: 285  YTEYGPMMCGKGGVAPVVDQSTCQQVDEAAKEC----IPLIQKC---------------- 324

Query: 843  YNIYGPR-CLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCY--SPYAEEY 673
            Y+   P+ C    ++    + G+   +L   + T    + +      D CY  + Y  E+
Sbjct: 325  YDTGAPQDCADAVNNCNDNVLGLYPSSLNPYDETKQCEQAQD-----DGCYTETDYMTEW 379

Query: 672  FNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS-LLPVYEKL--IKGGLKIWI 502
             N         + + A G+  NW   S  V+  +  T+   +LPV   +  I   + + I
Sbjct: 380  LN-------LPSTLEAIGAKHNWTGSSGTVYNDFTETSGDWMLPVVRDIPAILKEVPVLI 432

Query: 501  YSGDADGRVPVIGSRYCIEALKLPLKSPWR-SWFHNHQVGGR----IVEYHGLTFVTVRG 337
            Y+GD D     +G +   EAL+ P K  +  + F     GG+    +  Y   TF+ +  
Sbjct: 433  YAGDKDWICNWLGQKKWTEALEWPGKQGFNDAQFKPFSAGGKQAGEVRNYQQFTFLRIFD 492

Query: 336  AGHLVPLNKPSEALALIHSFLSGE 265
            AGH+VP ++P     +I+ ++SG+
Sbjct: 493  AGHMVPHDQPVATSEMINRWMSGD 516



>gb:AE017351_1759483 Cryptococcus neoformans var. neoformans JEC21
            chromosome 11, complete sequence.
          Length = 520

 Score =  134 bits (338), Expect = 4e-30
 Identities = 76/187 (40%), Positives = 111/187 (59%), Gaps = 6/187 (3%)
 Frame = -2

Query: 1548 PLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPL 1369
            P +  +SG++ V   +G+ LF++FFE++S PS  P+V+W+NGGPGCSS   G   ELGP 
Sbjct: 94   PDVKSYSGFLDVG--YGKNLFFYFFESRSKPSEDPIVMWINGGPGCSS-SLGMLMELGPC 150

Query: 1368 RVKRNGVGLH---FNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNF 1198
             VK +  G++    N Y+WN++AN+ F++ P+GVGFS+ N          +  A D   F
Sbjct: 151  SVKDDPKGVNDTERNPYAWNEKANVFFLDEPIGVGFSHAN--NGQTVSTTEEAAIDVQAF 208

Query: 1197 LVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRD---RGIYPRINLKGFIVGN 1027
            +  + E F +F+G  F +AGESY G Y+P  A  V D N+     G  P INL   ++GN
Sbjct: 209  ISIFFETFKEFEGRAFHMAGESYGGRYLPVFASAVVDGNKQLIKDGKTP-INLNSVMIGN 267

Query: 1026 PETNDYY 1006
              T DY+
Sbjct: 268  GVT-DYF 273



 Score = 55.5 bits (132), Expect = 3e-06
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 8/125 (6%)
 Frame = -2

Query: 609 NWKTCSDPVFRAYKYT---TFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL 439
           NW +C  PVF  +  +   T         L++ G+++  Y G  D     + +   +E L
Sbjct: 394 NWSSCDGPVFTRFTQSLDNTGKTWLYVAGLLERGVRVLNYVGMLDFICNHVANELWMERL 453

Query: 438 KLPLKSPWRS-----WFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFL 274
           +   K  + +     W  +    G    Y  LT + +RGAGH+VP +KP EAL+++ S+L
Sbjct: 454 EWSGKEGYNAAQFSDWVVDGHRAGEFKTYGNLTMLKIRGAGHMVPYDKPKEALSMVTSWL 513

Query: 273 SGEEL 259
               L
Sbjct: 514 DAAAL 518



>pir|T49934|T49934 carboxypeptidase-like protein - Arabidopsis
            thaliana>gb:ATF17I14_1548922 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F17I14 (ESSA project).
          Length = 399

 Score =  133 bits (335), Expect = 1e-29
 Identities = 69/207 (33%), Positives = 115/207 (55%), Gaps = 5/207 (2%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK--- 1360
            +GY+++ +S    LFY+F +++ +P N PL++WL GGPGCSSI  G     GPL  K   
Sbjct: 43   TGYVSIGESGDVELFYYFVKSERNPENDPLMIWLTGGPGCSSI-CGLLFANGPLAFKGDE 101

Query: 1359 RNGV--GLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNW 1186
             NG    L    +SW K AN+L++E+P G G+SY            K + Q    FL +W
Sbjct: 102  YNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFESSDTKQMHQ-IDQFLRSW 160

Query: 1185 LERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYY 1006
              + P+F  + F++ G+SY+G  VP   + +     ++G+ P IN++G+++GNP T+   
Sbjct: 161  FVKHPEFISNPFYVGGDSYSGKIVPGAVQQI-SLGNEKGLTPLINIQGYVLGNPVTDKNI 219

Query: 1005 DYKGLLEYAWSHAIISDQQYDKAKEVC 925
            +    + +A    +ISD+ ++  +  C
Sbjct: 220  ETNYRVPFAHGMGLISDELFESLERSC 246



>sp|P34946|CPS1_PENJA Carboxypeptidase S1 (EC
            3.4.16.6).>pir|S38953|S38953 carboxypeptidase D (EC
            3.4.16.6) - Penicillium janthinellum
          Length = 423

 Score =  133 bits (335), Expect = 1e-29
 Identities = 104/436 (23%), Positives = 188/436 (43%), Gaps = 16/436 (3%)
 Frame = -2

Query: 1554 SAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELG 1375
            + P +  +SGY++V  +    +++WFFEA+++P   PL  W NGGPGCSS+  G   E G
Sbjct: 10   TTPGVNQYSGYLSVGSNMN--MWFWFFEARNNPQQAPLAAWFNGGPGCSSM-IGLFQENG 66

Query: 1374 PLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFL 1195
            P            N+ SWN  AN+++++ P+GVGFSY             +V    +N L
Sbjct: 67   PCHFVNGDSTPSLNENSWNNYANMIYIDQPIGVGFSYGTDDVTSTVTAAPYV----WNLL 122

Query: 1194 VNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRN----RDRGIYPRINLKGFIVGN 1027
              +  + P+++  DF I  ESY GHY P+ A  +  +N            +N+    V N
Sbjct: 123  QAFYAQRPEYESRDFAIFTESYGGHYGPEFASYIEQQNAAIKAGSVTGQNVNIVALGVNN 182

Query: 1026 PETNDYYDYKGLLEYAWSHA---IISDQQYDKAKEVCDFTQENWSDKCNEAMSIV-FTKY 859
               +     K  ++++++++   II     D   +  +        +C+++ S    T  
Sbjct: 183  GWIDSTIQEKAYIDFSYNNSYQQIIDSSTRDSLLDAYNNQCLPALQQCSQSGSTSDCTNA 242

Query: 858  EEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAE 679
            + +   NI GP        S++G   V D+                     +P   PY  
Sbjct: 243  DSVCYQNIEGP-------ISSSGDFDVYDIR--------------------EPSNDPYPP 275

Query: 678  EYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYT---TFSLLPVYEKLIKGGLKI 508
            + ++      +    ++A G+  N++ C +  +  +  T     S L     +++ G+ +
Sbjct: 276  KTYS---TYLSDPTVVKAIGARTNYQECPNGPYNKFASTGDNPRSFLSTLSSVVQSGINV 332

Query: 507  WIYSGDADGRVPVIGSRYCIEALKLPLKSPWRS-----WFHNHQVGGRIVEYHGLTFVTV 343
             +++GDAD     +G+     A+  P  + + +     +  N    G+       +F+ V
Sbjct: 333  LVWAGDADWICNWLGNYEVANAVDFPGNAQFSALDLAPYTVNGVEKGQFKTVDNFSFLKV 392

Query: 342  RGAGHLVPLNKPSEAL 295
             GAGH VP  +P  AL
Sbjct: 393  YGAGHEVPYYQPDTAL 408



>gb:AK017087_1159016 Mus musculus adult male testis cDNA, RIKEN
            full-length enriched library, clone:4933436L16
            product:similar to CARBOXYPEPTIDASE, VITELLOGENIC-LIKE
            [Homo sapiens], full insert sequence.
          Length = 434

 Score =  133 bits (334), Expect = 1e-29
 Identities = 73/196 (37%), Positives = 109/196 (55%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNG 1423
            K  Q    +   PG         ++GYITVNQ++   LF+WFF A+  P + P+VLWL G
Sbjct: 57   KEGQRKSMVSPFPGMNDKS----YAGYITVNQTYNSNLFFWFFPARMQPEDAPVVLWLQG 112

Query: 1422 GPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXX 1243
            GPG SS+ +G   E GP  +  N + +    + W    ++L++++PVG GFS+T+     
Sbjct: 113  GPGGSSM-FGLFVEHGPYIITSN-MTVVARDFPWTFTLSMLYIDNPVGTGFSFTDHFQGY 170

Query: 1242 XXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIY 1063
                D  VAQD Y+ L+ +   FP++  +DF++ GESYAG YVP LA  +   N  R   
Sbjct: 171  ATSEDD-VAQDLYSALIQFFTLFPEYAKNDFYVTGESYAGKYVPALAHYIHSLNPVRKF- 228

Query: 1062 PRINLKGFIVGNPETN 1015
             +I LKG  +G+  T+
Sbjct: 229  -KIRLKGIAIGDAYTD 243



 Score = 34.7 bits (78), Expect = 6.3
 Identities = 32/148 (21%), Positives = 62/148 (41%), Gaps = 6/148 (4%)
 Frame = -2

Query: 699 CYSPYAEEYFNRI----DVQKAFHANIR--APGSTVNWKTCSDPVFRAYKYTTFSLLPVY 538
           C  P  + YF +      V++A H   +  + G+ V      D V ++ K     ++  Y
Sbjct: 278 CTEPKEQSYFAKFLTLPQVRQAIHVGNQNFSDGAEVEKHLREDTV-KSVKPWLSEIMNYY 336

Query: 537 EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGL 358
           + LI  G    I +     R  +        A +   +  W+ +  +++V G +      
Sbjct: 337 KVLIYNGQLDIIVAAALTERSLMAMDWKGSRAYRRARRKVWKIFKSDNEVAGYVRRVGKF 396

Query: 357 TFVTVRGAGHLVPLNKPSEALALIHSFL 274
             V VRG GH++P ++P  +  +I+ F+
Sbjct: 397 HQVIVRGGGHILPYDQPMRSFDMINRFI 424



>pir|D86283|D86283 T15D22.4 protein - Arabidopsis
            thaliana>gb:AE005172_890496 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AY075612_1567759 Arabidopsis thaliana
            At1g15000/T15D22_7 mRNA, complete
            cds.>gb:BT002620_1636223 Arabidopsis thaliana
            At1g15000/T15D22_7 mRNA, complete cds.>gb:T15D22_1723475
            Arabidopsis thaliana chromosome 1 BAC T15D22 sequence,
            complete sequence.
          Length = 444

 Score =  126 bits (316), Expect = 2e-27
 Identities = 114/438 (26%), Positives = 186/438 (42%), Gaps = 14/438 (3%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPS---NKPLVLWLNGGPGCSSIGYGAAAELGPLRVK 1360
            SGY+ V  + G ++FY F+EA+   +   + PL++WL GGPGCSS+  G   ELGP RV 
Sbjct: 37   SGYLPVKPAPGSSMFYAFYEAQEPTTPLPDTPLLVWLQGGPGCSSM-IGNFYELGPWRVV 95

Query: 1359 RNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE 1180
                 L  N  +WN+   LLFV++P+GVGFS             + VA+  Y  LV +LE
Sbjct: 96   SRATDLERNPGAWNRLFGLLFVDNPIGVGFSIA-ASQQDIPTNQRQVAEHLYAALVEFLE 154

Query: 1179 RFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDY 1000
            + P F+    +  GESYAG YVP +   +  + +  G   ++NLKG  +GN  T+     
Sbjct: 155  QNPSFENRPVYFTGESYAGKYVPAIGYYIL-KEKPNG---KVNLKGLAIGNGLTDPVTQV 210

Query: 999  KGLLEYAWSHAIISDQQ---YDKAKE--VCDFTQENWSDKCNEAMSIVFTKYEEIDIYNI 835
            +      +   +++ +Q     KA+E  V     + W +  +                  
Sbjct: 211  QTHAVNVYYSGLVNAKQRVELQKAQEISVALVKSQKWREAADARTE-------------- 256

Query: 834  YGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDV 655
                 LL   S+ TG+       L N  R   YR             +    +  N+ + 
Sbjct: 257  -----LLTLLSNMTGL-----ATLYNTARAIPYR-------------TDLVVDLLNQREA 293

Query: 654  QKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRV 475
            ++     +     TV ++ CSD V    +      +    +      ++ +Y G  D R 
Sbjct: 294  KR-----VLGVSETVRFEECSDEVEDVLRADVMKSVKFMVEYALERTQVLLYQGMLDLRD 348

Query: 474  PVIGSRYCIE-----ALKLPLKSPWRSW-FHNHQVGGRIVEYHGLTFVTVRGAGHLVPLN 313
             V+ +   ++      L +   +  R W   +  V G +  +  L  V V GAGH VP +
Sbjct: 349  GVVSTEEWMKTMNWSGLGMFSTAERRVWKDEDGVVAGYVQRWGNLCHVAVTGAGHFVPTD 408

Query: 312  KPSEALALIHSFLSGEEL 259
            K   +  +I  ++ G+ L
Sbjct: 409  KAVNSRDMIEGWVLGKGL 426



>pir|T39601|T39601 serine carboxypeptidase-like protein - fission
            yeast  (Schizosaccharomyces pombe)>gb:SPBC16G5_1719166
            S.pombe chromosome II cosmid c16G5.
          Length = 510

 Score =  125 bits (313), Expect = 4e-27
 Identities = 104/431 (24%), Positives = 179/431 (41%), Gaps = 9/431 (2%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNG 1351
            +G++         LF+W FE+         +LWLNGGPGCSS   G+  E+GP R+  N 
Sbjct: 47   AGHLNQTDQLDGDLFFWMFESVKPEYEHRSILWLNGGPGCSSED-GSLMEVGPFRLDDNN 105

Query: 1350 VGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFP 1171
                 N   W++  NLLFV+ P+G G+SY+          ++ +A D   F   +LE FP
Sbjct: 106  T-FQLNPGRWDELGNLLFVDQPLGTGYSYS--LAKDFQSNNEKMANDFSIFFEKFLEEFP 162

Query: 1170 QFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGL 991
            +    ++FIAGES+AG Y+P +A  + ++N        +NL G  +GN   N    Y+  
Sbjct: 163  ERANDEWFIAGESFAGQYIPHIAAKLKEKN-------LVNLGGLAIGNGWINPLSHYETY 215

Query: 990  LEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEID-IYNIYGPRCLL 814
            L Y     ++     D   E+  +   +W++ C  A   + +   ++    +  G    +
Sbjct: 216  LNY-----LVEKGMVDFESELGQYLHHSWAE-CLLAFDKIGSGSGDLSKCESFLGDILYM 269

Query: 813  NGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHAN 634
                       + D++L   E TY    M        P    Y  E+ +  +   + + N
Sbjct: 270  VSKEPGKACMNMYDISL---ESTYPTCGMDW------PYDLSYLTEFLSTREAMTSLNVN 320

Query: 633  IRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRY 454
            +       +W+ C+D V   Y            + +   + I ++ G+ D     +    
Sbjct: 321  LE---KVHDWEECNDDVALQYAREGIESSSKLIQDLVSTVPILLFYGENDFLCNYLSGEK 377

Query: 453  CIEALKL--------PLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEA 298
               +L+             P+    ++ Q  G  V    LTF  +  A H+VP + P+E 
Sbjct: 378  LTRSLEWNGAVGFQNQSAQPFYLPGYSDQPSGSYVSSRNLTFARIVEASHMVPYDHPNEM 437

Query: 297  LALIHSFLSGE 265
              LI +F + +
Sbjct: 438  KTLITAFFNND 448



>gb:AP001633_1821371 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0515G01.>gb:AP003104_1824731 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:OSJNBa0038J17.
          Length = 429

 Score =  124 bits (310), Expect = 8e-27
 Identities = 118/435 (27%), Positives = 190/435 (43%), Gaps = 16/435 (3%)
 Frame = -2

Query: 1530 SGYITVNQSHGRALFYWFFEAK---SHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK 1360
            SGY+ +  ++  +LF+ ++EA    + P++ P++LWL GGPGCS +  G   ELGP  V 
Sbjct: 25   SGYLPIPTANA-SLFFAYYEATHLLTPPASTPIILWLQGGPGCSGLT-GNFFELGPYFVN 82

Query: 1359 RNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE 1180
             + + L  N ++WN+   LLF+++P+G GFS               VA   +  L ++  
Sbjct: 83   HDALSLSPNPFAWNRRFGLLFIDNPLGTGFSAAPSPAAIPTNQF-VVAAHLFTALQSFFA 141

Query: 1179 RFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDY 1000
              P F+   FF+ GESYAG YVP     +   N       R+NL G  + N  T+     
Sbjct: 142  LQPGFRSRPFFLTGESYAGKYVPAAGSYILAVNPTLPKRLRVNLHGVAIDNGLTHPVAQV 201

Query: 999  KGLLEYAWSHAIISDQQYD-----KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNI 835
                + A+   +I+ +Q       +A+ V       WS+   +A  +V +  E       
Sbjct: 202  ATHADTAYFMGLINAKQRRELEALQARAVELTNAARWSEAA-DARELVLSLLE------- 253

Query: 834  YGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDV 655
                       +ATG+    D A   K+R Y     +  P G          ++ NR +V
Sbjct: 254  -----------NATGLATQFDAA---KQRPY-----ETGPVG----------KFVNRAEV 284

Query: 654  QKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTF-SLLPVYEKLIKGGLKIWIYSG--DAD 484
            + A  A      + V W+ CSD V  A       S+ P  E L++ G ++ +Y G  D +
Sbjct: 285  KAALGAR-----TDVEWEDCSDTVGAAMHGDVMKSVKPGVEALLR-GTRVLLYQGIRDLN 338

Query: 483  GRVPVIGSRYCIEALKLP-----LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVP 319
             R  V+ +   +  LK       L +    W    ++ G +     L+ V V GAGHLVP
Sbjct: 339  LRDGVVSTEAWMRELKWDGLTAFLVADRAVWRIGEELAGYVQRSGPLSHVIVDGAGHLVP 398

Query: 318  LNKPSEALALIHSFL 274
             +    A  +I  ++
Sbjct: 399  ADNGRVAQEMIEDWV 413



>gb:AE016819_1749384 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 599

 Score =  124 bits (310), Expect = 8e-27
 Identities = 120/427 (28%), Positives = 184/427 (43%), Gaps = 22/427 (5%)
 Frame = -2

Query: 1500 GRALFYWFF-EAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYS 1324
            GRALF+W   E      +  L++WLNGGPGCSS+  GA  E G  RV  +G  L+ N  S
Sbjct: 59   GRALFFWRMGEQCGKRCSNELIVWLNGGPGCSSMD-GALMETGAFRVAEDGK-LYLNSGS 116

Query: 1323 WNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFI 1144
            W+    +LFV+ PVG GFS             + +A D   F+  +   FP+ +     +
Sbjct: 117  WHTRGTMLFVDQPVGTGFSRPGRDGRLRTELSQ-LADDFLLFMERYYAVFPEDRRRTLVL 175

Query: 1143 AGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI 964
            AGESYAG Y+P  A+ V  RN +R    R  L+  ++GN   +        + +  S  +
Sbjct: 176  AGESYAGQYLPYFADAVVRRNAERAPEERYKLQNVMIGNGWVDPDLQSLSYVPFVSSRGL 235

Query: 963  ISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIR 784
               +  +    + D  QE   +  N   +  F+  E   I     P+ L    SS  G  
Sbjct: 236  FGPETRNFQDILRD--QEACQNAINHGPAKGFSHPECEGIL----PKLL----SSIPG-- 283

Query: 783  GVLDLALTNKERTYAYRRMKRIP--GGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTV 610
               D  +      Y  R     P  G   P   P   ++F    V +A H + +  G  V
Sbjct: 284  --PDRPVQQCINMYDIRLRDVFPSCGMNWPADLPNVHKFFGTPGVLEALHVDPQVAGPWV 341

Query: 609  NWKTC-SDPVFRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKL 433
              K+  S+ +  A+   +  L+P    LI+ G+K   ++GD D    VI +   +E L  
Sbjct: 342  ECKSAVSEALVNAHSRPSVHLIP---GLIEAGVKFVFFNGDQD----VICNNMGVEMLIA 394

Query: 432  PLKSPWR------------SWFHNHQ-----VGGRIVEYHG-LTFVTVRGAGHLVPLNKP 307
             L+  WR             W+H+       V   +V+  G +TF++V  A H+VP + P
Sbjct: 395  ELR--WRGHMGFSNATENFDWYHSDADAKTLVAAGVVKRDGPVTFISVFNASHMVPFDVP 452

Query: 306  SEALALI 286
              +  +I
Sbjct: 453  RISRGII 459



>gb:CAR271659_1645180 Cicer arietinum partial mRNA for serine
            carboxipeptidase.
          Length = 360

 Score =  122 bits (305), Expect = 3e-26
 Identities = 103/365 (28%), Positives = 169/365 (46%), Gaps = 8/365 (2%)
 Frame = -2

Query: 1338 FNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKG 1159
            +N+Y W+K +N+L+V+ P G GFSY++          K V+ D Y+FL  +    PQ+  
Sbjct: 11   WNEYGWDKVSNILYVDQPTGTGFSYSSDLRDIRHNE-KGVSNDLYDFLQAFFAEHPQYAK 69

Query: 1158 HDFFIAGESYAGHYVPQLAEVVFDRNRDR-GIYPRINLKGFIVGNPETNDYYDYKGLLEY 982
            ++FFI GESYAGHY+P LA  +   N+ + GI+  INLKG  +GN  TN    YK   +Y
Sbjct: 70   NNFFITGESYAGHYIPALASRIRQGNQAKEGIH--INLKGLAIGNGLTNPAIQYKAYADY 127

Query: 981  AWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSS 802
            A    II+   +D+   V           C  A+ +  T           G    L  + 
Sbjct: 128  ALDMGIITKATHDRLGLVL-------VPACELAIKLCGTD----------GKLACLTANV 170

Query: 801  SATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS-PYAEEYFNRIDVQKAFHANIRA 625
            +   I    D+ L   +  Y Y   K+  G    CY     E++ N+  V+ +       
Sbjct: 171  ACNLI--FSDILLHAGDVNY-YDIRKKCEGSL--CYDFSNMEKFLNQESVRDSLGV---- 221

Query: 624  PGSTVNWKTCSDPVFRAYKYTTFSLLPV-YEKLIKGGLKIWIYSGDADGRVPVIGSRYCI 448
              + +++ +CS  V+ A        L V    L++ G+ + +Y+G+ D     +G+   +
Sbjct: 222  --AKISFVSCSTEVYIAMLVDWMRNLEVGIPILLEDGINLLVYAGEYDLICNWLGNSRWV 279

Query: 447  EAL-----KLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIH 283
             A+     K  + SP   +  N    G +  Y  L+F+ V  AGH+VP+++P  AL ++ 
Sbjct: 280  HAMEWSGQKKFVASPDVPFVVNGSEAGLLKNYGPLSFLKVYDAGHMVPMDQPKAALEMLK 339

Query: 282  SFLSG 268
             +  G
Sbjct: 340  KWTRG 344



>sp|P09620|KEX1_YEAST Carboxypeptidase KEX1 precursor (EC 3.4.16.6)
            (Carboxypeptidase D).>pir|A29651|A29651 KEX1 protein
            precursor - yeast (Saccharomyces
            cerevisiae)>gb:SCYGL203C_1712131 S.cerevisiae chromosome
            VII reading frame ORF YGL203c.>gb:YSCKEX1_1729406
            S.cerevisiae (clone pAD17) carboxypeptidase B-like
            processing protease (KEX1) gene, complete cds.
          Length = 729

 Score =  121 bits (303), Expect = 5e-26
 Identities = 121/468 (25%), Positives = 201/468 (42%), Gaps = 39/468 (8%)
 Frame = -2

Query: 1596 AQESDKIGY--LPGQPSAPLLTHF----SGYITV-----NQSHGRALFYWFFEAKSHPSN 1450
            + E  K+ Y  LPG    P  ++     +G+I +     ++     L Y+F++  ++ SN
Sbjct: 25   SSEEYKVAYELLPGLSEVPDPSNIPQMHAGHIPLRSEDADEQDSSDLEYFFWKFTNNDSN 84

Query: 1449 ----KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
                +PL++WLNGGPGCSS+  GA  E GP RV  +G  L+ N+ SW  + +LLF++ P 
Sbjct: 85   GNVDRPLIIWLNGGPGCSSMD-GALVESGPFRVNSDGK-LYLNEGSWISKGDLLFIDQPT 142

Query: 1281 GVGFSYTNXXXXXXXXXDKF------VAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGH 1120
            G GFS            +KF      V +   +FL N+ + FP+       ++GESYAG 
Sbjct: 143  GTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQ 202

Query: 1119 YVPQLAEVVFDRNRDRGI-YPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYD 943
            Y+P  A  + + N+   I     +LK  ++GN   +        L +A    +I D+   
Sbjct: 203  YIPFFANAILNHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYLPFAMEKKLI-DESNP 261

Query: 942  KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLAL 763
              K + +   EN  +  N A +     +   +  NI          SS  G    L++  
Sbjct: 262  NFKHLTN-AHENCQNLINSASTDEAAHFSYQECENILNLLLSYTRESSQKGTADCLNMYN 320

Query: 762  TNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPV 583
             N + +Y    M        P    +  ++F+   V  + H +        +WK C++ V
Sbjct: 321  FNLKDSYPSCGMNW------PKDISFVSKFFSTPGVIDSLHLD---SDKIDHWKECTNSV 371

Query: 582  ----FRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKL------ 433
                       +  LLP    L++ G++I +++GD D      G    I+ LK       
Sbjct: 372  GTKLSNPISKPSIHLLP---GLLESGIEIVLFNGDKDLICNNKGVLDTIDNLKWGGIKGF 428

Query: 432  ---PLKSPW----RSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNK 310
                +   W    +S   + +  G +     LTFV+V  A H+VP +K
Sbjct: 429  SDDAVSFDWIHKSKSTDDSEEFSGYVKYDRNLTFVSVYNASHMVPFDK 476



>gb:AC120983_1739975 Oryza sativa chromosome 3 BAC OSJNBb0011H13
            genomic sequence, complete sequence.
          Length = 301

 Score =  120 bits (302), Expect = 7e-26
 Identities = 82/285 (28%), Positives = 133/285 (46%), Gaps = 5/285 (1%)
 Frame = -2

Query: 1623 CAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKP 1444
            C+ SSS   +  S  I +LPG          +GYI + +  G  LFY+F E++++P   P
Sbjct: 39   CSASSS---SSSSSVITHLPGFHGRLPFYLETGYIGIEEKTGTELFYYFVESETNPDTDP 95

Query: 1443 LVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVG-----LHFNKYSWNKEANLLFVESPVG 1279
            LVLWL GGP CS+   G A E+GPL             L +N+YSW + A+++F++SPVG
Sbjct: 96   LVLWLVGGPRCSAFS-GLAYEVGPLNFVLEAYNGSLPRLVYNQYSWTQMASIIFLDSPVG 154

Query: 1278 VGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAE 1099
             GFSY                Q    F+  WL   P+++ H+F++ G SYAG  VP + +
Sbjct: 155  SGFSYARDSNGYDVGDISSSLQ-VVTFMKEWLNDHPRYRSHNFYVGGASYAGKVVPVIVQ 213

Query: 1098 VVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDF 919
             + + ++                       +D    + Y+    IISDQ Y+ A   C  
Sbjct: 214  YISEGSK-----------------------FDKNFHVPYSHGVGIISDQLYEAAVTHCKG 250

Query: 918  TQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIR 784
               N +++     ++V+T  +    Y  Y   C +N +++   ++
Sbjct: 251  DFVNPTNQL--CANVVYTINKS---YGYYLSYCWMNDNTTRDALK 290



>gb:A16772_1447683 ysc alpha gene (coding for a soluble protein) seq
            ID No: 2.
          Length = 598

 Score =  119 bits (297), Expect = 3e-25
 Identities = 120/468 (25%), Positives = 200/468 (42%), Gaps = 39/468 (8%)
 Frame = -2

Query: 1596 AQESDKIGY--LPGQPSAPLLTHF----SGYITV-----NQSHGRALFYWFFEAKSHPSN 1450
            + E  K+ Y  LPG    P  ++     +G+I +     ++     L Y+F++  ++ SN
Sbjct: 25   SSEEYKVAYELLPGLSEVPDPSNIPQMHAGHIPLRSEDADEQDSSDLEYFFWKFTNNDSN 84

Query: 1449 ----KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPV 1282
                +PL++WL GGPGCSS+  GA  E GP RV  +G  L+ N+ SW  + +LLF++ P 
Sbjct: 85   GNVDRPLIIWLKGGPGCSSMD-GALVESGPFRVNSDGK-LYLNEGSWISKGDLLFIDQPT 142

Query: 1281 GVGFSYTNXXXXXXXXXDKF------VAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGH 1120
            G GFS            +KF      V +   +FL N+ + FP+       ++GESYAG 
Sbjct: 143  GTGFSVEQNKDEGKIDKNKFDEDLEDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQ 202

Query: 1119 YVPQLAEVVFDRNRDRGI-YPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYD 943
            Y+P  A  + + N+   I     +LK  ++GN   +        L +A    +I D+   
Sbjct: 203  YIPFFANAILNHNKFSKIDGDTYDLKALLIGNGWIDPNTQSLSYLPFAMEKKLI-DESNP 261

Query: 942  KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLAL 763
              K + +   EN  +  N A +     +   +  NI          SS  G    L++  
Sbjct: 262  NFKHLTN-AHENCQNLINSASTDEAAHFSYQECENILNLLLSYTRESSQKGTADCLNMYN 320

Query: 762  TNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPV 583
             N + +Y    M        P    +  ++F+   V  + H +        +WK C++ V
Sbjct: 321  FNLKDSYPSCGMNW------PKDISFVSKFFSTPGVIDSLHLD---SDKIDHWKECTNSV 371

Query: 582  ----FRAYKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKL------ 433
                       +  LLP    L++ G++I +++GD D      G    I+ LK       
Sbjct: 372  GTKLSNPISKPSIHLLP---GLLESGIEIVLFNGDKDLICNNKGVLDTIDNLKWGGIKGF 428

Query: 432  ---PLKSPW----RSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNK 310
                +   W    +S   + +  G +     LTFV+V  A H+VP +K
Sbjct: 429  SDDAVSFDWIHKSKSTDDSEEFSGYVKYDRNLTFVSVYNASHMVPFDK 476



>gb:AY310135_1318075 Trypanosoma cruzi serine carboxypeptidase CBP1
            and serine carboxypeptidase CBP2 genes, partial cds.
          Length = 354

 Score =  119 bits (297), Expect = 3e-25
 Identities = 109/391 (27%), Positives = 167/391 (42%), Gaps = 32/391 (8%)
 Frame = -2

Query: 1344 LHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQF 1165
            ++ N YSWN EA +++V+ P GVGFSY           +  V++D Y+FL  +     + 
Sbjct: 2    IYKNNYSWNNEAYVIYVDQPAGVGFSYAEVEDYDSNEEE--VSEDMYHFLQAFFRAHQKL 59

Query: 1164 KGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLE 985
            + +  F+ GESY GHY P  A  +   NR+    P I L G  VGN  T+ Y  Y     
Sbjct: 60   RKNKLFVVGESYGGHYAPATAHHINKANREHVGLP-IRLAGLAVGNGLTDPYTQYAAYPS 118

Query: 984  YAW-------SHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGP 826
            +AW           +S++ Y +   +           C +A+ I  +    I        
Sbjct: 119  FAWGWCREKLGEPCVSEEGYQQMSSMV--------PPCQKAIEICNSDNNFIAKVACVTA 170

Query: 825  RCLLN---GSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYA-EEYFNRID 658
            R L N   G  SATG+              Y  R+    P     CY+  A   + NR D
Sbjct: 171  RVLCNPIIGVYSATGL------------NNYDIRK----PCIGTLCYNFDALNAFMNRED 214

Query: 657  VQKAFHANIRAPGSTVNWKTCSDPV--------FRAYKYTTFSLLPVYEKLIKGGLKIWI 502
            VQ +  A  +       W++C+  V        F+ + YT  +LL       + G+ + I
Sbjct: 215  VQSSLGAKRQV------WQSCNMEVNLMFLMDWFKNFNYTVPTLL-------EDGVSVMI 261

Query: 501  YSGDADGRVPVIGSRYCIEALKLPLKS--------PWRSWFHNHQVGGRI-----VEYHG 361
            Y+G+ D     IG++    AL  P K+        P+R+   +  V G +          
Sbjct: 262  YAGEMDFICNWIGNKQWTTALNWPGKAVFNAAPDEPFRA--PDGTVAGLVRTAAAASTSN 319

Query: 360  LTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
            LTFV V  AGH+VP+++P+ A  +I +FL G
Sbjct: 320  LTFVQVYNAGHMVPMDQPASAFVMISNFLQG 350



>pir|A41612|A41612 vitellogenic carboxypeptidase (EC 3.4.16.-)
            precursor - yellow fever mosquito>gb:MQSCPDA_1390080
            Aedes aegypti carboxypeptidase mRNA sequence.
          Length = 441

 Score =  118 bits (296), Expect = 3e-25
 Identities = 57/181 (31%), Positives = 101/181 (55%)
 Frame = -2

Query: 1557 PSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAEL 1378
            P    +  +SG++TV+  H   LF+W+  AK++    P+++WL GGPG SS+ +G   E 
Sbjct: 69   PMLSSVESYSGFMTVDAKHNSNLFFWYVPAKNNREQAPILVWLQGGPGASSL-FGMFEEN 127

Query: 1377 GPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNF 1198
            GP  + RN   +   +YSW++  +++++++PVG GFS+T+         ++ V ++   F
Sbjct: 128  GPFHIHRNN-SVKQREYSWHQNHHMIYIDNPVGTGFSFTD-SDEGYSTNEEHVGENLMKF 185

Query: 1197 LVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPET 1018
            +  +   FP    H F+I+GESY G +VP     + +        P+INL+G  +G+  T
Sbjct: 186  IQQFFVLFPNLLKHPFYISGESYGGKFVPAFGYAIHNSQSQ----PKINLQGLAIGDGYT 241

Query: 1017 N 1015
            +
Sbjct: 242  D 242



>sp|P42660|VCP_AEDAE Vitellogenic carboxypeptidase precursor (EC
            3.4.16.-).>gb:MQSAACR_1390072 Aedes aegypti (strain
            ugals) vitellogenic carboxypeptidase gene, complete cds.
          Length = 471

 Score =  117 bits (294), Expect = 6e-25
 Identities = 57/181 (31%), Positives = 101/181 (55%)
 Frame = -2

Query: 1557 PSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAEL 1378
            P    +  +SG++TV+  H   LF+W+  AK++    P+++WL GGPG SS+ +G   E 
Sbjct: 69   PMLSSVESYSGFMTVDAKHNSNLFFWYVPAKNNREQAPILVWLQGGPGASSL-FGMFEEN 127

Query: 1377 GPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNF 1198
            GP  + RN   +   +YSW++  +++++++PVG GFS+T+         ++ V ++   F
Sbjct: 128  GPFHIHRN-KSVKQREYSWHQNHHMIYIDNPVGTGFSFTD-SDEGYSTNEEHVGENLMKF 185

Query: 1197 LVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPET 1018
            +  +   FP    H F+I+GESY G +VP     + +        P+INL+G  +G+  T
Sbjct: 186  IQQFFVLFPNLLKHPFYISGESYGGKFVPAFGYAIHNSQSQ----PKINLQGLAIGDGYT 241

Query: 1017 N 1015
            +
Sbjct: 242  D 242



>gb:AY436352_1606114 Aspergillus fumigatus carboxypeptidase 2 gene,
            complete cds.
          Length = 553

 Score =  116 bits (290), Expect = 2e-24
 Identities = 119/490 (24%), Positives = 199/490 (40%), Gaps = 58/490 (11%)
 Frame = -2

Query: 1554 SAPLLTHFSGYITVN-QSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAEL 1378
            + P +  +SGY+ ++ +SH    F+WFFEA+  P N P+ LWLNGGPG  S+  G   EL
Sbjct: 63   TTPGVKSYSGYVDISPESH---TFFWFFEARHDPKNAPITLWLNGGPGSDSL-IGLFEEL 118

Query: 1377 GPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNX------------------- 1255
            GP R+  + +    N +SW + +N+LF+  P+GVGFSY+                     
Sbjct: 119  GPCRI-NSTLDSTINPHSWTEVSNVLFLSQPLGVGFSYSEAEPGSLNPFTGVFENASSAG 177

Query: 1254 -------XXXXXXXXDKFVAQDTYNFLVNWLERFPQ----FKGHDFFIAGESYAGHYVPQ 1108
                               A   +  L  ++   PQ     K  DF +  ESY GHY P 
Sbjct: 178  IQGRYPVIDATLIDTTDLAAHAAWEILQGFMGGLPQLDHRIKSKDFSLWTESYGGHYGPA 237

Query: 1107 LAEVVFDRNRD------RGIYPRINLKGFIVG----------NPE--TNDYYDYKGLLEY 982
                  ++N         GI+   N  G I G           PE   N+ Y  K + + 
Sbjct: 238  FFNYFHEQNEKIANGTVEGIHLNFNSLGIINGIIDEGIQASYYPEFAVNNTYGIKLVNDT 297

Query: 981  AWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSS 802
             +++   ++Q  +  ++   + ++  +++ + A   + ++   +   N+ GP        
Sbjct: 298  VYNYMKFANQMPNGCQDQIGYCKQ--TNRTSLADYAICSEATNMCRDNVEGP-------Y 348

Query: 801  SATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAP 622
             A G RGV D+   +K                DP    Y  +Y  +  V  A   NI   
Sbjct: 349  YAFGNRGVYDIRHPSK----------------DPTPESYYVDYLKKDWVMNAIGVNI--- 389

Query: 621  GSTVNWKTCSDPVFRAYKYTTFSLLPVY----EKLIKGGLKIWIYSGDADGRVPVIGSRY 454
                N+   ++ V+ A++ T   + P +    E+++K  +++ +  GDAD      G   
Sbjct: 390  ----NYTQSNNDVYYAFQQTGDFVWPNFLEDLEEILKLPVRVSLIYGDADYICNWFGGEA 445

Query: 453  CIEALKLPLKSPWRSWFHNHQV-----GGRIVEYHGLTFVTVRGAGHLVPLNKPSEALAL 289
               A+       +R+  +   V      G   EY   +F  V  AGH VP  +P  +L L
Sbjct: 446  VSLAVNYTHTEQFRAAGYTPMVVDGVEYGETREYGNFSFTRVYQAGHEVPYYQPVASLQL 505

Query: 288  IHSFLSGEEL 259
             +  L G ++
Sbjct: 506  FNRTLFGWDI 515



>gb:CR380953_1650668 Candida glabrata strain CBS138 chromosome G
            complete sequence.
          Length = 730

 Score =  115 bits (289), Expect = 2e-24
 Identities = 103/429 (24%), Positives = 183/429 (42%), Gaps = 21/429 (4%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNK--PLVLWLNGGPGCSSIGYGAAAELGPLRVK 1360
            ++G++   + +    F+W FE K    N   PL++WLNGGPGCSS+  GA  E+GP R+ 
Sbjct: 50   YAGHLPATRDNDTQYFFWKFENKKTKKNDETPLIIWLNGGPGCSSMA-GALMEIGPFRLN 108

Query: 1359 RNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE 1180
            +    +  N  SW+   ++LF++ PVG GFSY+          +  VA +   FL N+  
Sbjct: 109  KKAEVIK-NDGSWHMRGSVLFLDQPVGTGFSYSKEDNEVSELDE--VADNFMVFLQNYYA 165

Query: 1179 RFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRN-RDRGIYPRINLKGFIVGNPETNDYYD 1003
             FP  K  +  +AGESYAG ++P   + +   N + R    +IN+K   +GN   +    
Sbjct: 166  TFPDDKDRELILAGESYAGQFIPYFTKAIIKFNEQQRDENSKINIKVMFIGNGWLDPKRQ 225

Query: 1002 YKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPR 823
            Y   + ++    II  +  D A +  D  +++  + C   ++   T + E+     Y P 
Sbjct: 226  YLSYVPFSLEKGIIKKE--DPAFK--DILKQH--ETCQNYINSDHTGHSELS----YPPC 275

Query: 822  CLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP--GGYDPCYSPYAEEYFNRIDVQK 649
              + G         ++    T     Y +      P  G   P  + + +++     V  
Sbjct: 276  EAVLGK--------IISQDKTQCINVYKFDEYDSYPSCGLEWPVDTKFTKQFLTDKKVLA 327

Query: 648  AFHANIRAPGSTVNWKTCSDPVFRAYKYTTFSLLPVYE---KLIKGGLKIWIYSGDADGR 478
            A HAN        +W  C   V    K       P  E    L++ G+++ +++G+ D  
Sbjct: 328  ALHAN-----DERSWIECRPDV----KLENIKAKPAIELIPSLLESGIELILFNGNKDLI 378

Query: 477  VPVIGSRYCIEALKLPLKSPWR------SWFH-------NHQVGGRIVEYHGLTFVTVRG 337
               +G    ++ L+   ++ +        W +         +V G +     LT +T+  
Sbjct: 379  CNTLGIDNVLKHLQWEGETGFTDEVQIFDWVYRDDLKSDKEKVAGTVKYERQLTLITIED 438

Query: 336  AGHLVPLNK 310
              H+V  +K
Sbjct: 439  GSHMVSYDK 447



>gb:AE014297_1140378 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1140379 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE014297_1140380
            Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003728_1222371 Drosophila melanogaster
            chromosome 3R, section 66 of 118 of the complete
            sequence.>gb:AE003728_1222372 Drosophila melanogaster
            chromosome 3R, section 66 of 118 of the complete
            sequence.>gb:AE003728_1222373 Drosophila melanogaster
            chromosome 3R, section 66 of 118 of the complete
            sequence.>gb:AY052022_1290616 Drosophila melanogaster
            LD47549 full length cDNA.
          Length = 482

 Score =  114 bits (284), Expect = 8e-24
 Identities = 62/179 (34%), Positives = 96/179 (53%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+TV+      +F+W+F A+  P   P+VLWL GGPG SS+ +G   E GPL +  +
Sbjct: 87   YSGYLTVDPGFKSNMFFWYFPAEQEPEYAPVVLWLQGGPGASSL-FGLFTENGPLELDGH 145

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
            G  L    Y+W+K  NL+++++PVG GFS+T          +K V ++ +  ++   E F
Sbjct: 146  G-KLQKRNYTWSKTHNLIYIDNPVGTGFSFTE-NDAGYATNEKDVGRNLHEAVMQLYELF 203

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYK 997
                   F++ GESYAG YVP LA  +            + LKG  +GN  ++  +  K
Sbjct: 204  EWSNSSGFWVTGESYAGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLSDPLHQLK 262



>gb:AY290720_1595601 Triticum aestivum carboxypeptidase D mRNA,
           partial sequence.
          Length = 123

 Score =  112 bits (280), Expect = 2e-23
 Identities = 51/102 (50%), Positives = 69/102 (67%)
 Frame = -2

Query: 555 SLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNHQVGGRI 376
           S+LP+Y +LI  GL+IW++SGD D  VP+  +RY I AL LP  + W  W+ + +VGG  
Sbjct: 15  SMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWS 74

Query: 375 VEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEELPAQ 250
             Y GLT V+VRGAGH VPL++P +AL L   FL G+ +P Q
Sbjct: 75  QVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQ 116



>gb:AC098573_1736773 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1651_G11, complete
            sequence.>gb:AC134929_1741920 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone OSJNBb0035N21,
            complete sequence.
          Length = 451

 Score =  112 bits (279), Expect = 3e-23
 Identities = 122/490 (24%), Positives = 203/490 (41%), Gaps = 21/490 (4%)
 Frame = -2

Query: 1680 MAPPNRTFLLVGFLVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSH 1501
            MAPP+R F LV ++VI+V  + S++   A  +  +      P   L T  SGY+ +  + 
Sbjct: 1    MAPPSRPFYLV-YVVIFVAVSLSATAATATAAAVL------PRGALPTK-SGYLPIPPAA 52

Query: 1500 GRALFYWFFEAKSHPS---NKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNK 1330
              +L++ F+EA    +     PL++WL GGPGCS        ++GP      G  L  N 
Sbjct: 53   NASLYFAFYEATEPVTPLATTPLLVWLEGGPGCSGF-LSNFLQIGPYLFA--GGSLSPNP 109

Query: 1329 YSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDF 1150
            ++WN+   LLF++SP+G GFS               VA      L ++L   P F+    
Sbjct: 110  FAWNRRFGLLFIDSPLGTGFSVAPSPANIPTNQS-VVADHVLAALQSFLSLEPSFRARPL 168

Query: 1149 FIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSH 970
            ++ GESYAG  +P    ++   N       RINL+G  +GN  T+   +     + A+  
Sbjct: 169  YLTGESYAGKTIPAAGALIVATNPTLPEQKRINLRGVAIGNGMTHPVAEVTTHADIAYFM 228

Query: 969  AIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATG 790
             +I+ +Q   A+ +             +A ++  T+ E     +    R L++   +ATG
Sbjct: 229  GLINAKQKRAAEAM-------------QAEAVALTREERWREASAARAR-LMSWLENATG 274

Query: 789  IRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTV 610
            +  +LD+ +       A                    ++ +  +V+ A  A        V
Sbjct: 275  VVTLLDVEVQQSVAVMA----------------AGLADFLSTAEVKAAVGAR-----PDV 313

Query: 609  NWKTCSDPVFRAYKYTTF-SLLPVYEKLIKGG---------LKIWIYSGDAD-GRVPVIG 463
             W+ CS  V  A +     S     E L+  G          ++ +Y G  D G  PV  
Sbjct: 314  AWEACSAAVGAAQEEDVMKSAKRDVEALLHRGASPTATPTPTRVLLYEGIRDVGNGPVCA 373

Query: 462  SRYCIE-------ALKLPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPS 304
              +  E       A +   ++ WRS      + G +  +  L  V V GAGH VP ++  
Sbjct: 374  EAWLRELEWDGLAAFQDAGRAVWRS---GGGLAGYVQRHDALVHVAVYGAGHFVPYSQGR 430

Query: 303  EALALIHSFL 274
             A  +I  ++
Sbjct: 431  VAQEMIEDWV 440



>gb:AP002839_1823054 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0688A04.>gb:AP003220_1825466 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:OSJNBb0035I14.
          Length = 452

 Score =  110 bits (275), Expect = 9e-23
 Identities = 115/479 (24%), Positives = 198/479 (41%), Gaps = 23/479 (4%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAK- 1465
            +V+ +  A S+SP AA         P +         SGY+ V  ++  +L++ F+EA  
Sbjct: 16   IVLVLTAATSTSPAAAAARFPEEARPTR---------SGYLNVTSTN--SLYFAFYEATD 64

Query: 1464 ---SHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFV 1294
               + P+  PL++WL GGPGCSS+  G+ AELGP  +  +   L  N   WN+   ++F+
Sbjct: 65   PVTTQPAAVPLLVWLQGGPGCSSL-IGSFAELGPYLLLDSTSALARNDNRWNRRFGVIFI 123

Query: 1293 ESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYV 1114
            ++P+G GFS            ++ +A      L +++   P F+    F+ GESYAG Y+
Sbjct: 124  DNPLGAGFS-APASGDDIPTDERTIAAHLLAALQSFMALDPAFRARPLFLTGESYAGKYI 182

Query: 1113 PQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAK 934
            P  A  + D N       R+NL+G  +GN  T+         + A+   +I+ +Q  K +
Sbjct: 183  PAAASHILDANAKLTDDRRVNLQGIAIGNGMTHPVAQVTVHADQAYFAGLINAEQKAKVE 242

Query: 933  EVCDFT-----QENWSDKCNEAMSIV-FTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLD 772
            E+ D T      + W+    E   I+ F K                    +ATG+    +
Sbjct: 243  EMQDKTVSLIKSKKWAAARRERNRIIAFLK--------------------NATGVATPFN 282

Query: 771  LALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCS 592
             A   +E+ Y  R ++               ++ N  + + A  A      S V W  CS
Sbjct: 283  YA---REKGYPTRPLR---------------DFLNTGEAKAALGAR-----SDVEWARCS 319

Query: 591  DPVFRA-----YKYTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLP- 430
            + V  A      +     +  V+  L   G+++ ++ G  D           +  L  P 
Sbjct: 320  EAVSAALADDIMRSARGDVEAVF--LAPDGVRVLLFQGVFDLHSGPASVEAWVRELAWPG 377

Query: 429  -------LKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFL 274
                    ++ WR    + Q+ G +     L    + GAGH+   +    A A+I  ++
Sbjct: 378  LGAFLAAERAVWR--LGDEQLAGYVQRSGALANAVIVGAGHMAAGDNRPAAQAMIEGWV 434



>gb:AF095574_1767767 Pichia pastoris carboxypeptidase kex1 precursor
            (KEX1) gene, complete cds.
          Length = 623

 Score =  110 bits (275), Expect = 9e-23
 Identities = 112/430 (26%), Positives = 184/430 (42%), Gaps = 21/430 (4%)
 Frame = -2

Query: 1488 FYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEA 1309
            F+W F +K       +V WLNGGPGCSS+  GA  ELGP  +      + +N+ +W + A
Sbjct: 66   FFWRF-SKQDVDRADIVFWLNGGPGCSSMD-GALMELGPFVINPK-QEVEYNEGTWVEAA 122

Query: 1308 NLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESY 1129
            +++FV+ P G GFS T             VA     FL  +   FP      F + GESY
Sbjct: 123  DVVFVDQPGGTGFSSTTNYLTELTE----VADGFVTFLARYFHLFPADVYKKFTLGGESY 178

Query: 1128 AGHYVPQLAEVVF-DRNRDRGIYPR-INLKGFIVG------NPETNDYYDY---KGLLEY 982
            AG YVP + + +  D   D G  P+ + LKG ++G      N ++  Y ++   K L++ 
Sbjct: 179  AGQYVPYILKAIMDDLKSDSGQLPKELYLKGALIGNGWIDPNEQSLSYLEFFIKKELIDI 238

Query: 981  AWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSS 802
              S+     QQ +K + + + +    S+       I ++  E+I           LN + 
Sbjct: 239  HGSYMPGLLQQQEKCQNLINHSSGEASES-----QISYSACEKI-----------LNDAL 282

Query: 801  SAT-GIRGVLDLALTNKERTYAYRRMKRIP--GGYDPCYSPYAEEYFNRIDVQKAFHANI 631
              T   +  LD    N    Y Y      P  G   P Y P    +  +  V +A H + 
Sbjct: 283  RFTRDKKAPLDQQCIN---MYDYTLRDTYPSCGMSWPPYLPDVTAFLQKKSVLEALHLD- 338

Query: 630  RAPGSTVNWKTCSDPVFRAYK-YTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRY 454
                S+ +W  CS  V    K   +   + +   L++  + I +++GD D     IG+  
Sbjct: 339  ----SSASWSECSARVGSHLKNKISVPSVDILPDLLQ-EIPIILFNGDHDIICNCIGTER 393

Query: 453  CIEALK------LPLKSPWRSWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALA 292
             I+ L+          + +  WF+N    G+++    LT+V V  + H+VP +    +  
Sbjct: 394  MIDKLEFNGDQGFTEGTEYIPWFYNEVNVGKVISERNLTYVRVYNSSHMVPFDNTPVSRG 453

Query: 291  LIHSFLSGEE 262
            L+  +    E
Sbjct: 454  LLDIYFDNFE 463



>gb:AY190960_1308897 Drosophila pseudoobscura clone DPSF01_12_K22
            (D1411) genomic sequence.
          Length = 434

 Score =  110 bits (274), Expect = 1e-22
 Identities = 63/193 (32%), Positives = 102/193 (52%)
 Frame = -2

Query: 1533 FSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            +SGY+TV++     +F+W+F A+      P+VLWL GGPG SS+ +G   E GPL +  +
Sbjct: 88   YSGYLTVDKGFNSNMFFWYFPAEQDAVYAPVVLWLQGGPGASSL-FGLFTENGPLELDAH 146

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               L    Y+W+K  NL+++++PVG GFS+T+         +K V ++ +  ++   E F
Sbjct: 147  S-KLQKRNYTWSKTHNLIYIDNPVGTGFSFTD-KDEGYAKNEKDVGRNLHEAVMQLYELF 204

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
                   F++ GESYAG YVP LA  +            + LKG  +GN  ++  +  K 
Sbjct: 205  EWSNSSGFWVTGESYAGKYVPALAYHIHQVQNAIETRVYVPLKGVAIGNGLSDPLHQLK- 263

Query: 993  LLEYAWSHAIISD 955
              +Y +   +I D
Sbjct: 264  YGDYLYQLGLIDD 276



>gb:AE016920_357973 Chromobacterium violaceum ATCC 12472 section 11 of
            16 of the complete genome.>gb:AE016825_1043127
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 418

 Score =  109 bits (273), Expect = 2e-22
 Identities = 110/451 (24%), Positives = 193/451 (42%), Gaps = 9/451 (1%)
 Frame = -2

Query: 1590 ESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGC 1411
            ES  + +LPG   A   T  +GY++V  S G  L++ F EA  HP   PL++W+NG P  
Sbjct: 11   ESAALSHLPGF-GAVRSTQLAGYLSVGDSAGGWLYFCFSEAGDHPEQAPLLVWINGAPEW 69

Query: 1410 SSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXX 1231
            S++      E GP  +  +G  ++ N + W+   NLL +E P+G G S+T          
Sbjct: 70   SALD-ALLDEHGPYLLDPSG-RIYSNPFGWHHHVNLLIIEQPLGHGLSFTTHPRYLPESH 127

Query: 1230 DKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRIN 1051
            D+   Q  Y+ L  +L R+P+++  D ++ G + A H + +LA  V D N   G  P+I+
Sbjct: 128  DEASLQ-LYHALQEFLLRWPRYRERDCYLFGNAAATHTIARLAHRVLDGN--SGGQPQIS 184

Query: 1050 LKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIV 871
            LKG  +GN +          ++YA+ H +I+  + + A        +   D+ N A +  
Sbjct: 185  LKGLGLGNAQLAPDIQLPSHIDYAYQHRLINLDERNHA--------QAGLDEFNRAHASP 236

Query: 870  FTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYS 691
                ++             +    A GI   +            +   K          S
Sbjct: 237  IALQQQ-------------SAGRIAVGIERYIQQCCGRDLHDIRHPPQKP---------S 274

Query: 690  PYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFRA-YKYTTFSLLPVYEKLIKGGL 514
                EY  +  VQ+A H +   P S    +  S  +  A ++ ++  LLP    ++   L
Sbjct: 275  KALSEYLKKPSVQQALHID---PRSNNELQPHSSLMTEAIWQESSSHLLP----MLLDQL 327

Query: 513  KIWIYSGDADGRVPVIG--------SRYCIEALKLPLKSPWRSWFHNHQVGGRIVEYHGL 358
            K+  + G+       +G        S    +A +   +  WR +       G I  +  L
Sbjct: 328  KVLFFHGECCMTGNYLGLDAWFNTQSWSQADAFRRQKRQAWRPY---GLAAGLIRSHGNL 384

Query: 357  TFVTVRGAGHLVPLNKPSEALALIHSFLSGE 265
            + + ++ AG  V  ++P+ A A++  FL+G+
Sbjct: 385  SQIIIQNAGLRVARDQPAAAQAMLRDFLAGD 415



>gb:AY087352_1572384 Arabidopsis thaliana clone 34525 mRNA, complete
            sequence.
          Length = 223

 Score =  108 bits (270), Expect = 3e-22
 Identities = 67/191 (35%), Positives = 96/191 (50%), Gaps = 5/191 (2%)
 Frame = -2

Query: 1602 KAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNG 1423
            K A  S  I YLPG          +GYI V +     +FY+F +++S+P   PL+LWL+G
Sbjct: 19   KHADSSSIIKYLPGFEGPLPFELETGYIGVGEEDEDQMFYYFIKSESNPETDPLLLWLSG 78

Query: 1422 GPGCSSIGYGAAAELGPLRVKRNGVG-----LHFNKYSWNKEANLLFVESPVGVGFSYTN 1258
            GPGCSS   G   E GPL  K          L    YSW K AN+++++ PVG GFSY+ 
Sbjct: 79   GPGCSSF-TGLIYENGPLGFKVEAYNGSIPTLVSTTYSWTKVANIIYLDQPVGTGFSYSR 137

Query: 1257 XXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNR 1078
                         A+    FL  WL + P++  + F+  G SY+G  VP + + + + N 
Sbjct: 138  NPLADIPSDTG-SAKRVDEFLRKWLTKHPEYFSNPFYAGGNSYSGKMVPVIVQEISNGNC 196

Query: 1077 DRGIYPRINLK 1045
              G  P+I L+
Sbjct: 197  IYG-KPQIRLQ 206



>gb:BT016041_1358486 Drosophila melanogaster LP20617 full insert cDNA.
          Length = 438

 Score =  108 bits (270), Expect = 3e-22
 Identities = 119/466 (25%), Positives = 192/466 (41%), Gaps = 23/466 (4%)
 Frame = -2

Query: 1599 AAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSN---KPLVLWL 1429
            AA    K GY PG+          GY+ V    G  +FYW +   ++ S+   +PL +WL
Sbjct: 12   AALAHGKPGYGPGEQDW-------GYVDVRP--GAHMFYWLYYTTANVSSYTERPLAIWL 62

Query: 1428 NGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXX 1249
             GGPG SS GYG   ELGP+ +  +     +  ++W K+ N+LF+++PVG GFSY +   
Sbjct: 63   QGGPGASSTGYGNFEELGPVDLYGD-----WRSWTWVKDMNVLFIDNPVGSGFSYVD-NT 116

Query: 1248 XXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRDR 1072
                  +K +A D    +  +    P+F+     I  ESY G   P+ A E+ + + R  
Sbjct: 117  AFYTATNKEIALDLVELMKGFYTLHPEFEEVPLHIFCESYGGKMAPEFALELYYAKKRGE 176

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFT-----QEN 907
                + NL    +G+P T+          +     I+    Y+  +E  +FT     +E 
Sbjct: 177  ---VKSNLTSVALGDPWTSPIDSVLAWGPFLREMGIVDHAGYNAIQEAANFTAQLVEEER 233

Query: 906  W---SDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAY 736
            W   + +       V    + +D YN+              G       ALT++ER   Y
Sbjct: 234  WIQATYQWGNTQWEVMKASKGVDFYNVL---------KETKGGLYQRSKALTSEER--LY 282

Query: 735  RRMKRIPGGYDPCYSPYAEEYFNRI--DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYT 562
            R M +    YD       +E   ++  D+ +   A      S V W + S   F  ++  
Sbjct: 283  RTMVK----YD------IDEDRTKLLEDLMRGPVAETLGIPSNVIWGSQSGTTFDIHR-- 330

Query: 561  TFSLLPVY----EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNH 394
            T  + PV     E L K  LK+ ++SG  D      G+   I  L    K  + +   N 
Sbjct: 331  TDFMKPVIHIVNELLEKTPLKVGVFSGGLDLICATPGTVNWIAKLDWSRKDEYLAAPRNG 390

Query: 393  QVGGRIVEYH-----GLTFVTVRGAGHLVPLNKPSEALALIHSFLS 271
                RI+E +       T   +  +GH+ P + P+    ++  F S
Sbjct: 391  ITVDRILEGYQKTGGNFTMFWINRSGHMAPADNPAAMSHVLREFTS 436



>gb:AE014296_1134046 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003469_1211345 Drosophila melanogaster
            chromosome 3L, section 3 of 83 of the complete sequence.
          Length = 439

 Score =  108 bits (270), Expect = 3e-22
 Identities = 119/466 (25%), Positives = 192/466 (41%), Gaps = 23/466 (4%)
 Frame = -2

Query: 1599 AAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSN---KPLVLWL 1429
            AA    K GY PG+          GY+ V    G  +FYW +   ++ S+   +PL +WL
Sbjct: 13   AALAHGKPGYGPGEQDW-------GYVDVRP--GAHMFYWLYYTTANVSSYTERPLAIWL 63

Query: 1428 NGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXX 1249
             GGPG SS GYG   ELGP+ +  +     +  ++W K+ N+LF+++PVG GFSY +   
Sbjct: 64   QGGPGASSTGYGNFEELGPVDLYGD-----WRSWTWVKDMNVLFIDNPVGSGFSYVD-NT 117

Query: 1248 XXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLA-EVVFDRNRDR 1072
                  +K +A D    +  +    P+F+     I  ESY G   P+ A E+ + + R  
Sbjct: 118  AFYTATNKEIALDLVELMKGFYTLHPEFEEVPLHIFCESYGGKMAPEFALELYYAKKRGE 177

Query: 1071 GIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVCDFT-----QEN 907
                + NL    +G+P T+          +     I+    Y+  +E  +FT     +E 
Sbjct: 178  ---VKSNLTSVALGDPWTSPIDSVLAWGPFLREMGIVDHAGYNAIQEAANFTAQLVEEER 234

Query: 906  W---SDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTNKERTYAY 736
            W   + +       V    + +D YN+              G       ALT++ER   Y
Sbjct: 235  WIQATYQWGNTQWEVMKASKGVDFYNVL---------KETKGGLYQRSKALTSEER--LY 283

Query: 735  RRMKRIPGGYDPCYSPYAEEYFNRI--DVQKAFHANIRAPGSTVNWKTCSDPVFRAYKYT 562
            R M +    YD       +E   ++  D+ +   A      S V W + S   F  ++  
Sbjct: 284  RTMVK----YD------IDEDRTKLLEDLMRGPVAETLGIPSNVIWGSQSGTTFDIHR-- 331

Query: 561  TFSLLPVY----EKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSPWRSWFHNH 394
            T  + PV     E L K  LK+ ++SG  D      G+   I  L    K  + +   N 
Sbjct: 332  TDFMKPVIHIVNELLEKTPLKVGVFSGGLDLICATPGTVNWIAKLDWSRKDEYLAAPRNG 391

Query: 393  QVGGRIVEYH-----GLTFVTVRGAGHLVPLNKPSEALALIHSFLS 271
                RI+E +       T   +  +GH+ P + P+    ++  F S
Sbjct: 392  ITVDRILEGYQKTGGNFTMFWINRSGHMAPADNPAAMSHVLREFTS 437



>gb:AC098573_1736772 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1651_G11, complete
            sequence.>gb:AC134929_1741921 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone OSJNBb0035N21,
            complete sequence.
          Length = 446

 Score =  108 bits (269), Expect = 4e-22
 Identities = 117/479 (24%), Positives = 192/479 (40%), Gaps = 18/479 (3%)
 Frame = -2

Query: 1641 LVIWVLCAESSSPKAAQESDKIGYLPGQPSAPLLTHFSGYITVNQSHGRALFYWFFEAK- 1465
            LV  VL A S S  AA     +      P   + T  SGY+ +  ++  +L++ F+EA  
Sbjct: 11   LVFVVLAAVSLSASAAAAPASV-----LPRGAIPTK-SGYLPIPPANA-SLYFAFYEATE 63

Query: 1464 --SHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVE 1291
              + P+  PL++WL GGPGCS        ++GP  +   G  L  N ++WN+   LLF++
Sbjct: 64   PVTPPATTPLLVWLEGGPGCSGF-LSNFLQIGPYLLA--GGSLSPNPFAWNRRFGLLFID 120

Query: 1290 SPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIAGESYAGHYVP 1111
            SP+G GFS               VA      L +     P F+    ++ GESYAG  +P
Sbjct: 121  SPLGTGFSVAPSPAAIPTNQS-VVADHVLAALQSLYSLEPSFRARPLYLTGESYAGKTIP 179

Query: 1110 QLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAIISDQQYD---- 943
                ++   N       RINL+G  +GN  T+         + A+   +I+ +Q      
Sbjct: 180  AAGALIVATNPTLPEKKRINLRGVAIGNGMTHPVTQVTTHADIAYFMGLINGKQKREVEA 239

Query: 942  -KAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLA 766
             +A+ V     E WS+                          LL    +A+G+  + D+ 
Sbjct: 240  MQARAVELIKAERWSEA-------------------YVAREGLLKWMENASGVPSLFDVE 280

Query: 765  LTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDP 586
            +T      A               +P      N  + + A  A          WK CS  
Sbjct: 281  VTTSLEAEA------------AALAP----LLNGAEAKAALGAR-----GDAEWKMCSAA 319

Query: 585  VFRA-YKYTTFSLLPVYEKLIKGG---LKIWIYSGDADGRVPVIGSRYCIEALKLPLKSP 418
            V  A +K    S+ P  E L++ G    ++ +Y G  D +   + +   +  L+    + 
Sbjct: 320  VGAAQHKDVMKSVKPEVEALLRRGTTPTRVLLYGGIRDVKDGPVSTEAWVRELEWDGLAA 379

Query: 417  WRS-----WFH-NHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSGEEL 259
            ++      W H   ++ G +  +  L  V V GAGH VP ++   A  +I  ++ G+ L
Sbjct: 380  FQDADRAVWRHRGGELAGSVQRHGALVNVAVYGAGHFVPFSQGRAAQEMIEDWVFGKGL 438



>gb:AF394242_1795427 Aspergillus oryzae strain TK3 carboxypeptidase S1
            (cpI) gene, complete cds.
          Length = 555

 Score =  107 bits (268), Expect = 6e-22
 Identities = 116/490 (23%), Positives = 196/490 (40%), Gaps = 58/490 (11%)
 Frame = -2

Query: 1554 SAPLLTHFSGYI-TVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAEL 1378
            + P +  +SGY+ T  +SH    F+WFFEA+ +P   P+ LWLNGGPG  S+  G   EL
Sbjct: 63   TTPGVKSYSGYVDTSPESH---TFFWFFEARHNPETAPITLWLNGGPGSDSL-IGLFEEL 118

Query: 1377 GPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTN-------------------- 1258
            GP  V  +    + N +SWN+ +NLLF+  P+GVGFSY +                    
Sbjct: 119  GPCHV-NSTFDDYINPHSWNEVSNLLFLSQPLGVGFSYNDTVDGSINPVTGVVENSSFAG 177

Query: 1257 ------XXXXXXXXXDKFVAQDTYNFLVNWLERFP----QFKGHDFFIAGESYAGHYVPQ 1108
                               A+  +  L  +L   P    + +  DF +  ESY GHY P 
Sbjct: 178  VQGRYPTIDATLIDTTNLAAEAAWEILQGFLSGLPSLDSRVQSKDFSLWTESYGGHYGPA 237

Query: 1107 LAEVVFDRNRD------RGIYPRINLKGFIVG----------NPE--TNDYYDYKGLLEY 982
                 +++N         G+    N  G I G           PE   N+ Y  K + E 
Sbjct: 238  FFNHFYEQNERIANGSVNGVQLNFNSLGIINGIIDEAIQAPYYPEFAVNNTYGIKAVNET 297

Query: 981  AWSHAIISDQQYDKAKEVCDFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSS 802
             +++   ++Q  +  +++    ++  +++   A   +  +   +   N+ GP     G  
Sbjct: 298  VYNYMKFANQMPNGCQDLISTCKQ--TNRTALADYALCAEATNMCRDNVEGPYYAFAG-- 353

Query: 801  SATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAP 622
                 RGV D+                      P   P    Y+N+     A  + + A 
Sbjct: 354  -----RGVYDIR--------------------HPYDDPTPPSYYNKF---LAKDSVMDAI 385

Query: 621  GSTVNWKTCSDPVFRAYKYTTFSLLPVY----EKLIKGGLKIWIYSGDADGRVPVIGSRY 454
            G  +N+   ++ V+ A++ T   + P +    E+++   +++ +  GDAD      G + 
Sbjct: 386  GVNINYTQSNNDVYYAFQQTGDFVWPNFIEDLEEILALPVRVSLIYGDADYICNWFGGQA 445

Query: 453  CIEALKLPLKSPWRSWFH-----NHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALAL 289
               A      + +RS  +     N    G   EY   +F  V  AGH VP  +P  +L L
Sbjct: 446  VSLAANYSQAAQFRSAGYTPLKVNGVEYGETREYGNFSFTRVYEAGHEVPYYQPIASLQL 505

Query: 288  IHSFLSGEEL 259
             +  + G ++
Sbjct: 506  FNRTIFGWDI 515



>gb:AY497022_1609148 Trichophyton rubrum carboxypeptidase S1 gene,
            complete cds.
          Length = 662

 Score =  106 bits (265), Expect = 1e-21
 Identities = 116/485 (23%), Positives = 184/485 (37%), Gaps = 66/485 (13%)
 Frame = -2

Query: 1515 VNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHF 1336
            V Q +    F+WFFEA+  P N PL +W+NGGPG SS+ +G   E GP  V  +      
Sbjct: 76   VEQDYPINTFFWFFEARKDPENAPLGIWMNGGPGSSSM-FGMMTENGPCFVNADSNSTRL 134

Query: 1335 NKYSWNKEANLLFVESPVGVGFS------------------------------------Y 1264
            N +SWN E N+L+++ PV VG S                                    Y
Sbjct: 135  NPHSWNNEVNMLYIDQPVQVGLSYDTLANFTRNLVTDEITKLKPGEPIPEQNATFLVGTY 194

Query: 1263 TNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQF--KGHDFFIAGESYAGHYVPQLAEVVF 1090
             +          +  A   ++F   W + FP +  + +   IA ESY G Y P       
Sbjct: 195  ASRNMNTTAHGTRHAAMALWHFAQVWFQEFPGYHPRNNKISIATESYGGRYGPAFTAFFE 254

Query: 1089 DRNR---------DRGIYPRINLKGFIVGNPETNDYYDYKGLLEYAWSHAI-ISDQQYDK 940
            ++N+           G    ++L   ++ N   +    +    + A+++   I       
Sbjct: 255  EQNQKIKNGTWKGHEGTMHVLHLDTLMIVNGCIDRLVQWPAYPQMAYNNTYSIEAVNASI 314

Query: 939  AKEVCD--FTQENWSDKCN--EAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLD 772
               + D  +      DK N   ++S VF   E + I +     C    +  +  +R   D
Sbjct: 315  HAGMLDALYRDGGCRDKINHCRSLSSVFDP-ENLGINSTVNDVCKDAETFCSNDVR---D 370

Query: 771  LALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCS 592
              L    R Y Y   +  P    P  +P+   + N+  VQ A        G  +NW   +
Sbjct: 371  PYLKFSGRNY-YDIGQLDP---SPFPAPFYMAWLNQPHVQAAL-------GVPLNWTQSN 419

Query: 591  DPVFRAYK----YTTFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLK 424
            D V  A++    Y     L     L++ G+K+ +  GD D      G     E   L + 
Sbjct: 420  DVVSTAFRAIGDYPRPGWLENLAYLLENGIKVSLVYGDRDYACNWFGG----ELSSLGIN 475

Query: 423  SPWRSWFHN----------HQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFL 274
                  FHN            +GG++ +Y  L+F  V  AGH VP  +P  AL + H  L
Sbjct: 476  YTDTHEFHNAGYAGIQINSSYIGGQVRQYGNLSFARVYEAGHEVPSYQPETALQIFHRSL 535

Query: 273  SGEEL 259
              +++
Sbjct: 536  FNKDI 540



>gb:BC004847_2089835 Mus musculus serine carboxypeptidase 1, mRNA
            (cDNA clone MGC:6852 IMAGE:2650587), complete
            cds.>gb:BC021399_2093426 Mus musculus serine
            carboxypeptidase 1, mRNA (cDNA clone MGC:29291
            IMAGE:4193674), complete cds.
          Length = 452

 Score =  105 bits (261), Expect = 4e-21
 Identities = 104/433 (24%), Positives = 185/433 (42%), Gaps = 20/433 (4%)
 Frame = -2

Query: 1524 YITVNQSHGRALFYWFFEAKSHPSN---KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            Y+TV +     +F+W + A +   N    PLV+WL GGPG SS G+G   E+GPL  +  
Sbjct: 42   YVTVRKD--AHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQ-- 97

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               L     +W + A+LLFV++PVG GFSY N         D  VA D    L ++ +  
Sbjct: 98   ---LKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDT-VASDMMVLLKSFFDCH 153

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
             +F+   F+I  ESY G     ++  ++   +   I  + N  G  +G+   +       
Sbjct: 154  KEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTI--KCNFSGVALGDSWISPVDSVLS 211

Query: 993  LLEYAWSHAIISDQQY----DKAKEVCDFTQENWSDKCNE----AMSIVFTKYEEIDIYN 838
               Y +S +++ +Q      D A++V D   + +  +  +    A  I+    + ++ YN
Sbjct: 212  WGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYN 271

Query: 837  IYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRID 658
            I      L  SS    +   L+   +   R    R ++ + G         A        
Sbjct: 272  I------LTKSSPEKAMESSLEFLRSPLVR-LCQRHVRHLQGD--------ALSQLMNGP 316

Query: 657  VQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS-LLPVYEKLIKGGLKIWIYSGDADG 481
            ++K     ++     ++W   +  VF + +       + V +KL+  G+ + +Y+G  D 
Sbjct: 317  IKK----KLKIIPEDISWGAQASYVFLSMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDL 372

Query: 480  RVPVIGSRYCIEALKLPLKS-----PWRSWF---HNHQVGGRIVEYHGLTFVTVRGAGHL 325
             V  IG    ++ LK P  S      W++ +    + +    +  Y  L F  +  AGH+
Sbjct: 373  IVDTIGQESWVQKLKWPQLSKFNQLKWKALYTDPKSSETAAFVKSYENLAFYWILKAGHM 432

Query: 324  VPLNKPSEALALI 286
            VP ++   AL ++
Sbjct: 433  VPSDQGEMALKMM 445



>gb:AK014680_1158089 Mus musculus 0 day neonate head cDNA, RIKEN
            full-length enriched library, clone:4833411K15
            product:retinoid-inducible serine caroboxypetidase, full
            insert sequence.>gb:AK050181_1169159 Mus musculus adult
            male liver tumor cDNA, RIKEN full-length enriched
            library, clone:C730025I09 product:retinoid-inducible
            serine caroboxypetidase, full insert
            sequence.>gb:AL646096_2072168 Mouse DNA sequence from
            clone RP23-176J13 on chromosome 11 Contains the 5' end of
            the Scpep1 gene for serine carboxypeptidase 1, two
            transcription elongation factor B (SIII) polypeptide 2
            (Tceb2) pseudogenes, four novel genes (incl.
            A930013B10Rik), the Coil gene for coilin, the Trim25 gene
            for tripartite motif protein 25 and the Dgke gene for
            diacylglycerol kinase epsilon, complete
            sequence.>gb:AL929426_2073172 Mouse DNA sequence from
            clone RP23-471H23 on chromosome 11 Contains the 3' end of
            the Scpep1 gene for serine carboxypeptidase 1, complete
            sequence.
          Length = 452

 Score =  105 bits (261), Expect = 4e-21
 Identities = 104/433 (24%), Positives = 185/433 (42%), Gaps = 20/433 (4%)
 Frame = -2

Query: 1524 YITVNQSHGRALFYWFFEAKSHPSN---KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            Y+TV +     +F+W + A +   N    PLV+WL GGPG SS G+G   E+GPL  +  
Sbjct: 42   YVTVRKD--AHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQ-- 97

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               L     +W + A+LLFV++PVG GFSY N         D  VA D    L ++ +  
Sbjct: 98   ---LKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDT-VASDMMVLLKSFFDCH 153

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
             +F+   F+I  ESY G     ++  ++   +   I  + N  G  +G+   +       
Sbjct: 154  KEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTI--KCNFSGVALGDSWISPVDSVLS 211

Query: 993  LLEYAWSHAIISDQQY----DKAKEVCDFTQENWSDKCNE----AMSIVFTKYEEIDIYN 838
               Y +S +++ +Q      D A++V D   + +  +  +    A  I+    + ++ YN
Sbjct: 212  WGPYLYSMSLLDNQGLAEVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYN 271

Query: 837  IYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRID 658
            I      L  SS    +   L+   +   R    R ++ + G         A        
Sbjct: 272  I------LTKSSPEKAMESSLEFLRSPLVR-LCQRHVRHLQGD--------ALSQLMNGP 316

Query: 657  VQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS-LLPVYEKLIKGGLKIWIYSGDADG 481
            ++K     ++     ++W   +  VF + +       + V +KL+  G+ + +Y+G  D 
Sbjct: 317  IKK----KLKIIPEDISWGAQASYVFLSMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDL 372

Query: 480  RVPVIGSRYCIEALKLPLKS-----PWRSWF---HNHQVGGRIVEYHGLTFVTVRGAGHL 325
             V  IG    ++ LK P  S      W++ +    + +    +  Y  L F  +  AGH+
Sbjct: 373  IVDTIGQESWVQKLKWPQLSKFNQLKWKALYTDPKSSETAAFVKSYENLAFYWILKAGHM 432

Query: 324  VPLNKPSEALALI 286
            VP ++   AL ++
Sbjct: 433  VPSDQGEMALKMM 445



>sp|Q920A5|RISC_MOUSE Retinoid-inducible serine carboxypeptidase
            precursor (EC 3.4.16.-).>gb:AF330052_2063377 Mus musculus
            retinoid-inducible serine carboxypeptidase precursor
            (Risc) mRNA, complete cds.
          Length = 452

 Score =  105 bits (261), Expect = 4e-21
 Identities = 104/433 (24%), Positives = 185/433 (42%), Gaps = 20/433 (4%)
 Frame = -2

Query: 1524 YITVNQSHGRALFYWFFEAKSHPSN---KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            Y+TV +     +F+W + A +   N    PLV+WL GGPG SS G+G   E+GPL  +  
Sbjct: 42   YVTVRKD--AHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQ-- 97

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               L     +W + A+LLFV++PVG GFSY N         D  VA D    L ++ +  
Sbjct: 98   ---LKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDT-VASDMMVLLKSFFDCH 153

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
             +F+   F+I  ESY G     ++  ++   +   I  + N  G  +G+   +       
Sbjct: 154  KEFQTVPFYIFSESYGGKMAAGISVELYKAVQQGTI--KCNFSGVALGDSWISPVDSVLS 211

Query: 993  LLEYAWSHAIISDQQY----DKAKEVCDFTQENWSDKCNE----AMSIVFTKYEEIDIYN 838
               Y +S +++ +Q      D A++V D   + +  +  +    A  I+    + ++ YN
Sbjct: 212  WGPYLYSMSLLDNQGLAMVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYN 271

Query: 837  IYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRID 658
            I      L  SS    +   L+   +   R    R ++ + G         A        
Sbjct: 272  I------LTKSSPEKAMESSLEFLRSPLVR-LCQRHVRHLQGD--------ALSQLMNGP 316

Query: 657  VQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS-LLPVYEKLIKGGLKIWIYSGDADG 481
            ++K     ++     ++W   +  VF + +       + V +KL+  G+ + +Y+G  D 
Sbjct: 317  IKK----KLKIIPEDISWGAQASYVFLSMEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDL 372

Query: 480  RVPVIGSRYCIEALKLPLKS-----PWRSWF---HNHQVGGRIVEYHGLTFVTVRGAGHL 325
             V  IG    ++ LK P  S      W++ +    + +    +  Y  L F  +  AGH+
Sbjct: 373  IVDTIGQESWVQKLKWPQLSKFNQLKWKALYTDPKSSETAAFVKSYENLAFYWILKAGHM 432

Query: 324  VPLNKPSEALALI 286
            VP ++   AL ++
Sbjct: 433  VPSDQGEMALKMM 445



>gb:NCB11H7_1689053 Neurospora crassa DNA linkage group V BAC clone
            B11H7.
          Length = 577

 Score =  104 bits (259), Expect = 6e-21
 Identities = 127/465 (27%), Positives = 187/465 (40%), Gaps = 53/465 (11%)
 Frame = -2

Query: 1533 FSGYITVNQS--HGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAAELGPLRVK 1360
            ++G + ++Q       LF+WFF + +  + K +++WLNGGPGCSS+  G   E GP   +
Sbjct: 89   YAGTLPISQDPEEKSELFWWFFPSTNPAAKKEILIWLNGGPGCSSL-EGFLQENGPFLWQ 147

Query: 1359 RNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLE 1180
                    N +SW+   N+++VE PVG GFS  N         ++ VA     F  N+++
Sbjct: 148  YGTYKPVKNPWSWHTLTNVIWVEQPVGTGFSTGN----VTATSEEDVAAQFMGFWKNFID 203

Query: 1179 RFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDY 1000
             F   +G+  +I GESYAG Y P +A    D N                       YYD 
Sbjct: 204  TF-AMQGYKVYITGESYAGLYCPYIASAFLDAN--------------------DKTYYDM 242

Query: 999  KGLLEYAWSHAIISDQQYDKAKEVCDFTQENWS------DKCNEAMSIVFTK--YEE-ID 847
             GL+ Y     +IS  +  +   V  FT E WS      D   E +  V  K  Y + + 
Sbjct: 243  SGLMIY---DPVISWDEVAEQVPVVQFT-EYWSGLFPFNDTFREHIKSVDAKCGYSDFVS 298

Query: 846  IYNIYGPRCLLNGSSSATGIRG------------VLDLALTNKERTYAYRRMKRIPGGYD 703
             Y +Y P+ L       T   G            + D  L        Y+     P  +D
Sbjct: 299  QYLVYPPKGLQPSKLPGTDKTGTTRDECWGLFYEIFDAILLLNPCFNIYQVATTCPLLWD 358

Query: 702  PCYSP--------YAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDP-VF----RAYKYT 562
                P         A+ YF+R DV+KA HA        V W +CS+  VF       + +
Sbjct: 359  VLGFPGSMGYLPEGAKVYFDRDDVKKAVHA-----PENVKWSSCSEQNVFVGGRDRSEPS 413

Query: 561  TFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEAL----KL--------PLKSP 418
            +F  LP    +I     + I  G  D  +   G+   I+ +    KL        P   P
Sbjct: 414  SFHALP---HVIDATKNVIIGHGALDMVLIANGTLLGIQNMTWGGKLGFQNKPDQPFYVP 470

Query: 417  WR-----SWFHNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEA 298
            +      S      V G +    GLT+V +  +GH+VP   PS A
Sbjct: 471  YNTMSDLSTLAAGGVFGSMGSERGLTWVQIDMSGHMVPQYAPSAA 515



>gb:AY433801_1605990 Aspergillus fumigatus carboxypeptidase 1 gene,
            complete cds.
          Length = 613

 Score =  102 bits (254), Expect = 2e-20
 Identities = 125/543 (23%), Positives = 197/543 (36%), Gaps = 98/543 (18%)
 Frame = -2

Query: 1593 QESDKIGYL-PGQ-PSAPLLTHFSGYI----------TVNQSHGRALFYWFFEAKSHPSN 1450
            QE  KI Y  PG   + P +  +SGY+           V+Q +    F+ FFE+++ P +
Sbjct: 38   QEGVKISYKEPGICETTPGVKSYSGYVHLPPGTLNDVDVDQQYPINTFFCFFESRNDPIH 97

Query: 1449 KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGF 1270
             PL +W+NGGPG SS+  G   E GP  V  +      N +SWN   N+L+++ P  VGF
Sbjct: 98   APLAIWMNGGPGSSSM-IGLLQENGPCLVNADSNSTEINPWSWNNYVNMLYIDQPNQVGF 156

Query: 1269 SY---TNXX----------------------------------XXXXXXXDKFVAQDTYN 1201
            SY   TN                                            +  A+  ++
Sbjct: 157  SYDVPTNGTYNQLTTAWNVSAFPDGKVPEQNNTFYVGTFPSMNRTATANTTQNAARSLWH 216

Query: 1200 FLVNWLERFPQFKGHD--FFIAGESYAGHYVPQLAEVVFDRNR--------DRGIYPRIN 1051
            F   W   FP++K HD    I  ESY G Y P  A    ++N         D   Y  ++
Sbjct: 217  FAQTWFSEFPEYKPHDDRVSIWTESYGGRYGPSFAAFFQEQNEKIEEGALPDEYHYIHLD 276

Query: 1050 LKGFIVG------------NPETNDYYDYKGLLEYAWSHAIISDQQYDKAKEVC------ 925
              G I G            +   N+ Y  + + +  +  A+ +  +    K++       
Sbjct: 277  TLGIINGCVDLLTQAPFYPDMAYNNTYGIEAINKTVYERAMNAWSKPGGCKDLIVKCREL 336

Query: 924  ----DFTQENWSDKCNEAMSIVFTKYEEIDIYNIYGPRCLLNGSSSATGIRGVLDLALTN 757
                D T    ++  NEA      +  +     + GP  L +        RG  D+A  +
Sbjct: 337  AAEGDPTMSGHNETVNEAC----RRANDYCSNQVEGPYILFSK-------RGYYDIAHFD 385

Query: 756  KERTYAYRRMKRIPGGYDPCYSPYAEEYFNRIDVQKAFHANIRAPGSTVNWKTCSDPVFR 577
                             DP   PY + + N+  VQ A        G  VN+    D  + 
Sbjct: 386  P----------------DPFPPPYFQGFLNQNWVQAAL-------GVPVNFSISVDSTYS 422

Query: 576  AYKYT-------TFSLLPVYEKLIKGGLKIWIYSGDADGRVPVIGSRYCIEALKLPLKSP 418
            A+  T           L     ++  G+K+ +  GD D   P  G     E + L +   
Sbjct: 423  AFASTGDYPRADVHGYLEDLAYVLDSGIKVALVYGDRDYACPWNGG----EEVSLRVNYS 478

Query: 417  WRSWF----------HNHQVGGRIVEYHGLTFVTVRGAGHLVPLNKPSEALALIHSFLSG 268
                F          ++  +GGR+ +Y   +F  V  AGH VP  +P  A  + H  L  
Sbjct: 479  DSQSFQKAGYAPVQTNSSYIGGRVRQYGNFSFTRVFEAGHEVPAYQPQTAYEIFHRALFN 538

Query: 267  EEL 259
             ++
Sbjct: 539  RDI 541



>sp|Q920A6|RISC_RAT Retinoid-inducible serine carboxypeptidase
            precursor (EC 3.4.16.-).>gb:AF330051_2063376 Rattus
            norvegicus retinoid-inducible serine carboxypeptidase
            precursor (Risc) mRNA, complete cds.
          Length = 452

 Score =  102 bits (254), Expect = 2e-20
 Identities = 103/433 (23%), Positives = 186/433 (42%), Gaps = 20/433 (4%)
 Frame = -2

Query: 1524 YITVNQSHGRALFYWFFEAKSHPSN---KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRN 1354
            Y+TV +     +F+W + A +   N    PLV+WL GGPG SS G+G   E+GPL  +  
Sbjct: 42   YVTVRED--ARMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTR-- 97

Query: 1353 GVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERF 1174
               L     +W + A+LLFV++PVG GFSY N         D  VA D    L ++ +  
Sbjct: 98   ---LKPRNTTWLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDT-VASDMMVLLKSFFDCH 153

Query: 1173 PQFKGHDFFIAGESYAGHYVPQLAEVVFDRNRDRGIYPRINLKGFIVGNPETNDYYDYKG 994
             +F+   F+I  ESY G     ++  +    +   I  + N  G  +G+   +       
Sbjct: 154  KEFQTVPFYIFSESYGGKMAAGISLELHKAIQQGTI--KCNFSGVALGDSWISPVDSVLS 211

Query: 993  LLEYAWSHAIISD----QQYDKAKEVCDFTQENWSDKCNE----AMSIVFTKYEEIDIYN 838
               Y +S +++ +    +  D A++V +   + +  +  +    A  I+    + ++ YN
Sbjct: 212  WGPYLYSVSLLDNKGLAEVSDIAEQVLNAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYN 271

Query: 837  IYGPRCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIPGGYDPCYSPYAEEYFNRID 658
            I      L  S+  T +   L+   +   R    R ++ + G         A        
Sbjct: 272  I------LTKSTPDTSMESSLEFFRSPLVR-LCQRHVRHLQGD--------ALSQLMNGP 316

Query: 657  VQKAFHANIRAPGSTVNWKTCSDPVFRAYKYTTFS-LLPVYEKLIKGGLKIWIYSGDADG 481
            ++K     ++     V+W   S  VF + +      ++ + + L++ G+ + +Y+G  D 
Sbjct: 317  IKK----KLKIIPDDVSWGAQSSSVFISMEEDFMKPVIDIVDTLLELGVNVTVYNGQLDL 372

Query: 480  RVPVIGSRYCIEALKLPLKS-----PWRSWFHN---HQVGGRIVEYHGLTFVTVRGAGHL 325
             V  IG    ++ LK P  S      W++ + N    +    +  Y  L F  +  AGH+
Sbjct: 373  IVDTIGQESWVQKLKWPQLSRFNQLKWKALYTNPKSSETSAFVKSYENLAFYWILKAGHM 432

Query: 324  VPLNKPSEALALI 286
            VP ++   AL ++
Sbjct: 433  VPADQGDMALKMM 445



>gb:CR382126_1658799 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 642

 Score =  102 bits (253), Expect = 3e-20
 Identities = 108/444 (24%), Positives = 180/444 (40%), Gaps = 34/444 (7%)
 Frame = -2

Query: 1488 FYWFFEAKSHPSN----KPLVLWLNGGPGCSSIGYGAAAELGPLRVKRNGVGLHFNKYSW 1321
            F+W F   ++ ++    K L++WLNGGPGCSS+  GA  E G LR+  +G   + N  SW
Sbjct: 71   FFWKFHDLANQTSVVASKTLIIWLNGGPGCSSLD-GALMESGALRIDDDGEA-YLNPGSW 128

Query: 1320 NKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTYNFLVNWLERFPQFKGHDFFIA 1141
            +   +++FV+ P G GFS               V++    FL N+ + FP     D  +A
Sbjct: 129  HTRGDIVFVDQPAGTGFSTVGDSKYDKDLNQ--VSKHFMKFLKNYFKIFPDDLDKDLVLA 186

Query: 1140 GESYAGHYVPQLAEVVF---------DRNRDRGIYPRINLKGFIVGNPETNDYYDYKGLL 988
            GESYAG Y+P  A  +          D   +     + NLK  ++GN   +        +
Sbjct: 187  GESYAGQYIPFFANEILKFNSKLDKDDNEEESRSGKKYNLKSLLIGNGWIDPDQQSLSYI 246

Query: 987  EYAWSHAIISDQQYDKAKEVCDFTQENWSDKC------NEAMSIVFTKYEEIDIYNIYGP 826
             +A  + +IS     KA    D    N   +C      N      F + E+I    +Y  
Sbjct: 247  PFALENNLIS----TKADYFPDLL--NMHSRCQNLVNNNGGKKFSFDECEDILTKILYYT 300

Query: 825  RCLLNGSSSATGIRGVLDLALTNKERTYAYRRMKRIP--GGYDPCYSPYAEEYFNRIDVQ 652
            R      +   G +   +   TN    Y +R     P  G   P   P   ++  +  V 
Sbjct: 301  R----RKTDENGNKVPSNQECTN---IYDFRLFDSYPACGSNWPDDLPSVSKFLGKPGVM 353

Query: 651  KAFHANIRAPGSTVNWKTCSDPVFRAYK-YTTFSLLPVYEKLIKGGLKIWIYSGDADGRV 475
             + H ++       +W+ C   V    K   T   + +   L+K  ++I++++GD D   
Sbjct: 354  DSLHLDV---DKVPHWRECDSKVSSHLKNKNTQPSIHLLPNLLK-HMQIFLFNGDKDIIC 409

Query: 474  PVIGSRYCIEALK------LPLKSPWRSWFHNHQV------GGRIVEYHGLTFVTVRGAG 331
               G +  I+ +K          + +  W +  Q        G +     LT+V+V  A 
Sbjct: 410  NSRGVQDLIKNMKWNNHTGFTNDAEYYDWQYYDQFTDDTISAGFVKHESNLTYVSVYNAS 469

Query: 330  HLVPLNKPSEALALIHSFLSGEEL 259
            H+VP +    +  ++  +L   EL
Sbjct: 470  HMVPYDNALISRGIMDIYLKDVEL 493



>gb:AB005243_1509543 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MRN17.
          Length = 190

 Score =  101 bits (252), Expect = 4e-20
 Identities = 63/174 (36%), Positives = 92/174 (52%), Gaps = 1/174 (0%)
 Frame = -2

Query: 1563 GQPSAPLLTHFSGYITVNQSHGRALFYWFFEAKSHPSNKPLVLWLNGGPGCSSIGYGAAA 1384
            G PS   L   +GY ++ +S    LF++FF+++++ S+ P+V+WL+GGPGCSS       
Sbjct: 25   GDPSVKDLGQHAGYFSLPRSKSARLFHFFFQSRNNSSD-PVVIWLSGGPGCSSSNQ---- 79

Query: 1383 ELGPLRVKRNGVGLHFNKYSWNKEANLLFVESPVGVGFSYTNXXXXXXXXXDKFVAQDTY 1204
                               S+ K +NL++V+ P+  GFSY N         D  V+ D Y
Sbjct: 80   ----------------RYISYLKISNLIYVDQPIRTGFSYANDSTDLRHDEDS-VSNDLY 122

Query: 1203 NFLVNWLERFPQFKGHDFFIAGESYAGHYVPQLAEVVFDRN-RDRGIYPRINLK 1045
            +FL  + +  P     DF+I GESYAGHY+P LA  V + N +  GI   INLK
Sbjct: 123  DFLQAFFKEHPNLAKDDFYITGESYAGHYIPALASRVHNGNEKKEGIV--INLK 174


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,965,300,736
Number of Sequences: 1806583
Number of extensions: 46713013
Number of successful extensions: 117857
Number of sequences better than 10.0: 326
Number of HSP's better than 10.0 without gapping: 108344
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 116710
length of database: 581,917,975
effective HSP length: 130
effective length of database: 347,062,185
effective search space used: 153748547955
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)