BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig12039
         (733 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY086403_1571452 Arabidopsis thaliana clone 249634 mRNA, comp...   245   7e-64   
gb:AP004675_1843178 Oryza sativa (japonica cultivar-group) genom...   194   2e-48   
gb:ATAC009325_1542882 Arabidopsis thaliana chromosome III BAC F4...   181   9e-45   
gb:AE017346_1757597 Cryptococcus neoformans var. neoformans JEC2...    52   1e-05   
gb:CR382132_1665183 Yarrowia lipolytica chromosome F of strain C...    51   2e-05   
pir|A90131|A90131 hypothetical protein kin(aaB) [imported] - Gui...    51   2e-05   Guillardia theta
gb:AF276086_1782626 Zea mays protein kinase AKINbetagamma-2 mRNA...    50   5e-05   
gb:ATH132316_1552004 Arabidopsis thaliana mRNA for AKIN beta2.>g...    50   5e-05   
pir|C71430|C71430 hypothetical protein - Arabidopsis thaliana>gb...    50   5e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP003813_1833731 Oryza sativa (japonica cultivar-group) genom...    49   9e-05   
gb:AF276085_1782625 Zea mays protein kinase AKINbetagamma-1 mRNA...    49   9e-05   
gb:AC096690_1736313 Oryza sativa chromosome 3 BAC OSJNBa0059G06 ...    49   9e-05   
sp|P80387|AAKB_PIG|AAKB_PIG 5'-AMP-activated protein kinase, beta-1 subun...    49   9e-05   Sus scrofa [pigs]
gb:CR380956_1652473 Candida glabrata strain CBS138 chromosome J ...    49   1e-04   
gb:AF322108_1786069 Lycopersicon esculentum SNF1-related kinase ...    48   2e-04   
gb:HSAMPKP6_2010533 Human AMP-activated protein kinase beta subu...    48   2e-04   
gb:HSA224515_2000531 Homo sapiens mRNA for AMP-activated protein...    48   2e-04   
gb:BC001007_1967205 Homo sapiens protein kinase, AMP-activated, ...    48   2e-04   
gb:AF022116_1877061 Homo sapiens 5'-AMP-activated protein kinase...    48   2e-04   
gb:AC002563_1874465 Human PAC clone 127H14 from 12q, complete se...    48   2e-04   
gb:AY123127_1579995 Griffithsia japonica glycogen synthase mRNA,...    48   2e-04   
gb:BX538351_1358854 Cryptosporidium parvum chromosome 6, complet...    48   2e-04   
gb:CR859955_1184054 Pongo pygmaeus mRNA; cDNA DKFZp469J1020 (fro...    48   2e-04   
pir|T09514|T09514 5'-AMP-activated protein kinase (EC 2.7.1.-) b...    48   2e-04   Homo sapiens [man]
sp|Q9Y478|AAKB_HUMAN|AAKB_HUMAN 5'-AMP-activated protein kinase, beta-1 sub...    48   2e-04   Homo sapiens [man]
gb:CR382136_1668797 Debaryomyces hansenii chromosome D of strain...    47   3e-04   
gb:AY247274_1592599 Medicago truncatula AKIN beta4 mRNA, partial...    47   3e-04   
gb:CR382132_1665116 Yarrowia lipolytica chromosome F of strain C...    47   5e-04   
gb:BC075947_2558835 Danio rerio zgc:92228, mRNA (cDNA clone MGC:...    46   8e-04   
gb:BC066758_2554594 Danio rerio zgc:76975, mRNA (cDNA clone MGC:...    46   8e-04   
gb:AE017343_1755850 Cryptococcus neoformans var. neoformans JEC2...    46   8e-04   
gb:RNU42411_2137292 Rattus norvegicus 5'-AMP-activated protein k...    45   0.001   
gb:BC062008_2104784 Rattus norvegicus protein kinase, AMP-activa...    45   0.001   
gb:AK088250_1175288 Mus musculus 2 days neonate thymus thymic ce...    45   0.001   
sp|P53885|YNR3_YEAST|YNR3_YEAST Hypothetical 40.3 kDa protein in RPS3-PSD1 ...    45   0.001   Saccharomyces cerevisiae [brewer's yeast]
sp|P80386|AAKB_RAT|AAKB_RAT 5'-AMP-activated protein kinase, beta-1 subun...    45   0.001   Rattus norvegicus [brown rat]
sp|Q9R078|AAKB_MOUSE|AAKB_MOUSE 5'-AMP-activated protein kinase, beta-1 sub...    45   0.001   Mus musculus [mouse]
gb:AY247272_1592597 Medicago truncatula AKIN beta2 mRNA, complet...    45   0.001   
gb:BC072961_2556879 Xenopus laevis MGC82489 protein, mRNA (cDNA ...    44   0.002   
gb:BC053787_2550738 Xenopus laevis protein kinase, AMP-activated...    44   0.002   
gb:BT019427_2151350 Synthetic construct Homo sapiens protein kin...    44   0.002   
gb:BC078821_2106977 Rattus norvegicus protein kinase, AMP-activa...    44   0.002   
gb:BC060228_2103935 Mus musculus protein kinase, AMP-activated, ...    44   0.002   
sp|Q9QZH4|AAKC_RAT|AAKC_RAT 5'-AMP-activated protein kinase, beta-2 subun...    44   0.002   Rattus norvegicus [brown rat]
sp|O43741|AAKC_HUMAN|AAKC_HUMAN 5'-AMP-activated protein kinase, beta-2 sub...    44   0.002   Homo sapiens [man]
gb:CR548612_1375361 Paramecium tetraurelia macronuclear largest ...    44   0.003   
pir|T31528|T31528 hypothetical protein Y47D3A.15 - Caenorhabditi...    44   0.004   Caenorhabditis elegans [roundworm]
gb:U41543_1404076 Caenorhabditis elegans cosmid F46H5, complete ...    43   0.005   
pir|T34273|T34273 hypothetical protein F46H5.7 - Caenorhabditis ...    43   0.005   Caenorhabditis elegans [roundworm]
gb:BT000625_1634903 Arabidopsis thaliana putative activator subu...    43   0.007   
gb:CR380953_1650868 Candida glabrata strain CBS138 chromosome G ...    42   0.009   
gb:BT001554_1356327 Drosophila melanogaster RE12077 full insert ...    42   0.009   
gb:AE013599_1130792 Drosophila melanogaster chromosome 2R, compl...    42   0.009   
gb:AE013599_1130791 Drosophila melanogaster chromosome 2R, compl...    42   0.009   
gb:BX538350_1358747 Cryptosporidium parvum chromosome 6, complet...    42   0.011   
gb:OSJN00045_1693799 Oryza sativa genomic DNA, chromosome 4, BAC...    42   0.015   
pir|I39917|I39917 hypothetical protein - Bacillus sp.>gb:BACORF_...    41   0.019   Bacillus sp. XAL601
gb:AC092779_1735703 Oryza sativa chromosome 3 BAC OSJNBb0024N19 ...    40   0.033   
pir|G72204|G72204 hypothetical protein - Thermotoga maritima (st...    40   0.033   Thermotoga maritima
gb:AP005474_1852524 Oryza sativa (japonica cultivar-group) genom...    40   0.057   
gb:LES313509_1684577 Lycopersicon esculentum mRNA for protein ty...    39   0.074   
gb:CR382129_1661335 Yarrowia lipolytica chromosome C of strain C...    39   0.074   
gb:AY247268_1592593 Medicago truncatula AKIN betagamma mRNA, com...    39   0.097   
pir|T22739|T22739 hypothetical protein F55F3.1 - Caenorhabditis ...    39   0.097   Caenorhabditis elegans [roundworm]
gb:AC140977_1744073 Arabidopsis thaliana chromosome 5 BAC F13M11...    39   0.13    
gb:CR382129_1662102 Yarrowia lipolytica chromosome C of strain C...    39   0.13    
gb:AY247271_1592596 Medicago truncatula AKIN beta1 mRNA, complet...    39   0.13    
gb:ATH132315_1552003 Arabidopsis thaliana mRNA for AKIN beta1.>g...    39   0.13    
gb:D89138_1675256 Schizosaccharomyces pombe mRNA, partial cds, c...    38   0.16    
pir|T42415|T42415 SIP2 protein homolog - fission yeast (Schizosa...    38   0.16    Schizosaccharomyces pombe
pir|T41228|T41228 5'-amp-activated protein kinase - fission yeas...    38   0.16    Schizosaccharomyces pombe
gb:AF272660_494496 Bacillus stearothermophilus TS-23 putative co...    37   0.28    
gb:STU012215_1722951 Solanum tuberosum mRNA for GAL83 protein.         37   0.37    
gb:AY245177_1592537 Lycopersicon esculentum SNF1 kinase complex ...    37   0.37    
gb:AP006878_576129 Thermococcus kodakaraensis strain KOD1 DNA, c...    36   0.63    
gb:CR858254_1182439 Pongo pygmaeus mRNA; cDNA DKFZp469M1118 (fro...    36   0.82    
gb:AE016815_1746102 Ashbya gossypii (= Eremothecium gossypii) AT...    35   1.1     
gb:CR382124_1656689 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   1.4     
gb:AY143878_1583335 Arabidopsis thaliana At3g52180/F4F15_290 mRN...    35   1.8     
gb:AY084675_1569763 Arabidopsis thaliana clone 114734 mRNA, comp...    35   1.8     
gb:ATH302779_1552431 Arabidopsis thaliana f4F15.290 gene for PTP...    35   1.8     
pir|T49097|T49097 hypothetical protein F4F15.290 - Arabidopsis t...    35   1.8     Arabidopsis thaliana [mouse-ear cress]
gb:AF004841_1875913 Homo sapiens CDO mRNA, complete cds.               34   2.4     
gb:AC129718_1740645 Oryza sativa (japonica cultivar-group) chrom...    34   2.4     
gb:AC113930_1739083 Oryza sativa (japonica cultivar-group) chrom...    34   2.4     
pir|T03097|T03097 CDO protein - human                                  34   2.4     Homo sapiens [man]
gb:AE005172_891586 Arabidopsis thaliana chromosome 1, top arm co...    34   3.1     
gb:ATH302779_1552432 Arabidopsis thaliana f4F15.290 gene for PTP...    33   5.3     
sp|Q8DT52|GLGB_STRMU|GLGB_STRMU 1,4-alpha-glucan branching enzyme (EC 2.4.1...    33   5.3     Streptococcus mutans serotype C
gb:AP004253_1839167 Oryza sativa (japonica cultivar-group) genom...    32   9.0     
pir|B72510|B72510 hypothetical protein APE2056 - Aeropyrum perni...    32   9.0     Aeropyrum pernix
sp|Q63505|T3C1_RAT|T3C1_RAT General transcription factor 3C polypeptide 1...    32   9.0     Rattus norvegicus [brown rat]


>gb:AY086403_1571452 Arabidopsis thaliana clone 249634 mRNA,
           complete sequence.
          Length = 591

 Score =  245 bits (625), Expect = 7e-64
 Identities = 113/145 (77%), Positives = 127/145 (87%)
 Frame = -1

Query: 733 NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY 554
           +G+HDG  TH+VTFVWNG EG+ V LVGDFTGNWKEPI+A HK GPRFE EVRL+QGKYY
Sbjct: 446 DGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVRLTQGKYY 505

Query: 553 YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE 374
           YKYIING WRHS  S TERD+RGNTNN+IVVGD+A+VRP++QQ  K ANIIKVIER LTE
Sbjct: 506 YKYIINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRKDANIIKVIERVLTE 565

Query: 373 NERFMLAKAARCIAFSICPIRLAPK 299
           +ERF LAKAARCIAFS+CPIRL PK
Sbjct: 566 SERFRLAKAARCIAFSVCPIRLCPK 590



>gb:AP004675_1843178 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0709D11.>gb:AP005443_1851857 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBb0011E04.
          Length = 593

 Score =  194 bits (492), Expect = 2e-48
 Identities = 94/147 (63%), Positives = 113/147 (76%), Gaps = 2/147 (1%)
 Frame = -1

Query: 733 NGRHDGPATHAVTFVWN-GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKY 557
           NGRHDG  TH+V FVWN G EG++V LVGDFT NWK+ ++  HK G R+EAE+RL  GKY
Sbjct: 446 NGRHDGTPTHSVCFVWNSGREGEDVELVGDFTSNWKDKVKCDHKGGSRYEAEIRLRHGKY 505

Query: 556 YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQ-QTKGANIIKVIERPL 380
           YYK+I  GQWRHST   TE DE GN NNVI VGDIA +RP+  Q Q +   ++KVIER L
Sbjct: 506 YYKFIAGGQWRHSTSLPTETDEHGNVNNVIRVGDIARIRPAPSQLQIRDPTVVKVIERAL 565

Query: 379 TENERFMLAKAARCIAFSICPIRLAPK 299
           TE+ERF+LA AAR +AF+ICPIRL+PK
Sbjct: 566 TEDERFLLAFAARRMAFAICPIRLSPK 592



>gb:ATAC009325_1542882 Arabidopsis thaliana chromosome III BAC F4P13
           genomic sequence, complete sequence.
          Length = 716

 Score =  181 bits (460), Expect = 9e-45
 Identities = 80/106 (75%), Positives = 92/106 (86%)
 Frame = -1

Query: 733 NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYY 554
           +G+HDG  TH+VTFVWNG EG+ V LVGDFTGNWKEPI+A HK GPRFE EVRL+QGKYY
Sbjct: 605 DGKHDGTPTHSVTFVWNGHEGEEVLLVGDFTGNWKEPIKATHKGGPRFETEVRLTQGKYY 664

Query: 553 YKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTK 416
           YKYIING WRHS  S TERD+RGNTNN+IVVGD+A+VRP++QQ  K
Sbjct: 665 YKYIINGDWRHSATSPTERDDRGNTNNIIVVGDVANVRPTIQQPRK 710



>gb:AE017346_1757597 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 509

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 28/80 (35%), Positives = 43/80 (53%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH 521
           V   WNG  G NV++ G + G W + I+ +H++   F   +RL  G+Y  K+I++  WR 
Sbjct: 255 VQIQWNGG-GRNVYVAGTWDGGWAKRIK-LHRSTHDFNTTIRLPPGQYRLKFIVDDSWRC 312

Query: 520 STDSATERDERGNTNNVIVV 461
           S   +T  D+ G   N I V
Sbjct: 313 SKQISTAVDDDGTLVNWIEV 332



>gb:CR382132_1665183 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 578

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 26/81 (32%), Positives = 43/81 (53%)
 Frame = -1

Query: 697 TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHS 518
           TF W  P G +  +V     NW + ++ + KT   F   V+L + K  YK+ ++G W+  
Sbjct: 5   TFEW--PYGGSEVVVSGTFDNWSKSVK-LDKTPKGFAKTVKLPKEKTVYKFYVDGVWKVD 61

Query: 517 TDSATERDERGNTNNVIVVGD 455
               TE+D +GN NNV++  +
Sbjct: 62  DGVPTEKDPQGNLNNVLIFAE 82



>pir|A90131|A90131 hypothetical protein kin(aaB) [imported] -
           Guillardia theta nucleomorph>gb:AF083031_1766810
           Guillardia theta nucleomorph chromosome 3, complete
           sequence.
          Length = 256

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G+ V++ GD+  +W + I  + K+G  F   + L+ GK+ YK+ ++G+W+ +  +  + D
Sbjct: 58  GNGVYITGDWD-SWNKRI-PLCKSGNEFFTIIPLTYGKFQYKFTVDGEWKFAPSTKIQED 115

Query: 493 ERGNTNNVIVVGD 455
           + GN NN I + D
Sbjct: 116 KNGNLNNFIDIHD 128



>gb:AF276086_1782626 Zea mays protein kinase AKINbetagamma-2 mRNA,
           complete cds.
          Length = 496

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 2/111 (1%)
 Frame = -1

Query: 730 GRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKY 557
           G   G AT    FVW    G  VF+ G FT  W E  P+  +      F+A   LS G +
Sbjct: 16  GVSSGGATVPTRFVWPYG-GKRVFVSGSFT-RWSEHLPMSPIEGCPTVFQAICSLSPGIH 73

Query: 556 YYKYIINGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANI 404
            YK+ ++G+WRH     T   E G  N + +  +   +       T G+ +
Sbjct: 74  EYKFFVDGEWRHDERQPTISGEFGIVNTLYLTREYNQINTLSSPSTPGSRM 124



>gb:ATH132316_1552004 Arabidopsis thaliana mRNA for AKIN
           beta2.>gb:BT020423_1642818 Arabidopsis thaliana
           At4g16360 mRNA, complete cds.>gb:AF360248_1791199
           Arabidopsis thaliana putative kinase (At4g16360) mRNA,
           complete cds.
          Length = 289

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 23/61 (37%), Positives = 36/61 (59%)
 Frame = -1

Query: 637 NWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVG 458
           NWK   R + ++G  F     L  G Y Y++I++GQWRH+ +    RD+ GNT N++ + 
Sbjct: 123 NWKTRSR-LQRSGKDFTIMKVLPSGVYEYRFIVDGQWRHAPELPLARDDAGNTFNILDLQ 181

Query: 457 D 455
           D
Sbjct: 182 D 182



>pir|C71430|C71430 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV43_1545438 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 43.>gb:ATFCA6_1551686
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 6.
          Length = 259

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 23/61 (37%), Positives = 36/61 (59%)
 Frame = -1

Query: 637 NWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVVG 458
           NWK   R + ++G  F     L  G Y Y++I++GQWRH+ +    RD+ GNT N++ + 
Sbjct: 93  NWKTRSR-LQRSGKDFTIMKVLPSGVYEYRFIVDGQWRHAPELPLARDDAGNTFNILDLQ 151

Query: 457 D 455
           D
Sbjct: 152 D 152



>gb:AP003813_1833731 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1150_E04.>gb:AP003818_1833814 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1200_C08.
          Length = 316

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 32/92 (34%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = -1

Query: 724 HDGPATHAVT--FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYY 551
           HDGP    +    VW    G NV++ G +  NWK   + VHK G      + L+ G Y Y
Sbjct: 119 HDGPPDKLIPTLLVWT-LGGKNVYIEGSWD-NWKSK-QLVHKCGKDHCVMLGLASGVYRY 175

Query: 550 KYIINGQWRHSTDSATERDERGNTNNVIVVGD 455
           ++I++G+ R   D   E D  G  +N+I V D
Sbjct: 176 RFIVDGERRFQPDRPREADIMGTISNLIDVHD 207



>gb:AF276085_1782625 Zea mays protein kinase AKINbetagamma-1 mRNA,
           complete cds.
          Length = 497

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 32/105 (30%), Positives = 47/105 (44%), Gaps = 2/105 (1%)
 Frame = -1

Query: 712 ATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYII 539
           AT    FVW    G  VF+ G FT  W E  P+  V      F+A   LS G + YK+ +
Sbjct: 23  ATVPARFVWPYG-GKRVFVSGSFT-RWSEHLPMSPVEGCPTVFQAICSLSPGIHEYKFYV 80

Query: 538 NGQWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANI 404
           +G+WRH     T   E G  N + +  +   +   +   T G+ +
Sbjct: 81  DGEWRHDERQPTISGEFGIVNTLYLTREFNQINALLNPSTPGSRM 125



>gb:AC096690_1736313 Oryza sativa chromosome 3 BAC OSJNBa0059G06
           genomic sequence, complete sequence.>gb:AC128647_1740593
           Oryza sativa (japonica cultivar-group) chromosome 3
           clone OSJNBb0062G19 map MAP_LOC, complete sequence.
          Length = 493

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 2/99 (2%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH 521
           FVW    G  V+L G FT  W E  P+  V      F+A   LS G + YK+ ++G+WRH
Sbjct: 26  FVWPYG-GKRVYLTGSFT-RWTEHLPMSPVEGCPTVFQAICSLSPGIHQYKFCVDGEWRH 83

Query: 520 STDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANI 404
                T   + G  N + +  D   +   +   T G+ +
Sbjct: 84  DERQPTITGDYGVVNTLCLTRDFDQINTILSPSTPGSRM 122



>sp|P80387|AAKB_PIG 5'-AMP-activated protein kinase, beta-1 subunit
           (AMPK beta-1 chain) (AMPKb) (40 kDa subunit) (Fragment).
          Length = 122

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 26/78 (33%), Positives = 38/78 (48%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK++++GQW H  
Sbjct: 47  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFLVDGQWTHDP 102

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 103 SEPVVTSQLGTVNNIIQV 120



>gb:CR380956_1652473 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 271

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 4/100 (4%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEA--EVRLSQGKYYYKYIINGQW 527
           V FVW       V + GDF   WK   + + K G  F     V+ +  K Y+K++++G+W
Sbjct: 4   VEFVWKSGTPSEVVVTGDFD-EWKCSHK-LEKRGDEFRGVVPVKFTAPKVYFKFVVDGEW 61

Query: 526 RHSTDSATERDERGNTNNVIVVGD--IASVRPSMQQQTKG 413
             S D   E ++ G+ NN I   D  + S+  SM    KG
Sbjct: 62  VASGDYKRESNDLGSENNYITKEDARMGSMDASMDAAPKG 101



>gb:AF322108_1786069 Lycopersicon esculentum SNF1-related kinase
           complex anchoring protein SIP1 mRNA, complete cds.
          Length = 227

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 27/74 (36%), Positives = 41/74 (55%)
 Frame = -1

Query: 676 EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATER 497
           +G  V + G +  NWK  +  + K+G  F     L  G Y Y++I++GQWR S D    +
Sbjct: 49  DGKEVAVEGSWD-NWKSRM-PLQKSGKDFTILKVLPSGVYQYRFIVDGQWRCSPDLPCVQ 106

Query: 496 DERGNTNNVIVVGD 455
           DE GNT N++ + D
Sbjct: 107 DEAGNTYNLLDMKD 120



>gb:HSAMPKP6_2010533 Human AMP-activated protein kinase beta subunit
           (HAMPKb) gene, exons 6 and 7, and complete
           cds.>gb:HSU83994_2026725 Human AMP-activated protein
           kinase beta subunit mRNA, complete cds.
          Length = 270

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>gb:HSA224515_2000531 Homo sapiens mRNA for AMP-activated protein
           kinase beta 1.
          Length = 270

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>gb:BC001007_1967205 Homo sapiens protein kinase, AMP-activated,
           beta 1 non-catalytic subunit, mRNA (cDNA clone MGC:8608
           IMAGE:2961281), complete cds.>gb:BC001056_1967250 Homo
           sapiens protein kinase, AMP-activated, beta 1
           non-catalytic subunit, mRNA (cDNA clone MGC:1878
           IMAGE:2961281), complete cds.>gb:BC001823_1967883 Homo
           sapiens protein kinase, AMP-activated, beta 1
           non-catalytic subunit, mRNA (cDNA clone MGC:3758
           IMAGE:2961281), complete cds.>gb:BC017671_1976198 Homo
           sapiens protein kinase, AMP-activated, beta 1
           non-catalytic subunit, mRNA (cDNA clone MGC:17785
           IMAGE:3884583), complete cds.
          Length = 270

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>gb:AF022116_1877061 Homo sapiens 5'-AMP-activated protein kinase
           beta-1 mRNA, complete cds.
          Length = 248

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>gb:AC002563_1874465 Human PAC clone 127H14 from 12q, complete
           sequence.
          Length = 282

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>gb:AY123127_1579995 Griffithsia japonica glycogen synthase mRNA,
           partial cds.
          Length = 201

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 30/90 (33%), Positives = 46/90 (51%), Gaps = 10/90 (11%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGP--------RFEAEVRLSQGKYYY 551
           V   W+G +G+ V ++G F  NW    P+  V   G          FE ++RLS G++ Y
Sbjct: 114 VRVAWHG-KGEKVIVMGSFD-NWTSEWPLLRVSDDGAGGAGTGVAAFELKLRLSPGEHAY 171

Query: 550 KYIINGQWRHSTDSATERDERGNTNNVIVV 461
           K+ ++ +W  + D     D  G TNNV+VV
Sbjct: 172 KFKVDDEWIVADDQPKREDASGITNNVLVV 201



>gb:BX538351_1358854 Cryptosporidium parvum chromosome 6, complete
           sequence; segment 2/4.
          Length = 284

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 22/69 (31%), Positives = 38/69 (55%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           GD VF+ G F    K+    + K+G      + L++  +++K+I++G+WR+S +   E D
Sbjct: 47  GDEVFVTGSFNFWRKQDEYKLFKSGHDHLIAIELTRNIHFFKFIVDGEWRYSPEYPIESD 106

Query: 493 ERGNTNNVI 467
             G  NN I
Sbjct: 107 SEGYINNCI 115



>gb:CR859955_1184054 Pongo pygmaeus mRNA; cDNA DKFZp469J1020 (from
           clone DKFZp469J1020).
          Length = 270

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>pir|T09514|T09514 5'-AMP-activated protein kinase (EC 2.7.1.-)
           beta-1 chain - human>gb:HSAMPKB1_2010532 H.sapiens mRNA
           for AMP-activated protein kinase beta-1.
          Length = 270

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>sp|Q9Y478|AAKB_HUMAN 5'-AMP-activated protein kinase, beta-1
           subunit (AMPK beta-1 chain) (AMPKb).
          Length = 269

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+   H     F A + L +G++ YK+ ++GQW H  
Sbjct: 81  FRWTGG-GKEVYLSGSFNNWSKLPLTRSHNN---FVAILDLPEGEHQYKFFVDGQWTHDP 136

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 137 SEPIVTSQLGTVNNIIQV 154



>gb:CR382136_1668797 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 793

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 29/85 (34%), Positives = 41/85 (48%), Gaps = 3/85 (3%)
 Frame = -1

Query: 697 TFVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLS--QGKYYYKYIINGQW 527
           TF W  GP+   V L G F  NW + +  V +    FE  V L     +  YKY+++GQW
Sbjct: 6   TFKWPKGPQ--EVVLTGTFD-NWSKTLFLVKQADGSFELTVPLPTHDDEILYKYVVDGQW 62

Query: 526 RHSTDSATERDERGNTNNVIVVGDI 452
           + S      +DE G  NN +   D+
Sbjct: 63  KVSPTEKVVKDESGIENNYVAASDL 87



>gb:AY247274_1592599 Medicago truncatula AKIN beta4 mRNA, partial
           cds.
          Length = 268

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 23/73 (31%), Positives = 40/73 (54%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G NV + G +  NW E + A+ + G  F     L    YYY++I++GQW H+ +  ++ D
Sbjct: 94  GTNVSIAGSWN-NW-ETVEALLRVGQHFVIVKTLPISIYYYRFIVDGQWTHAPEFPSDLD 151

Query: 493 ERGNTNNVIVVGD 455
           + G   N++ + D
Sbjct: 152 DSGYVYNILDLQD 164



>gb:CR382132_1665116 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 597

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 28/103 (27%), Positives = 51/103 (49%)
 Frame = -1

Query: 697 TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHS 518
           TFVW    G ++ + G F  NW + +  +  +       V +   K  +K++++G+W+  
Sbjct: 5   TFVWPH-SGSHIIVTGSFD-NWTQSL-TLSPSSAGHSHTVAIPVEKTLFKFVVDGEWKVD 61

Query: 517 TDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIE 389
              ATE DE GN NNV+ +         M +Q +G +I ++ +
Sbjct: 62  ESFATETDEHGNINNVLSL--------EMLEQLEGDDIQEITQ 96



>gb:BC075947_2558835 Danio rerio zgc:92228, mRNA (cDNA clone
           MGC:92228 IMAGE:7052330), complete cds.
          Length = 268

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 25/78 (32%), Positives = 37/78 (47%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V++ G F  NW   I  +      F A V L +G++ YK+ ++G W H  
Sbjct: 79  FRWTGA-GKEVYISGSFN-NWTNKIPLIRSQN-NFVAIVDLPEGEHQYKFYVDGLWTHDP 135

Query: 514 DSATERDERGNTNNVIVV 461
                 ++ G  NN+I V
Sbjct: 136 TEPVVTNQLGTVNNIIQV 153



>gb:BC066758_2554594 Danio rerio zgc:76975, mRNA (cDNA clone
           MGC:76975 IMAGE:6525582), complete cds.
          Length = 260

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 26/78 (33%), Positives = 40/78 (51%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W GP G  ++L G F  NW   I  ++K+   F A + L +G++ YK+ ++G W    
Sbjct: 71  FRWKGP-GKEIYLSGSFN-NWATKI-PLNKSHNNFVAIIDLPEGEHQYKFYVDGHWTLDP 127

Query: 514 DSATERDERGNTNNVIVV 461
                 ++ G  NNVI V
Sbjct: 128 KEPVVTNKSGVVNNVIKV 145



>gb:AE017343_1755850 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 793

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 28/81 (34%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -1

Query: 706 HAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGP-RFEAEVRLSQG-KYYYKYIING 533
           H  TF W G     V + G+F  +W      + K     F A+V +  G K  +KY+++G
Sbjct: 5   HLATFTW-GAGAQTVCVAGNFN-DWSATATPLKKQSDGSFLADVSVPWGEKQAFKYVVDG 62

Query: 532 QWRHSTDSATERDERGNTNNV 470
           +W+   D A E D  GN NNV
Sbjct: 63  EWKVREDEAKEWDAAGNMNNV 83



>gb:RNU42411_2137292 Rattus norvegicus 5'-AMP-activated protein
           kinase, beta subunit mRNA, complete cds.
          Length = 270

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+    ++   F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLT---RSQNNFVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>gb:BC062008_2104784 Rattus norvegicus protein kinase,
           AMP-activated, beta 1 non-catalytic subunit, mRNA (cDNA
           clone MGC:72378 IMAGE:5599996), complete
           cds.>gb:RNAMPKBET_2134470 R.norvegicus mRNA for beta
           subunit of AMP-activated protein kinase.
          Length = 270

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+    ++   F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLT---RSQNNFVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>gb:AK088250_1175288 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430008F22 product:5'-AMP-activated protein kinase
           beta subunit mRNA, full insert
           sequence.>gb:BC016398_2092276 Mus musculus protein
           kinase, AMP-activated, beta 1 non-catalytic subunit,
           mRNA (cDNA clone MGC:6400 IMAGE:3585002), complete cds.
          Length = 270

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+    ++   F A + L +G++ YK+ ++GQW H  
Sbjct: 82  FRWTGG-GKEVYLSGSFNNWSKLPLT---RSQNNFVAILDLPEGEHQYKFFVDGQWTHDP 137

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 138 SEPIVTSQLGTVNNIIQV 155



>sp|P53885|YNR3_YEAST Hypothetical 40.3 kDa protein in RPS3-PSD1
           intergenic region.>pir|S56040|S56040 pheromone response
           G protein - yeast (Saccharomyces
           cerevisiae)>gb:SCYNL173C_1713775 S.cerevisiae chromosome
           XIV reading frame ORF YNL173c.>gb:YSCPRGPRO_1730350
           Saccharomyces cerevisiae pheromone response G protein,
           complete cds.
          Length = 366

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 40/126 (31%), Positives = 54/126 (42%), Gaps = 7/126 (5%)
 Frame = -1

Query: 697 TFVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLS----QGKYYYKYIING 533
           TF W  GPE   + L G F  +WK  +  V      FE  + ++      K+Y+K+I++G
Sbjct: 9   TFKWPKGPEA--IILTGTFD-DWKGTLPMVKDPSGAFEITLPVTFDSPSSKFYFKFIVDG 65

Query: 532 QWRHSTDSATERDERGNTNNVIVVGDIASVRP--SMQQQTKGANIIKVIERPLTENERFM 359
           QW  S D     DE G  NN I   D+   R   S     + A +      PL E E   
Sbjct: 66  QWLPSKDYKVNIDE-GVENNFITEEDVIKQRENGSSTLVPESAGLAVSKNAPLIEPEAEK 124

Query: 358 LAKAAR 341
            AK  R
Sbjct: 125 RAKKLR 130



>sp|P80386|AAKB_RAT 5'-AMP-activated protein kinase, beta-1 subunit
           (AMPK beta-1 chain) (AMPKb) (40 kDa subunit).
          Length = 269

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+    ++   F A + L +G++ YK+ ++GQW H  
Sbjct: 81  FRWTGG-GKEVYLSGSFNNWSKLPLT---RSQNNFVAILDLPEGEHQYKFFVDGQWTHDP 136

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 137 SEPIVTSQLGTVNNIIQV 154



>sp|Q9R078|AAKB_MOUSE 5'-AMP-activated protein kinase, beta-1
           subunit (AMPK beta-1 chain) (AMPKb).>gb:AF108215_2054746
           Mus musculus 5'-AMP-activated protein kinase beta
           subunit mRNA, partial cds.
          Length = 269

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 25/78 (32%), Positives = 38/78 (48%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  V+L G F    K P+    ++   F A + L +G++ YK+ ++GQW H  
Sbjct: 81  FRWTGG-GKEVYLSGSFNNWSKLPLT---RSQNNFVAILDLPEGEHQYKFFVDGQWTHDP 136

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NN+I V
Sbjct: 137 SEPIVTSQLGTVNNIIQV 154



>gb:AY247272_1592597 Medicago truncatula AKIN beta2 mRNA, complete
           cds.
          Length = 287

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = -1

Query: 676 EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATER 497
           +G  V + G +  NWK  +  + ++G  F     L  G Y +++I++GQWR++ D    R
Sbjct: 109 DGKEVAVEGSWD-NWKTRM-PLQRSGKDFTIMKVLPSGVYQFRFIVDGQWRYAPDLPWAR 166

Query: 496 DERGNTNNVIVVGD 455
           D+  NT N++ + D
Sbjct: 167 DDAANTYNILDLQD 180



>gb:BC072961_2556879 Xenopus laevis MGC82489 protein, mRNA (cDNA
           clone MGC:82489 IMAGE:4959948), complete cds.
          Length = 266

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 25/78 (32%), Positives = 39/78 (50%)
 Frame = -1

Query: 694 FVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHST 515
           F W G  G  ++L G F    K P+    ++   F A + L +G++ YK++++GQW H  
Sbjct: 78  FRWTGG-GKEIYLSGTFNNWAKIPLI---RSRNNFFAILDLPEGEHQYKFLVDGQWTHDA 133

Query: 514 DSATERDERGNTNNVIVV 461
                  + G  NNVI V
Sbjct: 134 AEPVITSQLGTVNNVIQV 151



>gb:BC053787_2550738 Xenopus laevis protein kinase, AMP-activated,
           beta 2 non-catalytic subunit, mRNA (cDNA clone MGC:64365
           IMAGE:6877960), complete cds.
          Length = 271

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G  VF+ G F  NW   I  + K+   F A + L +G++ YK+ ++GQW H         
Sbjct: 86  GKEVFISGSFN-NWNTKIPLI-KSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTS 143

Query: 493 ERGNTNNVIVV 461
           + G  NN+I V
Sbjct: 144 QLGTINNLIHV 154



>gb:BT019427_2151350 Synthetic construct Homo sapiens protein
           kinase, AMP-activated, beta 2 non-catalytic subunit
           mRNA, partial cds.>gb:BT019428_2151351 Synthetic
           construct Homo sapiens protein kinase, AMP-activated,
           beta 2 non-catalytic subunit mRNA, partial cds.
          Length = 273

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G  VF+ G F  NW   I  + K+   F A + L +G++ YK+ ++GQW H         
Sbjct: 87  GKEVFISGSFN-NWSTKIPLI-KSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTS 144

Query: 493 ERGNTNNVIVV 461
           + G  NN+I V
Sbjct: 145 QLGTINNLIHV 155



>gb:BC078821_2106977 Rattus norvegicus protein kinase,
           AMP-activated, beta 2 non-catalytic subunit, mRNA (cDNA
           clone MGC:93432 IMAGE:7135534), complete cds.
          Length = 179

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G  VF+ G F  NW   I  + K+   F A + L +G++ YK+ ++GQW H         
Sbjct: 86  GKEVFISGSFN-NWSTKIPLI-KSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTS 143

Query: 493 ERGNTNNVIVV 461
           + G  NN+I V
Sbjct: 144 QLGTINNLIHV 154



>gb:BC060228_2103935 Mus musculus protein kinase, AMP-activated,
           beta 2 non-catalytic subunit, mRNA (cDNA clone MGC:77954
           IMAGE:6839848), complete cds.
          Length = 271

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G  VF+ G F  NW   I  + K+   F A + L +G++ YK+ ++GQW H         
Sbjct: 86  GKEVFISGSFN-NWSTKIPLI-KSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTS 143

Query: 493 ERGNTNNVIVV 461
           + G  NN+I V
Sbjct: 144 QLGTINNLIHV 154



>sp|Q9QZH4|AAKC_RAT 5'-AMP-activated protein kinase, beta-2 subunit
           (AMPK beta-2 chain).>gb:AF182717_2058109 Rattus
           norvegicus AMP-activated protein kinase beta-2
           regulatory subunit (Prkab2) mRNA, complete cds.
          Length = 271

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G  VF+ G F  NW   I  + K+   F A + L +G++ YK+ ++GQW H         
Sbjct: 86  GKEVFISGSFN-NWSTKIPLI-KSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTS 143

Query: 493 ERGNTNNVIVV 461
           + G  NN+I V
Sbjct: 144 QLGTINNLIHV 154



>sp|O43741|AAKC_HUMAN 5'-AMP-activated protein kinase, beta-2
           subunit (AMPK beta-2 chain).>gb:AF504538S6_1905446 Homo
           sapiens AMPK beta-2 subunit (PRKAB2) gene, exon 8 and
           complete cds.>gb:AL356378_1924474 Human DNA sequence
           from clone RP11-337C18 on chromosome 1 Contains the
           PRKAB2 gene for protein kinase, AMP-activated, beta 2
           non-catalytic subunit protein, a FMO5 gene for the
           flavin containing monooxygenase 5 protein, the CHD1L
           gene for chromodomain helicase DNA binding protein
           1-like (FLJ22530) protein, a processed pseudogene
           similar to glucose regulated protein, 58kDa (GRP58), a
           processed pseudogene similar to chaperonin containing
           TCP1, subunit 8 (theta) (CCT8) protein, a processed
           pseudogene similar to ribosomal protein L7a (RPL7A)
           protein, a processed pseudogene similar to leukotriene
           B4 12-hydroxydehydrogenase (LTB4DH) protein and three
           CpG islands, complete sequence.>gb:BC053610_1985003 Homo
           sapiens protein kinase, AMP-activated, beta 2
           non-catalytic subunit, mRNA (cDNA clone MGC:61468
           IMAGE:6091476), complete cds.>gb:HSA224538_2000533 Homo
           sapiens mRNA for AMP-activated protein kinase beta 2
           subunit.
          Length = 272

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/71 (33%), Positives = 36/71 (50%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G  VF+ G F  NW   I  + K+   F A + L +G++ YK+ ++GQW H         
Sbjct: 87  GKEVFISGSFN-NWSTKIPLI-KSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTS 144

Query: 493 ERGNTNNVIVV 461
           + G  NN+I V
Sbjct: 145 QLGTINNLIHV 155



>gb:CR548612_1375361 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 501

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = -1

Query: 712 ATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRF---EAEVRLSQGKYYYKYI 542
           A   VTF+W   EG +V L G +          + + G +    +  + L+ G+Y YK++
Sbjct: 21  AAQPVTFIWPY-EGIDVLLFGSWN---------LFQVGTKLIGNKCTLNLAVGQYEYKFL 70

Query: 541 INGQWRHSTDSATERDERGNTNNVIVV 461
           ++ QWR+  +  T  D  G+ NN+I V
Sbjct: 71  VDNQWRYLQNQETVNDNHGSYNNMIQV 97



>pir|T31528|T31528 hypothetical protein Y47D3A.15 - Caenorhabditis
           elegans>gb:CEY47D3A_1370165 Caenorhabditis elegans YAC
           Y47D3A, complete sequence.
          Length = 274

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 3/96 (3%)
 Frame = -1

Query: 733 NGRHDGPATHAVTFVWNGPEGDN---VFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQG 563
           +G  D      V F W+  +      V +VG +  NW+  I  V  T   F   + L  G
Sbjct: 52  DGNEDKSGECPVVFRWSFTQNAQPRVVHIVGSWD-NWQTRIPMVKSTND-FSTIIDLQPG 109

Query: 562 KYYYKYIINGQWRHSTDSATERDERGNTNNVIVVGD 455
           +Y YK+ ++G W    +    +D  GN NN+I + D
Sbjct: 110 QYEYKFQVDGSWVVDDNQGKAQDVHGNENNMINIQD 145



>gb:U41543_1404076 Caenorhabditis elegans cosmid F46H5, complete
           sequence.
          Length = 575

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = -1

Query: 664 VFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERG 485
           V+L G F  NWK  ++       +    V L++G++ ++++ING+W  S+D     +  G
Sbjct: 508 VYLTGSFI-NWKCTLKCEKLVSGKKGVTVNLTRGRHEFRFMINGEWATSSDYQQVPNGLG 566

Query: 484 NTNNVIVV 461
             NN+I V
Sbjct: 567 GQNNIIFV 574



>pir|T34273|T34273 hypothetical protein F46H5.7 - Caenorhabditis
           elegans>gb:U41543_1404075 Caenorhabditis elegans cosmid
           F46H5, complete sequence.
          Length = 572

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 21/68 (30%), Positives = 37/68 (54%)
 Frame = -1

Query: 664 VFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERG 485
           V+L G F  NWK  ++       +    V L++G++ ++++ING+W  S+D     +  G
Sbjct: 505 VYLTGSFI-NWKCTLKCEKLVSGKKGVTVNLTRGRHEFRFMINGEWATSSDYQQVPNGLG 563

Query: 484 NTNNVIVV 461
             NN+I V
Sbjct: 564 GQNNIIFV 571



>gb:BT000625_1634903 Arabidopsis thaliana putative activator subunit
           of SNF1-related protein kinase SNF4 (At1g09020/F7G19_11)
           mRNA, complete cds.>gb:AF439826_1800002 Arabidopsis
           thaliana At1g09020/F7G19_11 mRNA, complete cds.
          Length = 487

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 27/94 (28%), Positives = 38/94 (40%), Gaps = 2/94 (2%)
 Frame = -1

Query: 733 NGRHDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGK 560
           N    G       FVW    G  VFL G FT  W E  P+  +      F+    L+ G 
Sbjct: 12  NSAASGQLLTPTRFVWPYG-GRRVFLSGSFT-RWTEHVPMSPLEGCPTVFQVICNLTPGY 69

Query: 559 YYYKYIINGQWRHSTDSATERDERGNTNNVIVVG 458
           + YK+ ++G+WRH           G  N + + G
Sbjct: 70  HQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFITG 103



>gb:CR380953_1650868 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 843

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 4/100 (4%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLS---QG-KYYYKYIING 533
           V+F +  P G    LV      W+  I  V +    +   + L    +G + Y+K+I++ 
Sbjct: 5   VSFTFRWPAGPQEVLVTGSFDKWQSKIPLVKEADGSYAVTIPLKFEDEGERLYFKFIVDD 64

Query: 532 QWRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKG 413
           +W  S D   E D  G  NN + + +    + S++ QTKG
Sbjct: 65  EWVVSKDYRKEFDSNGFENNFVSINE---AKKSLKDQTKG 101



>gb:BT001554_1356327 Drosophila melanogaster RE12077 full insert
           cDNA.
          Length = 341

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 22/76 (28%), Positives = 41/76 (53%)
 Frame = -1

Query: 688 WNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDS 509
           W+G  G NV + G F+ +WK    A+ ++   F   + L +G + YK+ ++G+W+H    
Sbjct: 161 WDGG-GKNVTISGTFS-DWKP--MAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKL 216

Query: 508 ATERDERGNTNNVIVV 461
            +  +  G  NN++ V
Sbjct: 217 KSVENAEGQRNNLVSV 232



>gb:AE013599_1130792 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003834_1226896 Drosophila melanogaster
           chromosome 2R, section 16 of 74 of the complete
           sequence.>gb:AY060801_1292606 Drosophila melanogaster
           GH26685 full length cDNA.
          Length = 220

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 22/76 (28%), Positives = 41/76 (53%)
 Frame = -1

Query: 688 WNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDS 509
           W+G  G NV + G F+ +WK    A+ ++   F   + L +G + YK+ ++G+W+H    
Sbjct: 40  WDGG-GKNVTISGTFS-DWKP--MAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKL 95

Query: 508 ATERDERGNTNNVIVV 461
            +  +  G  NN++ V
Sbjct: 96  KSVENAEGQRNNLVSV 111



>gb:AE013599_1130791 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003834_1226895 Drosophila melanogaster
           chromosome 2R, section 16 of 74 of the complete
           sequence.
          Length = 341

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 22/76 (28%), Positives = 41/76 (53%)
 Frame = -1

Query: 688 WNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDS 509
           W+G  G NV + G F+ +WK    A+ ++   F   + L +G + YK+ ++G+W+H    
Sbjct: 161 WDGG-GKNVTISGTFS-DWKP--MAMVRSHQNFVTIIDLPEGDHQYKFCVDGEWKHDPKL 216

Query: 508 ATERDERGNTNNVIVV 461
            +  +  G  NN++ V
Sbjct: 217 KSVENAEGQRNNLVSV 232



>gb:BX538350_1358747 Cryptosporidium parvum chromosome 6, complete
            sequence; segment 1/4.
          Length = 1891

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = -1

Query: 562  KYYYKYIINGQWRHSTDSATERDERGNTNNVIVV 461
            +Y YKYI++G W H  +     D++GNTNN+I +
Sbjct: 967  QYEYKYIVDGNWMHDPNLPYTSDDKGNTNNIITL 1000



>gb:OSJN00045_1693799 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0012E08, complete sequence.
          Length = 451

 Score = 41.6 bits (96), Expect = 0.015
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKE-PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATER 497
           G      G FTG W+E P+  V   G  F+    L  G Y Y+++++G WR        R
Sbjct: 12  GQRASFCGSFTG-WRECPMGLV---GAEFQVVFDLPPGVYQYRFLVDGVWRCDETKPCVR 67

Query: 496 DERGNTNNVIVVGDIASVRPSMQQQT 419
           DE G  +N ++V    +  P +Q +T
Sbjct: 68  DEYGLISNEVLVD---NTHPVVQPET 90



>pir|I39917|I39917 hypothetical protein - Bacillus
           sp.>gb:BACORF_746004 Bacillus sp. gene for ORF, complete
           cds.
          Length = 2032

 Score = 41.2 bits (95), Expect = 0.019
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 2/109 (1%)
 Frame = -1

Query: 700 VTFVWNGP-EGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWR 524
           VTF + G  E  +V L G F  +W + I    ++   +     L  G Y YK++++G W 
Sbjct: 45  VTFRYVGTGEEQSVLLAGSFN-DW-QTIELTKESDYIWSVTKTLPDGTYMYKFVVDGNWV 102

Query: 523 HSTDSATERDE-RGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPL 380
               +A + D+  G  N+V+VVG  A      QQQ +   ++  +++ L
Sbjct: 103 ADPLNANQADDGHGGKNSVVVVGQPA------QQQERVVTLVGNLQKEL 145



>gb:AC092779_1735703 Oryza sativa chromosome 3 BAC OSJNBb0024N19
           genomic sequence, complete sequence.
          Length = 466

 Score = 40.4 bits (93), Expect = 0.033
 Identities = 25/80 (31%), Positives = 36/80 (45%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH 521
           V  VW+ P  + V L G F G W    R        F   +RL  G+Y  K+I++G WR+
Sbjct: 389 VYIVWSNPASE-VLLTGSFDG-WTSQRRMERSERGTFSLNLRLYPGRYEIKFIVDGVWRN 446

Query: 520 STDSATERDERGNTNNVIVV 461
                      G+ NN++ V
Sbjct: 447 DPLRPLV-SNNGHENNLLTV 465



>pir|G72204|G72204 hypothetical protein - Thermotoga maritima
           (strain MSB8)>gb:AE001821_39734 Thermotoga maritima MSB8
           section 133 of 136 of the complete
           genome.>gb:AE000512_1114207 Thermotoga maritima MSB8,
           complete genome.
          Length = 674

 Score = 40.4 bits (93), Expect = 0.033
 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 7/101 (6%)
 Frame = -1

Query: 697 TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPR-FEAEVRLSQGKYYYKYIING-QWR 524
           TF W G +   V+L G F  NW      + +  P  + AE+ L  G Y YKY+I+G  W+
Sbjct: 30  TFEWEGAKV--VYLAGTFN-NWNPTALPMEEVEPGLWRAELELEPGTYQYKYVIDGTTWK 86

Query: 523 HSTDSATERDER-GNTNNVIVV----GDIASVRPSMQQQTK 416
              ++    D+  G  N +  +    G++  V P  ++++K
Sbjct: 87  EDPNAPGYVDDGFGGYNGIFTLVEKDGELFIVGPQKKEESK 127



 Score = 37.7 bits (86), Expect = 0.22
 Identities = 17/53 (32%), Positives = 25/53 (47%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYI 542
           V F    PE    ++ G F  NW      + K G  + A ++L+ G Y YKY+
Sbjct: 284 VVFAVRKPEASEAYVAGSFN-NWSTTANPMEKEGNLWVARIKLNPGTYQYKYV 335



>gb:AP005474_1852524 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0081C13.
          Length = 306

 Score = 39.7 bits (91), Expect = 0.057
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 2/82 (2%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTG--PRFEAEVRLSQGKYYYKYIINGQW 527
           ++  W G   +NV ++G F G  +    ++  +G   RF A + L  G+Y  K++++G+W
Sbjct: 226 ISVFWVGI-AENVQIMGSFDGWSQGEAMSMEYSGYQARFSATLNLRPGRYEIKFLVDGEW 284

Query: 526 RHSTDSATERDERGNTNNVIVV 461
           R S +   +  E    NN++VV
Sbjct: 285 RLSLEYPID-GEGSMQNNILVV 305



>gb:LES313509_1684577 Lycopersicon esculentum mRNA for protein
           tyrosine phosphatase (ptpkis1 gene).
          Length = 370

 Score = 39.3 bits (90), Expect = 0.074
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 2/84 (2%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVG-DFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQW- 527
           VT  W+G     V + G D     + P++   + G  +  +  L +GKY YKYI++G+W 
Sbjct: 247 VTLTWHGDNCTTVEISGLDIGWGQRIPLKFDEERG-LWTLQKDLHEGKYEYKYIVDGEWI 305

Query: 526 RHSTDSATERDERGNTNNVIVVGD 455
            +  +  T  ++ G+ NN + V D
Sbjct: 306 CNEFEPITSPNKDGHVNNYVEVLD 329



>gb:CR382129_1661335 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 500

 Score = 39.3 bits (90), Expect = 0.074
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 1/89 (1%)
 Frame = -1

Query: 718 GPATHAV-TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYI 542
           GP   AV T +     G+  ++ G FTG W++ +    ++   F   + L +G + ++++
Sbjct: 250 GPRPGAVRTKICYKQGGNKAYITGTFTG-WRKMLPMDRQSDGTFSVTLDLPEGTHRFRFV 308

Query: 541 INGQWRHSTDSATERDERGNTNNVIVVGD 455
           I+G+ + + D  T  D  G   N + VG+
Sbjct: 309 IDGELKCADDIGTATDSSGFLVNYLDVGN 337



>gb:AY247268_1592593 Medicago truncatula AKIN betagamma mRNA,
           complete cds.
          Length = 485

 Score = 38.9 bits (89), Expect = 0.097
 Identities = 25/88 (28%), Positives = 38/88 (43%), Gaps = 2/88 (2%)
 Frame = -1

Query: 718 GPATHAVTFVWNGPEGDNVFLVGDFTGNWKE--PIRAVHKTGPRFEAEVRLSQGKYYYKY 545
           GP      FVW    G  V+L+G FT  W E  P+  +      F+    L  G + +K+
Sbjct: 21  GPILIPKRFVWPYG-GTRVYLIGSFT-RWSEHIPMSPMEGCPSVFQVICSLMPGYHQFKF 78

Query: 544 IINGQWRHSTDSATERDERGNTNNVIVV 461
            ++GQWR+           G  N + +V
Sbjct: 79  NVDGQWRYDEQQPFVNGNYGIVNTIYLV 106



>pir|T22739|T22739 hypothetical protein F55F3.1 - Caenorhabditis
           elegans>gb:CEF55F3_1364542 Caenorhabditis elegans cosmid
           F55F3, complete sequence.
          Length = 269

 Score = 38.9 bits (89), Expect = 0.097
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = -1

Query: 721 DGPATHAVTFVWN--GPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYK 548
           D  +   V F WN        V++ G + G W   I  V  T   F   V L  GK+ YK
Sbjct: 52  DDKSKFPVVFKWNINNATPRQVYICGSWDG-WNTKIPLVKSTSD-FSTIVDLEPGKHEYK 109

Query: 547 YIINGQWRHSTDSATERDERGNTNNVIVVGD 455
           ++++ +W    +     +  G  NNV+++ +
Sbjct: 110 FMVDSKWVVDDNQQKTGNNLGGENNVVMIDE 140



>gb:AC140977_1744073 Arabidopsis thaliana chromosome 5 BAC F13M11
           genomic sequence, complete sequence.
          Length = 283

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 24/95 (25%), Positives = 40/95 (42%)
 Frame = -1

Query: 721 DGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYI 542
           D P    +  +    +G N   V     NW+   + + K+G        L  G Y+YK I
Sbjct: 93  DNPPEQGIPTIITWNQGGNDVAVEGSWDNWRSR-KKLQKSGKDHSILFVLPSGIYHYKVI 151

Query: 541 INGQWRHSTDSATERDERGNTNNVIVVGDIASVRP 437
           ++G+ ++  D     DE GN  N++ V +     P
Sbjct: 152 VDGESKYIPDLPFVADEVGNVCNILDVHNFVPENP 186



>gb:CR382129_1662102 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 1002

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = -1

Query: 724 HDGPATHAVTFVWNGPEGDN-VFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGK-YYY 551
           HD P    +T+    P+  + V L GDF  +W+       + G ++  +     GK Y Y
Sbjct: 24  HDKPKM-IITYECQTPDKPSTVQLAGDFC-DWQPQNMTPEEDGNKYTYDFDPESGKKYLY 81

Query: 550 KYIINGQWRHSTDSATERDERGNTNNVIVVGD-IASVRPSMQQQTKGA 410
           K++++G+W      AT   E G  N+VI   +  A+V    + Q K A
Sbjct: 82  KFVVDGEWVLQDGVATATTEDGAVNHVITEAESSAAVAKRKKNQKKKA 129



>gb:AY247271_1592596 Medicago truncatula AKIN beta1 mRNA, complete
           cds.
          Length = 276

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 24/88 (27%), Positives = 38/88 (43%)
 Frame = -1

Query: 700 VTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRH 521
           V   WN   G N   V     NW    + + + G      + L  G ++Y++I++G+ R+
Sbjct: 94  VMITWN--YGGNSVAVEGSWDNWASR-KVLQRGGKDHSILIVLPSGIFHYRFIVDGEQRY 150

Query: 520 STDSATERDERGNTNNVIVVGDIASVRP 437
             D     DE GN  N++ V D     P
Sbjct: 151 IPDLPYVADEMGNVCNLLDVNDYVPENP 178



>gb:ATH132315_1552003 Arabidopsis thaliana mRNA for AKIN
           beta1.>gb:AY088139_1573162 Arabidopsis thaliana clone
           41668 mRNA, complete sequence.
          Length = 284

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 24/95 (25%), Positives = 40/95 (42%)
 Frame = -1

Query: 721 DGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYI 542
           D P    +  +    +G N   V     NW+   + + K+G        L  G Y+YK I
Sbjct: 94  DNPPEQGIPTIITWNQGGNDVTVEGSWDNWRSR-KKLQKSGKDHSILFVLPSGIYHYKVI 152

Query: 541 INGQWRHSTDSATERDERGNTNNVIVVGDIASVRP 437
           ++G+ ++  D     DE GN  N++ V +     P
Sbjct: 153 VDGESKYIPDLPFVADEVGNVCNILDVHNFVPENP 187



>gb:D89138_1675256 Schizosaccharomyces pombe mRNA, partial cds,
           clone: SY 0544.
          Length = 306

 Score = 38.1 bits (87), Expect = 0.16
 Identities = 24/88 (27%), Positives = 43/88 (48%)
 Frame = -1

Query: 724 HDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKY 545
           + GP    +   W G  G+ V++ G F+  WK+ I+ +      +   ++L  G   +K+
Sbjct: 102 YSGPCVPTI-IRWRGG-GEVVYVTGSFS-RWKKKIQLLKSED--YTVLLQLRPGTQRFKF 156

Query: 544 IINGQWRHSTDSATERDERGNTNNVIVV 461
           +++G W  S+D  T  D  GN  N + V
Sbjct: 157 LVDGIWCCSSDFPTATDAEGNLYNYLEV 184



>pir|T42415|T42415 SIP2 protein homolog - fission yeast
           (Schizosaccharomyces pombe) (fragment)
          Length = 306

 Score = 38.1 bits (87), Expect = 0.16
 Identities = 24/88 (27%), Positives = 43/88 (48%)
 Frame = -1

Query: 724 HDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKY 545
           + GP    +   W G  G+ V++ G F+  WK+ I+ +      +   ++L  G   +K+
Sbjct: 102 YSGPCVPTI-IRWRGG-GEVVYVTGSFS-RWKKKIQLLKSED--YTVLLQLRPGTQRFKF 156

Query: 544 IINGQWRHSTDSATERDERGNTNNVIVV 461
           +++G W  S+D  T  D  GN  N + V
Sbjct: 157 LVDGIWCCSSDFPTATDAEGNLYNYLEV 184



>pir|T41228|T41228 5'-amp-activated protein kinase - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC1919_1721163 S.pombe
           chromosome III cosmid 1919.
          Length = 298

 Score = 38.1 bits (87), Expect = 0.16
 Identities = 24/88 (27%), Positives = 43/88 (48%)
 Frame = -1

Query: 724 HDGPATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKY 545
           + GP    +   W G  G+ V++ G F+  WK+ I+ +      +   ++L  G   +K+
Sbjct: 94  YSGPCVPTI-IRWRGG-GEVVYVTGSFS-RWKKKIQLLKSED--YTVLLQLRPGTQRFKF 148

Query: 544 IINGQWRHSTDSATERDERGNTNNVIVV 461
           +++G W  S+D  T  D  GN  N + V
Sbjct: 149 LVDGIWCCSSDFPTATDAEGNLYNYLEV 176



>gb:AF272660_494496 Bacillus stearothermophilus TS-23 putative
           coiled-coil protein and amylopullulanase (apuTS) genes,
           complete cds.
          Length = 2018

 Score = 37.4 bits (85), Expect = 0.28
 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 6/99 (6%)
 Frame = -1

Query: 700 VTFVWNGP-EGDNVFLVGDFTGNWK----EPIRAVHKTGPRFEAEVRLSQGKYYYKYIIN 536
           VTF + G  E  +V L G F  +W+    + I    ++   +     L  G Y YK++++
Sbjct: 45  VTFRYVGTGEEQSVLLAGSFN-DWQTDGEKKIELTKESDHIWSVTKTLPDGTYMYKFVVD 103

Query: 535 GQWRHSTDSATERDE-RGNTNNVIVVGDIASVRPSMQQQ 422
           G W     +  + D+  G  N+V+VVG     +P+ QQ+
Sbjct: 104 GNWMTDPLNNNKADDGYGGKNSVVVVG-----QPAQQQE 137



>gb:STU012215_1722951 Solanum tuberosum mRNA for GAL83 protein.
          Length = 289

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G+NV + G +  NW    + + ++G  +   + L  G Y+YK+I++G+ R+  +     D
Sbjct: 114 GNNVAIQGSWD-NWTSR-KILQRSGKDYTVLLVLPSGIYHYKFIVDGEVRYIPELPCVAD 171

Query: 493 ERGNTNNVIVVGD 455
           E G   N++ V D
Sbjct: 172 ETGVVFNLLDVND 184



>gb:AY245177_1592537 Lycopersicon esculentum SNF1 kinase complex
           anchoring protein (GAL83) mRNA, partial cds.
          Length = 230

 Score = 37.0 bits (84), Expect = 0.37
 Identities = 21/73 (28%), Positives = 39/73 (53%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G+NV + G +  NW    + + ++G  +   + L  G Y+YK+I++G+ R+  +     D
Sbjct: 97  GNNVAIQGSWD-NWTSR-KILQRSGKDYTVLLVLPSGIYHYKFIVDGEVRYIPELPCVAD 154

Query: 493 ERGNTNNVIVVGD 455
           E G   N++ V D
Sbjct: 155 ETGVVFNLLDVND 167



>gb:AP006878_576129 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 765

 Score = 36.2 bits (82), Expect = 0.63
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = -1

Query: 667 NVFLVGDFTGNWKE-PIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQW-RHSTDSATER 497
           +V L G F  NW E P+   + T   +E  V L  G+Y YKY INGQW +  +D  T R
Sbjct: 101 SVSLRGSFN-NWGEWPMELKNGT---WETTVCLRPGRYEYKYFINGQWVKDMSDDGTGR 155



>gb:CR858254_1182439 Pongo pygmaeus mRNA; cDNA DKFZp469M1118 (from
           clone DKFZp469M1118).
          Length = 190

 Score = 35.8 bits (81), Expect = 0.82
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = -1

Query: 592 FEAEVRLSQGKYYYKYIINGQWRHSTDSATERDERGNTNNVIVV 461
           F A + L +G++ YK+ ++GQW H         + G  NN+I V
Sbjct: 30  FVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHV 73



>gb:AE016815_1746102 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 1766

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 23/86 (26%), Positives = 43/86 (50%), Gaps = 4/86 (4%)
 Frame = -1

Query: 697 TFVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLS---QGKYYYKYIINGQ 530
           TF W +GP+   V + GDF   W+  +    +    F  ++ +      K+Y+K+I++GQ
Sbjct: 5   TFTWPSGPK--KVVITGDFD-RWQGTVPLEKQPSGDFVVQLPIGVVESDKFYFKFIVDGQ 61

Query: 529 WRHSTDSATERDERGNTNNVIVVGDI 452
           W  ++D   +    G  NN ++V  +
Sbjct: 62  W-VTSDLYPKDSLTGAENNYVLVSSV 86



>gb:CR382124_1656689 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 456

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 29/112 (25%), Positives = 47/112 (41%), Gaps = 4/112 (3%)
 Frame = -1

Query: 697 TFVW-NGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRL---SQGKYYYKYIINGQ 530
           TF W  GP+   V + G+F  NW   +  V +    F   + L      K+ +K+I++G+
Sbjct: 5   TFTWPKGPQ--EVVVTGNFD-NWTGSLPLVKQPSGDFSLTMPLPPNDDDKFVFKFIVDGE 61

Query: 529 WRHSTDSATERDERGNTNNVIVVGDIASVRPSMQQQTKGANIIKVIERPLTE 374
           W  S D   +    G  NNVI    I           + A   K  ++P ++
Sbjct: 62  WVVS-DKYEKDSSAGPINNVIYTSKIVGTTTGSTFIPESALSAKTSQKPKSQ 112



>gb:AY143878_1583335 Arabidopsis thaliana At3g52180/F4F15_290 mRNA,
           complete cds.>gb:AF439823_1799999 Arabidopsis thaliana
           AT3g52180/F4F15_290 mRNA, complete cds.
          Length = 379

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 574 LSQGKYYYKYIINGQWRHS-TDSATERDERGNTNNVI-VVGDIASV 443
           L +G++ YKYII+G+W H+  +     ++ G+TNN   VV D  SV
Sbjct: 299 LPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYAKVVDDPTSV 344



>gb:AY084675_1569763 Arabidopsis thaliana clone 114734 mRNA,
           complete sequence.
          Length = 379

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 574 LSQGKYYYKYIINGQWRHS-TDSATERDERGNTNNVI-VVGDIASV 443
           L +G++ YKYII+G+W H+  +     ++ G+TNN   VV D  SV
Sbjct: 299 LPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYAKVVDDPTSV 344



>gb:ATH302779_1552431 Arabidopsis thaliana f4F15.290 gene for
           PTPKIS1 and alternative splice
           form.>gb:ATH302781_1552434 Arabidopsis thaliana mRNA for
           PTPKIS1 (full length RNA).
          Length = 379

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 574 LSQGKYYYKYIINGQWRHS-TDSATERDERGNTNNVI-VVGDIASV 443
           L +G++ YKYII+G+W H+  +     ++ G+TNN   VV D  SV
Sbjct: 299 LPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYAKVVDDPTSV 344



>pir|T49097|T49097 hypothetical protein F4F15.290 - Arabidopsis
           thaliana>gb:ATF4F15_1550684 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F4F15.
          Length = 347

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 2/46 (4%)
 Frame = -1

Query: 574 LSQGKYYYKYIINGQWRHS-TDSATERDERGNTNNVI-VVGDIASV 443
           L +G++ YKYII+G+W H+  +     ++ G+TNN   VV D  SV
Sbjct: 267 LPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNNYAKVVDDPTSV 312



>gb:AF004841_1875913 Homo sapiens CDO mRNA, complete cds.
          Length = 1264

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = -1

Query: 712 ATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIING 533
           A +++  + +GP   +V ++GDF  + K  I A  K+       V  S  K   +Y I G
Sbjct: 99  ANNSIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRG 158

Query: 532 QW-RHSTDS 509
           +W  HST++
Sbjct: 159 KWLEHSTEN 167



>gb:AC129718_1740645 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088I06, complete sequence.
          Length = 290

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 21/73 (28%), Positives = 37/73 (50%)
 Frame = -1

Query: 673 GDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTDSATERD 494
           G+ VF+ G +  NW    R + K+G      + L  G Y+Y+ I++G+ ++  +     D
Sbjct: 105 GNEVFVEGSWD-NWTSR-RVLEKSGKDHTILLVLPSGVYHYRIIVDGEPKYVPELPHVAD 162

Query: 493 ERGNTNNVIVVGD 455
           E G   N++ V D
Sbjct: 163 EGGQVANLLDVHD 175



>gb:AC113930_1739083 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1384D03, complete sequence.
          Length = 281

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%)
 Frame = -1

Query: 568 QGKYYYKYIINGQW-RHSTDSATERDERGNTNNVIVVG--DIASVRPSMQQQTKGANIIK 398
           +G+Y YKYI++G+W  +  +  T+ +  G+ NN + V     +     ++++  G N   
Sbjct: 200 EGRYEYKYIVDGKWVCNDNEKKTKANADGHVNNYVQVSRDGTSDEERELRERLTGQN--- 256

Query: 397 VIERPLTENERFML 356
                LT+ ER M+
Sbjct: 257 ---PDLTKEERLMI 267



>pir|T03097|T03097 CDO protein - human
          Length = 1240

 Score = 34.3 bits (77), Expect = 2.4
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = -1

Query: 712 ATHAVTFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIING 533
           A +++  + +GP   +V ++GDF  + K  I A  K+       V  S  K   +Y I G
Sbjct: 75  ANNSIGAIVSGPATVSVAVLGDFGSSTKHVITAEEKSAGFIGCRVPESNPKAEVRYKIRG 134

Query: 532 QW-RHSTDS 509
           +W  HST++
Sbjct: 135 KWLEHSTEN 143



>gb:AE005172_891586 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC000348_1530065 Genomic sequence
           for Arabidopsis thaliana BAC T7N9 from chromosome I,
           complete sequence.
          Length = 532

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 18/58 (31%), Positives = 27/58 (46%)
 Frame = -1

Query: 697 TFVWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWR 524
           + VW     + V L G F G W    +        F   ++L  GKY  K+I++GQW+
Sbjct: 456 SIVWPNSASE-VLLTGSFDG-WSTQRKMKKAENGVFSLSLKLYPGKYEIKFIVDGQWK 511



>gb:ATH302779_1552432 Arabidopsis thaliana f4F15.290 gene for
           PTPKIS1 and alternative splice
           form.>gb:ATH302780_1552433 Arabidopsis thaliana mRNA for
           PTPKIS1 (truncated form).
          Length = 239

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%)
 Frame = -1

Query: 574 LSQGKYYYKYIINGQWRHS-TDSATERDERGNTNN 473
           L +G++ YKYII+G+W H+  +     ++ G+TNN
Sbjct: 193 LPEGQFEYKYIIDGEWTHNEAEPFIGPNKDGHTNN 227



>sp|Q8DT52|GLGB_STRMU 1,4-alpha-glucan branching enzyme (EC
           2.4.1.18) (Glycogen branching enzyme) (BE)
           (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-
           transferase).>gb:AE014985_313862 Streptococcus mutans
           UA159 section 133 of 185 of the complete
           genome.>gb:AE014133_940863 Streptococcus mutans UA159
           complete genome.
          Length = 628

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 4/79 (5%)
 Frame = -1

Query: 691 VWNGPEGDNVFLVGDFTGNWKEPIRAVHKTGPRFEAEVRLSQGKYYYKYIINGQWRHSTD 512
           VW  P  +++ L+GDFTG +  P++        +E    L +  + YKY++  Q     +
Sbjct: 39  VW-APNAEDLHLIGDFTGWFDNPLQMDKNEAGVWEVFTDLPKEGHIYKYLVKRQGGQIVE 97

Query: 511 S----ATERDERGNTNNVI 467
                A   +ER  T ++I
Sbjct: 98  KMDPFAIYLEERPGTGSLI 116



>gb:AP004253_1839167 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1116_C07.
          Length = 1115

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 11/63 (17%)
 Frame = +3

Query: 237 HITDLGYH*PS*ECCSSIVRYFGASLIG--QIENAIHRAAFASIKRS---------FSVN 383
           ++ D+G   P   CC  +VR  G    G  QIE +IH A F+ I+++         F ++
Sbjct: 744 YVLDIGEVGPRATCCCQVVRSVGPWSAGTTQIEGSIHNAYFSLIEKAEHFVYIENQFFIS 803

Query: 384 GLS 392
           GLS
Sbjct: 804 GLS 806



>pir|B72510|B72510 hypothetical protein APE2056 - Aeropyrum pernix
           (strain K1)>gb:BA000002_652810 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 155

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%)
 Frame = -1

Query: 634 WKEPIRAVHKTGPRFEAEVRLSQGKY---YYKYIINGQ 530
           W+ P   + K  PR  AEV   QGK+   YY  I+NG+
Sbjct: 111 WRRPEEFIEKLWPRSLAEVLAKQGKHAKPYYLVIVNGR 148



>sp|Q63505|T3C1_RAT General transcription factor 3C polypeptide 1
            (Transcription factor IIIC-alpha subunit) (TF3C-alpha)
            (TFIIIC 220 kDa subunit) (TFIIIC220) (TFIIIC box
            B-binding subunit).>pir|A56011|A56011 transcription
            factor IIIC alpha chain - rat>gb:RATRFIIICA_2133705 Rat
            transcription factor IIIC alpha-subunit mRNA, complete
            cds.
          Length = 2148

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%)
 Frame = +3

Query: 558  YFPCESLTSASNLGPVLWTALIGSFQFPVK---SPTKKTLSPSGPFHTKVTACVAGPSCL 728
            Y+    + S  NL P   + ++ S Q   +   +P    L P+GP  T +    AGPSCL
Sbjct: 1643 YYTVPGMVSTRNLNPND-SIVVNSCQVKFRLRNTPAPTHLGPTGPTATPLEELQAGPSCL 1701

Query: 729  P 731
            P
Sbjct: 1702 P 1702


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 743,521,141
Number of Sequences: 1806583
Number of extensions: 14311788
Number of successful extensions: 30365
Number of sequences better than 10.0: 92
Number of HSP's better than 10.0 without gapping: 29450
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30352
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 44325214704
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)