BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11951
         (750 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP003872_1834606 Oryza sativa (japonica cultivar-group) genom...   217   2e-55   
gb:OSJN00208_1696719 Oryza sativa genomic DNA, chromosome 4, BAC...   216   5e-55   
gb:AY048281_1561742 Arabidopsis thaliana AT5g15220/F8M21_110 mRN...   215   6e-55   
gb:AC005167_1532228 Arabidopsis thaliana chromosome 2 clone F12A...   214   1e-54   
pir|T49957|T49957 ribosomal protein L27-like - Arabidopsis thali...   213   2e-54   Arabidopsis thaliana [mouse-ear cress]
pir|A84546|A84546 50S ribosomal protein L27 [imported] - Arabido...   197   2e-49   Arabidopsis thaliana [mouse-ear cress]
gb:BX897699_826773 Bartonella henselae strain Houston-1, complet...   113   3e-24   
sp|Q83ED9|RL27_COXBU|RL27_COXBU 50S ribosomal protein L27.>gb:AE016961_3676...   112   7e-24   Coxiella burnetii
sp|Q87SU3|RL27_VIBPA|RL27_VIBPA 50S ribosomal protein L27.>gb:BA000031_7057...   111   1e-23   
gb:CP000020_870455 Vibrio fischeri ES114 chromosome I, complete ...   111   2e-23   
gb:BX897700_828378 Bartonella quintana str. Toulouse, complete g...   111   2e-23   
sp|Q8UBR6|RL27_AGRT5|RL27_AGRT5 50S ribosomal protein L27.>pir|AG2918|AG291...   111   2e-23   Agrobacterium tumefaciens
sp|Q9KUS9|RL27_VIBCH|RL27_VIBCH 50S ribosomal protein L27.>pir|C82322|C8232...   110   3e-23   
sp|Q8DEC5|RL27_VIBVU|RL27_VIBVU 50S ribosomal protein L27.>gb:AE016799_3354...   109   6e-23   Vibrio vulnificus
sp|Q92LB7|RL27_RHIME|RL27_RHIME 50S ribosomal protein L27.>gb:SME591793_187...   108   1e-22   Sinorhizobium meliloti
sp|Q889F2|RL27_PSESM|RL27_PSESM 50S ribosomal protein L27.>gb:AE016858_3502...   108   1e-22   Pseudomonas syringae pv. tomato
gb:CR378664_93804 Photobacterium profundum SS9; segment 2/12.         107   2e-22   
sp|Q8EB81|RL27_SHEON|RL27_SHEON 50S ribosomal protein L27.>gb:AE015800_3179...   107   2e-22   Shewanella oneidensis
sp|Q98EZ0|RL27_RHILO|RL27_RHILO 50S ribosomal protein L27.>gb:BA000012_6690...   107   2e-22   Mesorhizobium loti
gb:CR628336_112820 Legionella pneumophila str. Paris complete ge...   106   5e-22   
sp|Q7VP91|RL27_HAEDU|RL27_HAEDU 50S ribosomal protein L27.>gb:AE017151_3918...   106   5e-22   [Haemophilus] ducreyi
sp|Q8VW58|RL27_BRUAB|RL27_BRUAB 50S ribosomal protein L27.>sp|Q8FYL8|RL27_B...   106   5e-22   Brucella abortus bv. 1
gb:CR543861_104749 Acinetobacter sp. ADP1 complete genome.            105   9e-22   
gb:BX571874_789396 Photorhabdus luminescens subsp. laumondii TTO...   105   1e-21   
gb:AJ749949_531230 Francisella tularensis subsp. tularensis comp...   105   1e-21   
gb:AE017340_456241 Idiomarina loihiensis L2TR, complete genome.       105   1e-21   
gb:AE017282_428962 Methylococcus capsulatus str. Bath, complete ...   105   1e-21   
gb:AE016827_343227 Mannheimia succiniciproducens MBEL55E, comple...   105   1e-21   
sp|Q8D278|RL27_WIGBR|RL27_WIGBR 50S ribosomal protein L27.>gb:BA000021_6872...   105   1e-21   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
sp|Q9CNS7|RL27_PASMU|RL27_PASMU 50S ribosomal protein L27.>gb:AE006071_2152...   105   1e-21   Pasteurella multocida
gb:AF153712_483850 Pseudomonas sp. BG33R strain BG33R 50S riboso...   104   2e-21   
pir|F64099|F64099 ribosomal protein L27 - Haemophilus influenzae...   104   2e-21   Haemophilus influenzae
sp|Q8ZBA7|RL27_YERPE|RL27_YERPE 50S ribosomal protein L27.>pir|AH0426|AH042...   104   2e-21   Yersinia pestis
sp|P44363|RL27_HAEIN|RL27_HAEIN 50S ribosomal protein L27.                       104   2e-21   Haemophilus influenzae
gb:CR555306_105850 Azoarcus sp. EbN1 complete genome.                 103   3e-21   
gb:AE014295_312182 Bifidobacterium longum NCC2705, complete genome.   103   3e-21   
sp|Q9ABB3|RL27_CAUCR|RL27_CAUCR 50S ribosomal protein L27.>pir|E87288|E8728...   103   3e-21   Caulobacter vibrioides
sp|Q8YJ84|RL27_BRUME|RL27_BRUME 50S ribosomal protein L27.                       103   3e-21   
gb:BX842656_826574 Bdellovibrio bacteriovorus complete genome, s...   103   4e-21   
gb:CP000027_80298 Dehalococcoides ethenogenes 195, complete genome.   102   6e-21   
sp|Q9HVL7|RL27_PSEAE|RL27_PSEAE 50S ribosomal protein L27.>pir|A83075|A8307...   102   7e-21   Pseudomonas aeruginosa
gb:BX950851_839442 Erwinia carotovora subsp. atroseptica SCRI104...   102   1e-20   
gb:CR767821_116842 Ehrlichia ruminantium strain Welgevonden, com...   102   1e-20   
gb:CP000030_83535 Anaplasma marginale str. St. Maries, complete ...   102   1e-20   
gb:BX572593_799775 Rhodopseudomonas palustris CGA009 complete ge...   101   1e-20   
pir|JS0767|R5EC27 ribosomal protein L27 [validated] - Escherichi...   101   1e-20   
sp|P02427|RL27_ECOLI|RL27_ECOLI 50S ribosomal protein L27.                       101   1e-20   Escherichia coli [E. coli]
gb:AY657060_2146070 Synthetic construct Peudomonas aeruginosa cl...   101   2e-20   
sp|Q8Z0F1|RL27_ANASP|RL27_ANASP 50S ribosomal protein L27.>pir|AB1825|AB182...   100   2e-20   Anabaena sp.
pir|AF0903|AF0903 50S ribosomal chain protein L27 [imported] - S...   100   3e-20   Salmonella enterica subsp. enterica serovar Typhi
sp|Q8XGK4|RL27_SALTY|RL27_SALTY 50S ribosomal protein L27.                       100   3e-20   Salmonella enterica subsp. enterica serovar Typhimurium
sp|Q9JRI8|RL27_NEIMA|RL27_NEIMA 50S ribosomal protein L27.>pir|G81212|G8121...   100   4e-20   
sp|Q8REI3|RL27_FUSNN|RL27_FUSNN 50S ribosomal protein L27.>gb:AE010616_2650...   100   4e-20   Fusobacterium nucleatum subsp. nucleatum
gb:AE004969_61331 Neisseria gonorrhoeae FA 1090, complete genome.     100   5e-20   
sp|Q88Q09|RL27_PSEPK|RL27_PSEPK 50S ribosomal protein L27.>gb:AE016776_3301...    99   6e-20   Pseudomonas putida
sp|Q8F7U1|RL27_LEPIN|RL27_LEPIN 50S ribosomal protein L27.>gb:AE011270_2710...    99   6e-20   
sp|Q89X93|RL27_BRAJA|RL27_BRAJA 50S ribosomal protein L27.>gb:BA000040_7286...    99   6e-20   Bradyrhizobium japonicum
sp|Q7VQN1|RL27_CANBF|RL27_CANBF 50S ribosomal protein L27.>gb:BX248584_7637...    99   1e-19   Candidatus Blochmannia floridanus
gb:AP006840_567620 Symbiobacterium thermophilum DNA, complete ge...    98   1e-19   
gb:AE008692_239947 Zymomonas mobilis subsp. mobilis ZM4, complet...    98   1e-19   
gb:AE017173_396670 Porphyromonas gingivalis W83 section 2 of 8 o...    98   2e-19   
gb:AE016944_363679 Bacteroides thetaiotaomicron VPI-5482, sectio...    98   2e-19   
sp|Q87BL1|RL27_XYLFT|RL27_XYLFT 50S ribosomal protein L27.>gb:AE012558_2848...    98   2e-19   Xylella fastidiosa
sp|Q9PAS2|RL27_XYLFA|RL27_XYLFA 50S ribosomal protein L27.>pir|H82559|H8255...    98   2e-19   Xylella fastidiosa
sp|P56050|RL27_HELPY|RL27_HELPY 50S ribosomal protein L27.>pir|A64557|A6455...    98   2e-19   Helicobacter pylori
sp|Q9ZMD8|RL27_HELPJ|RL27_HELPJ 50S ribosomal protein L27.>pir|E71951|E7195...    98   2e-19   Helicobacter pylori
gb:AE017180_401523 Geobacter sulfurreducens PCA, complete genome.      97   2e-19   
sp|Q92GG0|RL27_RICCN|RL27_RICCN 50S ribosomal protein L27.>pir|C97845|C9784...    97   2e-19   Rickettsia conorii
sp|P30155|RK27_TOBAC|RK27_TOBAC 50S ribosomal protein L27, chloroplast prec...    97   2e-19   Nicotiana tabacum [American tobacco]
gb:CP000009_862177 Gluconobacter oxydans 621H, complete genome.        97   3e-19   
gb:AP006841_571536 Bacteroides fragilis YCH46 DNA, complete genome.    97   3e-19   
gb:AE013598_295322 Xanthomonas oryzae pv. oryzae KACC10331, comp...    97   3e-19   
sp|Q7VK83|RL27_HELHP|RL27_HELHP 50S ribosomal protein L27.>gb:AE017144_3897...    97   3e-19   Helicobacter hepaticus
gb:BX571658_777896 Wolinella succinogenes, complete genome; segm...    97   4e-19   
sp|Q9RY65|RL27_DEIRA|RL27_DEIRA 50S ribosomal protein L27.>pir|E75560|E7556...    97   4e-19   Deinococcus radiodurans
sp|Q8PN24|RL27_XANAC|RL27_XANAC 50S ribosomal protein L27.>gb:AE011754_2761...    96   5e-19   Xanthomonas citri
sp|Q7WQL7|RL27_BORBR|RL27_BORBR 50S ribosomal protein L27.>sp|Q7W1P1|RL27_B...    96   5e-19   Bordetella bronchiseptica
sp|Q9ZCI8|RL27_RICPR|RL27_RICPR 50S ribosomal protein L27.>pir|D71635|D7163...    96   9e-19   Rickettsia prowazekii
sp|P57468|RL27_BUCAI|RL27_BUCAI 50S ribosomal protein L27.>pir|C84975|C8497...    96   9e-19   
gb:AE017305_437057 Thermus thermophilus HB27 section 5 of 7 of t...    95   1e-18   
sp|Q8PBH1|RL27_XANCP|RL27_XANCP 50S ribosomal protein L27.>gb:AE012213_2804...    95   1e-18   Xanthomonas campestris pv. campestris
sp|Q8RBA7|RL27_THETN|RL27_THETN 50S ribosomal protein L27.>gb:AE013057_2885...    95   1e-18   
sp|Q8K9G2|RL27_BUCAP|RL27_BUCAP 50S ribosomal protein L27.>gb:AE014114_3032...    95   1e-18   
gb:BA000045_740899 Gloeobacter violaceus PCC 7421 DNA, complete ...    95   2e-18   
gb:AE017256_417942 Wolbachia endosymbiont of Drosophila melanoga...    95   2e-18   
gb:AE017197_402699 Rickettsia typhi str. Wilmington complete gen...    95   2e-18   
sp|Q82V19|RL27_NITEU|RL27_NITEU 50S ribosomal protein L27.>gb:BX321860_7736...    95   2e-18   Nitrosomonas europaea
sp|P59513|RL27_BUCBP|RL27_BUCBP 50S ribosomal protein L27.>gb:AE014017_3027...    95   2e-18   
gb:CP000031_86022 Silicibacter pomeroyi DSS-3, complete genome.        94   2e-18   
sp|P74267|RL27_SYNY3|RL27_SYNY3 50S ribosomal protein L27.>pir|S75902|S7590...    94   2e-18   Synechocystis sp.
sp|Q9Z3H6|RL27_SYNP7|RL27_SYNP7 50S ribosomal protein L27.>pir|T44265|T4426...    94   2e-18   Synechococcus sp.
sp|Q9PJ31|RL27_CAMJE|RL27_CAMJE 50S ribosomal protein L27.>pir|G81425|G8142...    94   2e-18   
sp|P49561|RK27_ODOSI|RK27_ODOSI Chloroplast 50S ribosomal protein L27.>pir|...    94   2e-18   
gb:AP008226_579239 Thermus thermophilus HB8 genomic DNA, complet...    94   3e-18   
gb:BX572093_796971 Prochlorococcus marinus MED4 complete genome;...    94   3e-18   
sp|Q8FN77|RL27_COREF|RL27_COREF 50S ribosomal protein L27.>gb:BA000035_7170...    93   5e-18   Corynebacterium efficiens
gb:AY085449_1570518 Arabidopsis thaliana clone 152076 mRNA, comp...    93   6e-18   
sp|P46288|RL27_CRYNE|RL27_CRYNE 60S ribosomal protein L27, mitochondrial pr...    93   6e-18   Cryptococcus neoformans
sp|Q9FLN4|RK27_ARATH|RK27_ARATH 50S ribosomal protein L27, chloroplast prec...    93   6e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AE017283_430616 Propionibacterium acnes KPA171202, complete g...    92   8e-18   
gb:BX571965_792803 Burkholderia pseudomallei strain K96243, chro...    92   1e-17   
gb:BX294144_768793 Pirellula sp. strain 1 complete genome; segme...    92   1e-17   
gb:AE016912_355810 Chromobacterium violaceum ATCC 12472 section ...    92   1e-17   
sp|Q82C86|RL27_STRAW|RL27_STRAW 50S ribosomal protein L27.>gb:BA000030_7033...    92   1e-17   Streptomyces avermitilis
sp|P51210|RK27_PORPU|RK27_PORPU Chloroplast 50S ribosomal protein L27.>pir|...    92   1e-17   Porphyra purpurea
sp|O65037|RK27_ORYSA|RK27_ORYSA 50S ribosomal protein L27, chloroplast prec...    92   1e-17   Oryza sativa [red rice]
sp|O78430|RK27_GUITH|RK27_GUITH Chloroplast 50S ribosomal protein L27.>gb:A...    92   1e-17   Guillardia theta
gb:AE017321_442332 Wolbachia endosymbiont strain TRS of Brugia m...    91   2e-17   
sp|Q8XVK9|RL27_RALSO|RL27_RALSO 50S ribosomal protein L27.>gb:AL646072_5477...    91   2e-17   Ralstonia solanacearum
sp|O51721|RL27_BORBU|RL27_BORBU 50S ribosomal protein L27.>pir|C70197|C7019...    91   2e-17   Borreliella burgdorferi
sp|O21275|RM27_RECAM|RM27_RECAM Mitochondrial 60S ribosomal protein L27.>pi...    91   2e-17   Reclinomonas americana
sp|Q97JL5|RL27_CLOAB|RL27_CLOAB 50S ribosomal protein L27.>pir|C97055|C9705...    91   2e-17   Clostridium acetobutylicum
gb:AY673996_1621373 Gracilaria tenuistipitata var. liui chloropl...    91   3e-17   
sp|Q8NN51|RL27_CORGL|RL27_CORGL 50S ribosomal protein L27.>gb:BA000036_7200...    91   3e-17   Corynebacterium glutamicum
sp|Q9FD28|RL27_BURPS|RL27_BURPS 50S ribosomal protein L27.>gb:AF292383_4965...    91   3e-17   Burkholderia pseudomallei
gb:BX248359_763050 Corynebacterium diphtheriae gravis NCTC13129,...    90   4e-17   
gb:AY552545_627882 Uncultured marine gamma proteobacterium EBAC2...    90   4e-17   
sp|Q9X1G7|RL27_THEMA|RL27_THEMA 50S ribosomal protein L27.>pir|A72251|A7225...    90   4e-17   Thermotoga maritima
sp|Q7U8R7|RL27_SYNPX|RL27_SYNPX 50S ribosomal protein L27.>gb:BX569690_7754...    90   4e-17   Synechococcus sp.
sp|Q9L1I1|RL27_STRCO|RL27_STRCO 50S ribosomal protein L27.>gb:SCO939113_176...    90   4e-17   
gb:AY268081_604357 Candidatus Portiera aleyrodidarum, partial ge...    90   5e-17   
sp|P95757|RL27_STRGR|RL27_STRGR 50S ribosomal protein L27.>gb:D87916_120983...    90   5e-17   Streptomyces griseus
gb:AE016814_1745810 Ashbya gossypii (= Eremothecium gossypii) AT...    89   7e-17   
sp|O67650|RL27_AQUAE|RL27_AQUAE 50S ribosomal protein L27.>pir|H70452|H7045...    89   7e-17   Aquifex aeolicus
sp|Q9CGL5|RL27_LACLA|RL27_LACLA 50S ribosomal protein L27.>pir|A86760|A8676...    89   9e-17   Lactococcus lactis subsp. lactis
gb:AE017251_416791 Treponema denticola ATCC 35405, section 6 of ...    89   1e-16   
gb:CP000013_870007 Borrelia garinii PBi, complete genome.              88   1e-16   
sp|O87885|RL27_LAWIN|RL27_LAWIN 50S ribosomal protein L27.>gb:LIU45241_1406...    88   2e-16   Lawsonia intracellularis
sp|P94689|RL27_CHLVI|RL27_CHLVI 50S ribosomal protein L27 (Fragment).>gb:CV...    88   2e-16   Prosthecochloris vibrioformis
sp|P41545|RK27_PLECA|RK27_PLECA Chloroplast 50S ribosomal protein L27.>pir|...    88   2e-16   Chrysotila carterae
sp|Q8EVW5|RL27_MYCPE|RL27_MYCPE 50S ribosomal protein L27.>gb:BA000026_6937...    87   2e-16   Mycoplasma penetrans
gb:AE017312_439181 Desulfovibrio vulgaris subsp. vulgaris str. H...    87   3e-16   
sp|Q8KCB7|RL27_CHLTE|RL27_CHLTE 50S ribosomal protein L27.>gb:AE012907_2869...    87   3e-16   Chlorobaculum tepidum
sp|O83725|RL27_TREPA|RL27_TREPA 50S ribosomal protein L27.>pir|D71286|D7128...    87   4e-16   Treponema pallidum
sp|Q7V5W4|RL27_PROMM|RL27_PROMM 50S ribosomal protein L27.>gb:BX572099_7987...    87   4e-16   Prochlorococcus marinus
sp|O19885|RK27_CYACA|RK27_CYACA Chloroplast 50S ribosomal protein L27.>pir|...    87   4e-16   Cyanidium caldarium
sp|Q8DMF2|RL27_SYNEL|RL27_SYNEL 50S ribosomal protein L27.>gb:BA000039_7259...    86   6e-16   Synechococcus elongatus
sp|Q7VAN2|RL27_PROMA|RL27_PROMA 50S ribosomal protein L27.>gb:AE017165_3958...    86   6e-16   Prochlorococcus marinus
sp|Q9K8J7|RL27_BACHD|RL27_BACHD 50S ribosomal protein L27.>pir|A84026|A8402...    86   6e-16   Bacillus halodurans
gb:AY458644_619833 Uncultured bacterium 562 clone EBAC000-45B06 ...    86   7e-16   
gb:AP006618_557748 Nocardia farcinica IFM 10152 DNA, complete ge...    86   7e-16   
gb:AE017333_448751 Bacillus licheniformis DSM 13, complete genom...    86   7e-16   
gb:CR522870_101436 Desulfotalea psychrophila LSv54 chromosome.         86   7e-16   
sp|Q8XIJ1|RL27_CLOPE|RL27_CLOPE 50S ribosomal protein L27.>gb:BA000016_6751...    86   7e-16   Clostridium perfringens
gb:AE016822_339940 Leifsonia xyli subsp. xyli str. CTCB07, compl...    86   9e-16   
gb:AB002583_1508744 Cyanidioschyzon merolae chloroplast DNA, com...    85   1e-15   
gb:AP006627_564919 Bacillus clausii KSM-K16 DNA, complete genome.      85   1e-15   
gb:SPBP19A11_1720578 S.pombe chromosome II cosmid p19A11.              85   2e-15   
sp|P75458|RL27_MYCPN|RL27_MYCPN 50S ribosomal protein L27.>pir|S73835|S7383...    85   2e-15   Mycoplasma pneumoniae
sp|Q892N6|RL27_CLOTE|RL27_CLOTE 50S ribosomal protein L27.>gb:AE015943_3211...    85   2e-15   Clostridium tetani
gb:AE017235_412970 Mycobacterium avium subsp. paratuberculosis s...    84   2e-15   
gb:AE017263_420994 Mesoplasma florum L1 complete genome.               84   3e-15   
sp|P05657|RL27_BACSU|RL27_BACSU 50S ribosomal protein L27 (BL30) (BL24).>pi...    84   3e-15   Bacillus subtilis
sp|Q817U4|RL27_BACCR|RL27_BACCR 50S ribosomal protein L27.>gb:AE017012_3793...    84   3e-15   Bacillus cereus
gb:AE017308_437927 Mycoplasma mobile 163K complete genome.             84   4e-15   
sp|Q81LE8|RL27_BACAN|RL27_BACAN 50S ribosomal protein L27.>gb:AE017038_3846...    84   4e-15   Bacillus anthracis [anthrax]
sp|Q9CBZ3|RL27_MYCLE|RL27_MYCLE 50S ribosomal protein L27.>pir|C87092|C8709...    83   5e-15   Mycobacterium leprae
gb:BA000043_739185 Geobacillus kaustophilus HTA426 DNA, complete...    83   6e-15   
gb:AE016851_348996 Tropheryma whipplei str. Twist, section 2 of ...    83   6e-15   
sp|Q836X4|RL27_ENTFA|RL27_ENTFA 50S ribosomal protein L27.>gb:AE016950_3650...    83   6e-15   Enterococcus faecalis
gb:BX842643_822570 Mycoplasma mycoides subsp. mycoides SC genomi...    82   1e-14   
sp|Q8CS89|RL27_STAEP|RL27_STAEP 50S ribosomal protein L27.>gb:CP000029_8181...    82   1e-14   Staphylococcus epidermidis
sp|Q931Q3|RL27_STAAM|RL27_STAAM 50S ribosomal protein L27.>sp|Q99TK8|RL27_S...    82   1e-14   Staphylococcus aureus
gb:AE017204_404712 Lactobacillus johnsonii NCC 533, section 5 of...    82   1e-14   
sp|P41552|RK27_PLEHA|RK27_PLEHA Chloroplast 50S ribosomal protein L27 (Frag...    82   1e-14   Pleurochrysis haptonemofera
gb:CR382126_1658904 Kluyveromyces lactis strain NRRL Y-1140 chro...    81   2e-14   
gb:CR380954_1651222 Candida glabrata strain CBS138 chromosome H ...    81   2e-14   
gb:ARGTE1826_582538 Arthrobacter sp. gene for sarcosine oxidase,...    81   2e-14   
gb:AP006628_566523 Onion yellows phytoplasma OY-M DNA, complete ...    81   2e-14   
sp|P48535|RM02_KLULA|RM02_KLULA 60S ribosomal protein L2, mitochondrial pre...    81   2e-14   Kluyveromyces lactis
gb:BX251411_764494 Tropheryma whipplei TW08/27, complete genome;...    81   2e-14   
sp|Q8EPP8|RL27_OCEIH|RL27_OCEIH 50S ribosomal protein L27.>gb:BA000028_6964...    81   2e-14   Oceanobacillus iheyensis
gb:AE014185_937908 Plasmodium falciparum 3D7 chromosome 10 compl...    80   3e-14   
sp|P71908|RL27_MYCTU|RL27_MYCTU 50S ribosomal protein L27.>pir|G70680|G7068...    80   3e-14   Mycobacterium tuberculosis
gb:CR382139_1672501 Debaryomyces hansenii chromosome G of strain...    80   4e-14   
sp|P41550|RK27_CHRHI|RK27_CHRHI Chloroplast 50S ribosomal protein L27 (Frag...    80   4e-14   Haptolina hirta
gb:SCN200XG_1708816 s.cerevisiae N2005, N2007, N2009, N2012, N20...    80   5e-14   
sp|P12687|RM02_YEAST|RM02_YEAST 60S ribosomal protein L2, mitochondrial pre...    80   5e-14   Saccharomyces cerevisiae [brewer's yeast]
pir|AE3277|AE3277 LSU ribosomal protein L27P [imported] - Brucel...    79   7e-14   Brucella melitensis
sp|Q9Z807|RL27_CHLPN|RL27_CHLPN 50S ribosomal protein L27.>pir|B72065|B7206...    79   7e-14   Chlamydia pneumoniae
gb:BX908798_829774 Parachlamydia-related symbiont UWE25, complet...    79   9e-14   
sp|Q8DUQ4|RL27_STRMU|RL27_STRMU 50S ribosomal protein L27.>gb:AE014926_3132...    79   9e-14   Streptococcus mutans serotype C
sp|O84424|RL27_CHLTR|RL27_CHLTR 50S ribosomal protein L27.>pir|E81673|E8167...    79   9e-14   Chlamydia trachomatis
gb:AE016968_369638 Mycoplasma gallisepticum strain R section 2 o...    79   1e-13   
gb:AE014254_306672 Streptococcus agalactiae 2603V/R section 64 o...    79   1e-13   
gb:SAG766850_170966 Streptococcus agalactiae NEM316 complete gen...    79   1e-13   
sp|Q9PQT2|RL27_UREPA|RL27_UREPA 50S ribosomal protein L27.>pir|D82920|D8292...    79   1e-13   Ureaplasma parvum serovar 3
sp|Q97QU2|RL27_STRPN|RL27_STRPN 50S ribosomal protein L27.>pir|A95128|A9512...    79   1e-13   
sp|P47476|RL27_MYCGE|RL27_MYCGE 50S ribosomal protein L27.>pir|H64225|H6422...    79   1e-13   Mycoplasma genitalium
sp|Q92BH4|RL27_LISMO|RL27_LISMO 50S ribosomal protein L27.>pir|AD1267|AD126...    79   1e-13   
sp|Q824F4|RL27_CHLCV|RL27_CHLCV 50S ribosomal protein L27.>gb:AE016994_3742...    79   1e-13   Chlamydia caviae
gb:CP000023_874380 Streptococcus thermophilus LMG 18311, complet...    78   2e-13   
gb:AE006533_219882 Streptococcus pyogenes M1 GAS, section 62 of ...    78   2e-13   
sp|Q9A0D4|RL27_STRPY|RL27_STRPY 50S ribosomal protein L27.                        78   2e-13   Streptococcus pyogenes
gb:AE017332_445509 Mycoplasma hyopneumoniae 232, complete genome.      78   2e-13   
pir|F97998|F97998 50S ribosomal protein L27 [imported] - Strepto...    78   2e-13   Streptococcus pneumoniae R6
sp|P07844|RL27_BACST|RL27_BACST 50S ribosomal protein L27 (BL30).>pir|S0856...    78   2e-13   Geobacillus stearothermophilus
sp|P41549|RK27_CHRAL|RK27_CHRAL Chloroplast 50S ribosomal protein L27 (Frag...    76   7e-13   Chrysochromulina alifera
gb:CP000033_89579 Lactobacillus acidophilus NCFM, complete genome.     75   1e-12   
sp|Q98QN2|RL27_MYCPU|RL27_MYCPU 50S ribosomal protein L27.>pir|A99553|A9955...    75   1e-12   Mycoplasma pulmonis
sp|P41548|RK27_CALSH|RK27_CALSH Chloroplast 50S ribosomal protein L27 (Frag...    74   2e-12   Calyptrosphaera sphaeroidea
gb:CR382130_1662817 Yarrowia lipolytica chromosome D of strain C...    74   3e-12   
sp|Q88WN3|RL27_LACPL|RL27_LACPL 50S ribosomal protein L27.>gb:AL935256_5513...    74   3e-12   Lactobacillus plantarum
gb:AF349567_503855 Staphylococcus aureus putative 50S ribosomal ...    73   6e-12   
sp|P41553|RK27_PORCR|RK27_PORCR Chloroplast 50S ribosomal protein L27 (Frag...    72   1e-11   Porphyridium purpureum
gb:NC5E6_1688574 Neurospora crassa DNA linkage group V Cosmid co...    72   1e-11   
sp|Q9P0M9|RM27_HUMAN|RM27_HUMAN Mitochondrial 60S ribosomal protein L27 (L2...    72   1e-11   Homo sapiens [man]
sp|Q99N92|RM27_MOUSE|RM27_MOUSE Mitochondrial 60S ribosomal protein L27 (L2...    71   2e-11   Mus musculus [mouse]
gb:AF195213_1775831 Pyrus pyrifolia strain Whangkeumbae ribosoma...    66   6e-10   
pir|T14374|T14374 ribosomal protein L27 - red alga (Cyanidium ca...    59   9e-08   Cyanidium caldarium
sp|P41551|RK2X_CYACA|RK2X_CYACA Chloroplast 50S ribosomal protein L27 (Frag...    59   9e-08   Cyanidium caldarium
gb:AE014134_1127495 Drosophila melanogaster chromosome 2L, compl...    57   3e-07   
gb:AX970856_1486165 Sequence 1659 from Patent EP1104808.               49   8e-05   
gb:PFMAL3P6_1394534 Plasmodium falciparum MAL3P6, complete seque...    46   8e-04   
gb:BA000036_720088 Corynebacterium glutamicum ATCC 13032 DNA, co...    39   0.13    
gb:BA000037_721359 Vibrio vulnificus YJ016 DNA, chromosome I, co...    36   0.86    
sp|P60493|RL27_THETH|RL27_THETH 50S ribosomal protein L27 (Fragment).             35   1.1     Thermus thermophilus
pir|T14124|T14124 neural zinc finger factor 3 - rat>gb:AF031942_...    34   2.5     Rattus norvegicus [brown rat]
gb:AC137610_1743506 Oryza sativa (japonica cultivar-group) chrom...    34   3.3     
sp|O88987|AKA3_MOUSE|AKA3_MOUSE A-kinase anchor protein 3 (Protein kinase A...    33   4.3     Mus musculus [mouse]
pir|T21027|T21027 hypothetical protein F16H6.9 - Caenorhabditis ...    32   9.5     Caenorhabditis elegans [roundworm]


>gb:AP003872_1834606 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1118_A03.>gb:AP003872_1834607 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1118_A03.>gb:AP004636_1842372 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0685B10.>gb:AP004636_1842373 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0685B10.
          Length = 145

 Score =  217 bits (553), Expect = 2e-55
 Identities = 100/139 (71%), Positives = 123/139 (88%)
 Frame = -3

Query: 646 MNFTTLFRRLNIRELVSNAPVYSSGSDASGEGLSLVLRRWATKKTAGSTKNGRDSKPKNL 467
           M F+++FRR N++EL+SN  VY+S +++SG GLSL+ +RWATKKTAGSTKNGRDS PK L
Sbjct: 1   MAFSSVFRRGNVKELISNVSVYTSAAESSG-GLSLIFKRWATKKTAGSTKNGRDSNPKYL 59

Query: 466 GVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVKFERNKLTGRKWVH 287
           GVKKFGGE+V PGNII+RQRGTRFHPG+YVG+GKDHTL+ LKEG V+FERNKLTGRKWVH
Sbjct: 60  GVKKFGGEKVEPGNIIIRQRGTRFHPGNYVGMGKDHTLFCLKEGHVRFERNKLTGRKWVH 119

Query: 286 VEPKDGHVLHPIYSTAADP 230
           V+P  GHVLHP+Y++ + P
Sbjct: 120 VDPVAGHVLHPVYASDSTP 138



>gb:OSJN00208_1696719 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0062H02, complete
           sequence.>gb:OSJN00218_1696927 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0041M06, complete
           sequence.
          Length = 145

 Score =  216 bits (549), Expect = 5e-55
 Identities = 101/139 (72%), Positives = 122/139 (87%)
 Frame = -3

Query: 646 MNFTTLFRRLNIRELVSNAPVYSSGSDASGEGLSLVLRRWATKKTAGSTKNGRDSKPKNL 467
           M F+++FRR N++EL+SN  VY+S  ++SG GLSL+ +RWATKKTAGSTKNGRDS PK L
Sbjct: 1   MAFSSVFRRGNVKELISNVSVYTSTVESSG-GLSLIFKRWATKKTAGSTKNGRDSNPKYL 59

Query: 466 GVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVKFERNKLTGRKWVH 287
           GVKKFGGE+V PGNIIVRQRGTRFHPG+YVG+GKDHTL+ LKEG V+FERNKLTGRKWVH
Sbjct: 60  GVKKFGGEKVEPGNIIVRQRGTRFHPGNYVGMGKDHTLFCLKEGHVRFERNKLTGRKWVH 119

Query: 286 VEPKDGHVLHPIYSTAADP 230
           V+P  GHVLHP+Y++ + P
Sbjct: 120 VDPVAGHVLHPVYTSDSTP 138



>gb:AY048281_1561742 Arabidopsis thaliana AT5g15220/F8M21_110 mRNA,
           complete cds.>gb:AY079120_1568181 Arabidopsis thaliana
           AT5g15220/F8M21_110 mRNA, complete cds.
          Length = 154

 Score =  215 bits (548), Expect = 6e-55
 Identities = 107/154 (69%), Positives = 125/154 (81%), Gaps = 9/154 (5%)
 Frame = -3

Query: 646 MNF----TTLFRRLNIRELVSNAPVYSSGS--DASGEGLSLVLRRWATKKTAGSTKNGRD 485
           MNF     ++ RR+++REL++  P YS  S  D S  GLSLV +RWATKKTAGSTKNGRD
Sbjct: 1   MNFLNSAASICRRVSLRELITEVPAYSGSSISDGSSSGLSLVFKRWATKKTAGSTKNGRD 60

Query: 484 SKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVKFERNKLT 305
           S PK LGVKKFGGE VIPGNIIVRQRGTRFHPGDYVGIGKDHTL+ALKEG V+FE++K+T
Sbjct: 61  SNPKFLGVKKFGGESVIPGNIIVRQRGTRFHPGDYVGIGKDHTLFALKEGRVRFEKSKIT 120

Query: 304 GRKWVHVEPKDGHVLHPIYSTAA---DPELKTAT 212
           GRKW+HV+P  GHVLHPIY+ AA     +LKTA+
Sbjct: 121 GRKWIHVDPTGGHVLHPIYTKAAAAQSTKLKTAS 154



>gb:AC005167_1532228 Arabidopsis thaliana chromosome 2 clone F12A24
           map mi398, complete sequence.>gb:BT003674_1636873
           Arabidopsis thaliana At2g16930 mRNA, complete
           cds.>gb:AK118574_1816543 Arabidopsis thaliana At2g16930
           mRNA for putative 50S ribosomal protein L27, complete
           cds, clone: RAFL19-80-O09.
          Length = 154

 Score =  214 bits (545), Expect = 1e-54
 Identities = 105/143 (73%), Positives = 121/143 (84%), Gaps = 6/143 (4%)
 Frame = -3

Query: 646 MNF----TTLFRRLNIRELVSNAPVY--SSGSDASGEGLSLVLRRWATKKTAGSTKNGRD 485
           MNF     ++ RR+++REL++  P Y  SS SD S  GLSLVL+RWATKKTAGSTKNGRD
Sbjct: 1   MNFLNSAASICRRVSLRELITEVPAYTGSSISDGSSSGLSLVLKRWATKKTAGSTKNGRD 60

Query: 484 SKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVKFERNKLT 305
           S PK LGVKKFGGE VIPGNIIVRQRGTRFHPGDYVGIGKDHTL+ALKEG V+FE++K+T
Sbjct: 61  SNPKFLGVKKFGGESVIPGNIIVRQRGTRFHPGDYVGIGKDHTLFALKEGRVRFEKSKIT 120

Query: 304 GRKWVHVEPKDGHVLHPIYSTAA 236
           GRKW+HV+P  GHVLHPIY+ AA
Sbjct: 121 GRKWIHVDPIGGHVLHPIYTKAA 143



>pir|T49957|T49957 ribosomal protein L27-like - Arabidopsis
           thaliana>gb:ATF8M21_1551260 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F8M21 (ESSA project).
          Length = 162

 Score =  213 bits (543), Expect = 2e-54
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 6/143 (4%)
 Frame = -3

Query: 646 MNF----TTLFRRLNIRELVSNAPVYSSGS--DASGEGLSLVLRRWATKKTAGSTKNGRD 485
           MNF     ++ RR+++REL++  P YS  S  D S  GLSLV +RWATKKTAGSTKNGRD
Sbjct: 1   MNFLNSAASICRRVSLRELITEVPAYSGSSISDGSSSGLSLVFKRWATKKTAGSTKNGRD 60

Query: 484 SKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVKFERNKLT 305
           S PK LGVKKFGGE VIPGNIIVRQRGTRFHPGDYVGIGKDHTL+ALKEG V+FE++K+T
Sbjct: 61  SNPKFLGVKKFGGESVIPGNIIVRQRGTRFHPGDYVGIGKDHTLFALKEGRVRFEKSKIT 120

Query: 304 GRKWVHVEPKDGHVLHPIYSTAA 236
           GRKW+HV+P  GHVLHPIY+ AA
Sbjct: 121 GRKWIHVDPTGGHVLHPIYTKAA 143



>pir|A84546|A84546 50S ribosomal protein L27 [imported] -
           Arabidopsis thaliana
          Length = 147

 Score =  197 bits (501), Expect = 2e-49
 Identities = 92/111 (82%), Positives = 101/111 (90%)
 Frame = -3

Query: 568 DASGEGLSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHP 389
           D S  GLSLVL+RWATKKTAGSTKNGRDS PK LGVKKFGGE VIPGNIIVRQRGTRFHP
Sbjct: 26  DGSSSGLSLVLKRWATKKTAGSTKNGRDSNPKFLGVKKFGGESVIPGNIIVRQRGTRFHP 85

Query: 388 GDYVGIGKDHTLYALKEGCVKFERNKLTGRKWVHVEPKDGHVLHPIYSTAA 236
           GDYVGIGKDHTL+ALKEG V+FE++K+TGRKW+HV+P  GHVLHPIY+ AA
Sbjct: 86  GDYVGIGKDHTLFALKEGRVRFEKSKITGRKWIHVDPIGGHVLHPIYTKAA 136



>gb:BX897699_826773 Bartonella henselae strain Houston-1, complete
           genome.
          Length = 89

 Score =  113 bits (283), Expect = 3e-24
 Identities = 57/83 (68%), Positives = 65/83 (78%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVKKFGGE VI GNIIVRQRGTR+HPGD VGIGKDHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKKFGGEAVIAGNIIVRQRGTRWHPGDNVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V F+R K   R +V V P
Sbjct: 62  LSKGMVSFQR-KANNRSYVSVIP 83



>sp|Q83ED9|RL27_COXBU 50S ribosomal protein L27.>gb:AE016961_367629
           Coxiella burnetii strain RSA 493, section 2 of 7 of the
           complete genome.>gb:AE016828_1008365 Coxiella burnetii
           strain RSA 493, complete genome.
          Length = 90

 Score =  112 bits (280), Expect = 7e-24
 Identities = 54/83 (65%), Positives = 64/83 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS PK LGVK+FGGERV+ GNIIVRQRGT + PG+ +G+G+DHTLYA
Sbjct: 2   AHKKAGGSTRNGRDSNPKMLGVKRFGGERVLAGNIIVRQRGTHYRPGENMGMGRDHTLYA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L EG VKF R     R +V +EP
Sbjct: 62  LIEGKVKFTRKGPKKRNFVSIEP 84



>sp|Q87SU3|RL27_VIBPA 50S ribosomal protein L27.>gb:BA000031_705789
           Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1,
           complete sequence.
          Length = 85

 Score =  111 bits (278), Expect = 1e-23
 Identities = 55/82 (67%), Positives = 64/82 (78%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ GNIIVRQRGT+FH G+ VGIGKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTKFHAGNNVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L EG VKFE      RK+V +E
Sbjct: 62  LTEGKVKFEVKGPKNRKFVSIE 83



>gb:CP000020_870455 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 85

 Score =  111 bits (277), Expect = 2e-23
 Identities = 55/82 (67%), Positives = 63/82 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ GNIIVRQRGT+FH G  VGIGKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTKFHAGTNVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L EG VKFE      RK+V +E
Sbjct: 62  LSEGKVKFEVKGPKNRKFVSIE 83



>gb:BX897700_828378 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 89

 Score =  111 bits (277), Expect = 2e-23
 Identities = 55/81 (67%), Positives = 63/81 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVKKFGGE VI GNII+RQRGTR+HPGD VGIGKDHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKKFGGETVIAGNIIIRQRGTRWHPGDNVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L  G V F+R K   R +V V
Sbjct: 62  LSNGVVSFQR-KANNRSYVSV 81



>sp|Q8UBR6|RL27_AGRT5 50S ribosomal protein L27.>pir|AG2918|AG2918
           50S ribosomal protein L27 [imported] - Agrobacterium
           tumefaciens (strain C58, Dupont)>pir|B97693|B97693
           ribosomal protein L27 VC0436 [imported] - Agrobacterium
           tumefaciens (strain C58, Cereon)>gb:AE008192_234440
           Agrobacterium tumefaciens str. C58 circular chromosome,
           section 250 of 254 of the complete
           sequence.>gb:AE009226_249792 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 252 of 256 of the
           complete sequence.>gb:AE007869_1084109 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.>gb:AE008688_1087635 Agrobacterium tumefaciens
           str. C58 circular chromosome, complete sequence.
          Length = 89

 Score =  111 bits (277), Expect = 2e-23
 Identities = 56/84 (66%), Positives = 65/84 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVKKFGGE VIPGNII+RQRGT++HPG  VGIGKDHT++A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKKFGGEAVIPGNIILRQRGTQWHPGANVGIGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           L  G V F R K  GR +V V PK
Sbjct: 62  LTAGNVNF-RTKANGRVFVSVAPK 84



>sp|Q9KUS9|RL27_VIBCH 50S ribosomal protein L27.>pir|C82322|C82322
           ribosomal protein L27 VC0436 [imported] - Vibrio
           cholerae  (strain N16961 serogroup O1)>gb:AE004131_50839
           Vibrio cholerae O1 biovar eltor str. N16961 chromosome
           I, section 39 of 251 of the complete
           chromosome.>gb:AE003852_1051613 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 86

 Score =  110 bits (275), Expect = 3e-23
 Identities = 54/82 (65%), Positives = 63/82 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ GNIIVRQRGT+FH G  VGIGKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTKFHAGTNVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L +G VKFE      RK+V +E
Sbjct: 62  LSDGKVKFEVKGPNNRKFVSIE 83



>sp|Q8DEC5|RL27_VIBVU 50S ribosomal protein L27.>gb:AE016799_335435
           Vibrio vulnificus CMCP6 chromosome I section 3 of 11 of
           the complete sequence.>gb:BA000037_721297 Vibrio
           vulnificus YJ016 DNA, chromosome I, complete
           sequence.>gb:AE016795_1045159 Vibrio vulnificus CMCP6
           chromosome I complete sequence.
          Length = 85

 Score =  109 bits (272), Expect = 6e-23
 Identities = 53/82 (64%), Positives = 64/82 (78%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ GNIIVRQRGT+FH G+ VG+GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTQFHAGNNVGLGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L +G VKFE      RK+V +E
Sbjct: 62  LTDGKVKFEVKGPKNRKFVSIE 83



>sp|Q92LB7|RL27_RHIME 50S ribosomal protein L27.>gb:SME591793_187174
           Sinorhizobium meliloti 1021 complete chromosome; segment
           12/12.
          Length = 89

 Score =  108 bits (270), Expect = 1e-22
 Identities = 55/84 (65%), Positives = 64/84 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVKKFGGE VIPGNIIVRQRGT++H G  VG+GKDHT++A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKKFGGEAVIPGNIIVRQRGTKWHAGANVGLGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           L  G V F R K  GR +V V PK
Sbjct: 62  LTTGNVDF-RKKANGRVYVSVMPK 84



>sp|Q889F2|RL27_PSESM 50S ribosomal protein L27.>gb:AE016858_350252
           Pseudomonas syringae pv. tomato str. DC3000 section 3 of
           21 of the complete genome.>gb:AE016853_1035427
           Pseudomonas syringae pv. tomato str. DC3000 complete
           genome.
          Length = 91

 Score =  108 bits (270), Expect = 1e-22
 Identities = 51/84 (60%), Positives = 64/84 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK +GG+ +IPGNIIVRQRGT+FH G  VG+GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSEAKRLGVKMYGGQAIIPGNIIVRQRGTQFHAGYGVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
             EG +KF+     GR++V + PK
Sbjct: 62  KVEGVIKFQVKGAFGRRYVSIVPK 85



>gb:CR378664_93804 Photobacterium profundum SS9; segment 2/12.
          Length = 85

 Score =  107 bits (268), Expect = 2e-22
 Identities = 53/82 (64%), Positives = 62/82 (75%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST NGRDS+ K LGVK+FGGE V+ GNIIVRQRGT+FH G  VG+GKDHTL+A
Sbjct: 2   AHKKAGGSTNNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTKFHAGTNVGLGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L +G VKFE      RK+V +E
Sbjct: 62  LTDGKVKFEVKGPKNRKFVTIE 83



>sp|Q8EB81|RL27_SHEON 50S ribosomal protein L27.>gb:AE015800_317976
           Shewanella oneidensis MR-1 section 349 of 457 of the
           complete genome.>gb:AE014299_953573 Shewanella
           oneidensis MR-1 complete genome.
          Length = 84

 Score =  107 bits (268), Expect = 2e-22
 Identities = 52/82 (63%), Positives = 63/82 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ GNIIVRQRGT+FH G  VGIG+DHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGNIIVRQRGTKFHAGVNVGIGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L +G VKFE      RK++ +E
Sbjct: 62  LTDGKVKFEVKGPNNRKFISIE 83



>sp|Q98EZ0|RL27_RHILO 50S ribosomal protein L27.>gb:BA000012_669064
           Mesorhizobium loti MAFF303099 DNA, complete genome.
          Length = 89

 Score =  107 bits (267), Expect = 2e-22
 Identities = 53/83 (63%), Positives = 62/83 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  K LGVKKFGGE VIPGNII+RQRGT +HPG  VG+G DHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSHSKRLGVKKFGGEAVIPGNIIIRQRGTTWHPGVNVGMGTDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L+ G V F + K  GR +V V P
Sbjct: 62  LESGAVTFNK-KANGRTYVSVNP 83



>gb:CR628336_112820 Legionella pneumophila str. Paris complete
           genome.>gb:CR628337_115780 Legionella pneumophila str.
           Lens complete genome.>gb:AE017354_460994 Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1,
           complete genome.
          Length = 92

 Score =  106 bits (264), Expect = 5e-22
 Identities = 53/84 (63%), Positives = 61/84 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS PK LGVK+FGG+ V  G IIVRQRGTRFHPG  VG G+DHTLYA
Sbjct: 2   AHKKAGGSTRNGRDSNPKYLGVKRFGGQFVNAGEIIVRQRGTRFHPGPGVGCGRDHTLYA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           L EG V+F       RK+V + P+
Sbjct: 62  LVEGLVQFTTKGEKNRKYVTILPE 85



>sp|Q7VP91|RL27_HAEDU 50S ribosomal protein L27.>gb:AE017151_391800
           Haemophilus ducreyi strain 35000HP section 1 of 6 of the
           complete genome.>gb:AE017143_1026062 Haemophilus ducreyi
           strain 35000HP complete genome.
          Length = 85

 Score =  106 bits (264), Expect = 5e-22
 Identities = 51/81 (62%), Positives = 62/81 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG+GKDHTL+A
Sbjct: 2   ATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGSNVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G VKFE      RK+V +
Sbjct: 62  TADGKVKFEVKGEKNRKYVSI 82



>sp|Q8VW58|RL27_BRUAB 50S ribosomal protein
           L27.>sp|Q8FYL8|RL27_BRUSU 50S ribosomal protein
           L27.>gb:AE014291_309258 Brucella suis 1330 chromosome I,
           complete sequence.>gb:AF119331_480535 Brucella
           melitensis biovar Abortus 50S ribosomal protein L27
           (RL27) and 50S ribosomal protein L21 (RL21) genes,
           complete cds.
          Length = 89

 Score =  106 bits (264), Expect = 5e-22
 Identities = 52/83 (62%), Positives = 62/83 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVKKFGGE V+ GNIIVRQRGT++HPG  VG+GKDHT++A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKKFGGEAVLAGNIIVRQRGTKWHPGANVGLGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
              G V F R K  GR +V V P
Sbjct: 62  TVNGSVSF-RTKANGRTYVSVNP 83



>gb:CR543861_104749 Acinetobacter sp. ADP1 complete genome.
          Length = 85

 Score =  105 bits (262), Expect = 9e-22
 Identities = 52/82 (63%), Positives = 61/82 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A+KK  GSTKNGRDS PK LGVK +GG+ V  GNIIVRQRGT FH G  VG+G+DHTL+A
Sbjct: 2   ASKKAGGSTKNGRDSNPKMLGVKIYGGQSVTAGNIIVRQRGTEFHAGANVGMGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
             +G VKFE     GR++V VE
Sbjct: 62  TADGVVKFEVKGQFGRRYVTVE 83



>gb:BX571874_789396 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 16/17.
          Length = 85

 Score =  105 bits (261), Expect = 1e-21
 Identities = 50/82 (60%), Positives = 63/82 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G+ VG G+DHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKRFGGESVLAGSIIVRQRGTKFHAGNNVGCGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L +G VKFE      RK++ +E
Sbjct: 62  LADGKVKFEVKGPKNRKFISIE 83



>gb:AJ749949_531230 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 84

 Score =  105 bits (261), Expect = 1e-21
 Identities = 51/82 (62%), Positives = 60/82 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS PK LGVK++GGE V  G II+RQRGT+ HPG  VG GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSNPKYLGVKRYGGEFVKAGTIIIRQRGTKTHPGVNVGCGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           LK+G VKF       RK+V +E
Sbjct: 62  LKDGTVKFHTGGALNRKFVSIE 83



>gb:AE017340_456241 Idiomarina loihiensis L2TR, complete genome.
          Length = 85

 Score =  105 bits (261), Expect = 1e-21
 Identities = 52/81 (64%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GSTKNGRDS+ K LGVK+FGGE V+ GNI+VRQRGT+FH G  VGIGKDHTL+A
Sbjct: 2   AHKKAGGSTKNGRDSESKRLGVKRFGGESVLAGNILVRQRGTKFHAGANVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             EG V F+      RK+V V
Sbjct: 62  TSEGKVSFDVKGSKNRKFVSV 82



>gb:AE017282_428962 Methylococcus capsulatus str. Bath, complete
           genome.
          Length = 85

 Score =  105 bits (261), Expect = 1e-21
 Identities = 52/83 (62%), Positives = 63/83 (75%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVK+FGG+ V  GNIIVRQRGT FHPGD VG G+D+TL+A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKRFGGQVVRAGNIIVRQRGTHFHPGDNVGCGRDYTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L EG V+F+     GRK+V V P
Sbjct: 62  LTEGRVEFKVKGPAGRKYVSVIP 84



>gb:AE016827_343227 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 85

 Score =  105 bits (261), Expect = 1e-21
 Identities = 50/81 (61%), Positives = 62/81 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG+G+DHTL+A
Sbjct: 2   ATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGSNVGMGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G VKFE      RK+V +
Sbjct: 62  TADGKVKFEVKGEKSRKYVSI 82



>sp|Q8D278|RL27_WIGBR 50S ribosomal protein L27.>gb:BA000021_687222
           Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis DNA, complete genome.
          Length = 87

 Score =  105 bits (261), Expect = 1e-21
 Identities = 51/84 (60%), Positives = 64/84 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  K LGVK FGG++  PGNIIVRQRGT+FHPG  VG GKD++LYA
Sbjct: 2   AHKKAGGSTRNGRDSIGKRLGVKLFGGQKAYPGNIIVRQRGTKFHPGKNVGCGKDYSLYA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           LK G V F++ K   +K++++ PK
Sbjct: 62  LKSGIVFFKKKK--NKKFINIIPK 83



>sp|Q9CNS7|RL27_PASMU 50S ribosomal protein L27.>gb:AE006071_215236
           Pasteurella multocida subsp. multocida str. Pm70 section
           38 of 204 of the complete genome.>gb:AE004439_1117966
           Pasteurella multocida subsp. multocida str. Pm70,
           complete genome.
          Length = 85

 Score =  105 bits (261), Expect = 1e-21
 Identities = 50/81 (61%), Positives = 62/81 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG+G+DHTL+A
Sbjct: 2   ATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGSNVGMGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G VKFE      RK+V +
Sbjct: 62  TADGKVKFEVKGEKNRKYVSI 82



>gb:AF153712_483850 Pseudomonas sp. BG33R strain BG33R 50S ribosomal
           protein homolog gene, complete cds.
          Length = 85

 Score =  104 bits (260), Expect = 2e-21
 Identities = 50/81 (61%), Positives = 62/81 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK +GG+++IPGNIIVRQRGT+FH G  VG+GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSEAKRLGVKMYGGQKIIPGNIIVRQRGTQFHAGYGVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             EG +KFE      R++V V
Sbjct: 62  KIEGVIKFEVKGAFNRRYVSV 82



>pir|F64099|F64099 ribosomal protein L27 - Haemophilus influenzae
           (strain Rd KW20)>gb:U32769_204551 Haemophilus influenzae
           Rd KW20 section 84 of 163 of the complete
           genome.>gb:L42023_1097100 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 85

 Score =  104 bits (260), Expect = 2e-21
 Identities = 50/79 (63%), Positives = 62/79 (78%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G+ VG+G+DHTL+A
Sbjct: 2   ATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGNNVGMGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWV 290
             +G VKFE      RK+V
Sbjct: 62  TADGKVKFEVKGEKSRKYV 80



>sp|Q8ZBA7|RL27_YERPE 50S ribosomal protein L27.>pir|AH0426|AH0426
           50S ribosomal protein L27 [imported] - Yersinia pestis
           (strain CO92)>gb:AE013669_299003 Yersinia pestis KIM
           section 69 of 415 of the complete
           genome.>gb:AE017129_386419 Yersinia pestis biovar
           Medievalis str. 91001 section 3 of 16 of the complete
           genome.>gb:AJ414157_525269 Yersinia pestis strain CO92
           complete genome; segment 17/20.>gb:BX936398_835110
           Yersinia pseudotuberculosis IP32953 genome, complete
           sequence.>gb:AE009952_929186 Yersinia pestis KIM
           complete genome.>gb:AE017042_1142985 Yersinia pestis
           biovar Medievalis str. 91001 complete genome.
          Length = 85

 Score =  104 bits (260), Expect = 2e-21
 Identities = 51/82 (62%), Positives = 62/82 (75%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKRFGGEAVLAGSIIVRQRGTKFHAGINVGCGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L +G VKFE      RK++ +E
Sbjct: 62  LADGKVKFEVKGPKNRKFISIE 83



>sp|P44363|RL27_HAEIN 50S ribosomal protein L27.
          Length = 84

 Score =  104 bits (260), Expect = 2e-21
 Identities = 50/79 (63%), Positives = 62/79 (78%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G+ VG+G+DHTL+A
Sbjct: 1   ATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGNNVGMGRDHTLFA 60

Query: 346 LKEGCVKFERNKLTGRKWV 290
             +G VKFE      RK+V
Sbjct: 61  TADGKVKFEVKGEKSRKYV 79



>gb:CR555306_105850 Azoarcus sp. EbN1 complete genome.
          Length = 87

 Score =  103 bits (258), Expect = 3e-21
 Identities = 49/84 (58%), Positives = 64/84 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVK++GG+ V+ GNIIVRQRGT +HPG+ VGIGKDHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKRYGGQFVLAGNIIVRQRGTEYHPGENVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           LK+G V+F       R+ V + P+
Sbjct: 62  LKDGTVQFTIKGAQRRRTVVIVPE 85



>gb:AE014295_312182 Bifidobacterium longum NCC2705, complete genome.
          Length = 82

 Score =  103 bits (257), Expect = 3e-21
 Identities = 49/68 (72%), Positives = 56/68 (82%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS P+ LGVKKFGGE V+ GNIIVRQRGT FHPG  VG+GKDHTL+A
Sbjct: 2   AHKKGASSSRNGRDSNPQYLGVKKFGGEAVVAGNIIVRQRGTNFHPGHNVGMGKDHTLFA 61

Query: 346 LKEGCVKF 323
           L +G VKF
Sbjct: 62  LTDGSVKF 69



>sp|Q9ABB3|RL27_CAUCR 50S ribosomal protein L27.>pir|E87288|E87288
           ribosomal protein L27 [imported] - Caulobacter
           crescentus>gb:AE005705_74335 Caulobacter crescentus CB15
           section 31 of 359 of the complete
           genome.>gb:AE005673_921367 Caulobacter crescentus CB15
           complete genome.
          Length = 89

 Score =  103 bits (257), Expect = 3e-21
 Identities = 52/83 (62%), Positives = 63/83 (75%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK+ GS+ NGRDS+ K LGVKKFGGE+V+ GNI+VRQRGT+F+PG  VGIGKDHTL+A
Sbjct: 2   AHKKSGGSSSNGRDSESKRLGVKKFGGEKVLAGNILVRQRGTKFYPGSGVGIGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V F   K   R +V V P
Sbjct: 62  LVQGAVGFVTKK-HNRTYVTVTP 83



>sp|Q8YJ84|RL27_BRUME 50S ribosomal protein L27.
          Length = 89

 Score =  103 bits (257), Expect = 3e-21
 Identities = 51/83 (61%), Positives = 61/83 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A  K  GS++NGRDS+ K LGVKKFGGE V+ GNIIVRQRGT++HPG  VG+GKDHT++A
Sbjct: 2   AHTKKGGSSRNGRDSESKRLGVKKFGGEAVLAGNIIVRQRGTKWHPGANVGLGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
              G V F R K  GR +V V P
Sbjct: 62  TVNGSVSF-RTKANGRTYVSVNP 83



>gb:BX842656_826574 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 11/11.
          Length = 86

 Score =  103 bits (256), Expect = 4e-21
 Identities = 47/70 (67%), Positives = 60/70 (85%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A+KK  GSTKNGRDS+ K LGVK+FGGE+V+PG IIVRQRGT+FH G+ V +G+D+T+Y+
Sbjct: 2   ASKKAGGSTKNGRDSQSKRLGVKRFGGEKVLPGTIIVRQRGTKFHLGNNVKMGRDYTIYS 61

Query: 346 LKEGCVKFER 317
           + EG VKFER
Sbjct: 62  VVEGLVKFER 71



>gb:CP000027_80298 Dehalococcoides ethenogenes 195, complete genome.
          Length = 84

 Score =  102 bits (255), Expect = 6e-21
 Identities = 51/77 (66%), Positives = 59/77 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK AGSTKNGRDSKPK LGVK+F GE+V  G IIVRQRGTR HPG+ VG+G+D+T++A
Sbjct: 2   AHKKGAGSTKNGRDSKPKMLGVKRFAGEKVHSGTIIVRQRGTRIHPGENVGLGRDYTIFA 61

Query: 346 LKEGCVKFERNKLTGRK 296
             EG VKFE      RK
Sbjct: 62  TCEGVVKFEPTTNDRRK 78



>sp|Q9HVL7|RL27_PSEAE 50S ribosomal protein L27.>pir|A83075|A83075
           50S ribosomal protein L27 PA4567 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004870_58802
           Pseudomonas aeruginosa PAO1, section 431 of 529 of the
           complete genome.>gb:AE004091_972902 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 85

 Score =  102 bits (254), Expect = 7e-21
 Identities = 50/81 (61%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK FGG+ V  GNI+VRQRGT+FH G  VG+GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKLFGGQAVKAGNILVRQRGTKFHAGYGVGLGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G VKFE     GRK+V +
Sbjct: 62  KVDGVVKFETKGAFGRKYVSI 82



>gb:BX950851_839442 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 85

 Score =  102 bits (253), Expect = 1e-20
 Identities = 49/81 (60%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LGVK+FGGE V+ GNIIVRQRGT+FH G  VG GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSNAQRLGVKRFGGESVLAGNIIVRQRGTKFHAGTNVGCGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L +G V+FE      RK++ +
Sbjct: 62  LTDGKVQFEVKGPKNRKFISI 82



>gb:CR767821_116842 Ehrlichia ruminantium strain Welgevonden,
           complete genome.>gb:CR925677_117754 Ehrlichia
           ruminantium str. Gardel, complete
           genome.>gb:CR925678_118714 Ehrlichia ruminantium str.
           Welgevonden, complete genome.
          Length = 88

 Score =  102 bits (253), Expect = 1e-20
 Identities = 46/73 (63%), Positives = 58/73 (79%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK+ GS+ NGRDS+ + LGVKKFG E+VIPGNII+RQRGT++HPG  VGIGKDHT+++
Sbjct: 2   ATKKSGGSSSNGRDSRGRRLGVKKFGSEKVIPGNIIIRQRGTKYHPGRNVGIGKDHTIFS 61

Query: 346 LKEGCVKFERNKL 308
              G V F +  L
Sbjct: 62  KVSGVVYFRKGAL 74



>gb:CP000030_83535 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 90

 Score =  102 bits (253), Expect = 1e-20
 Identities = 50/84 (59%), Positives = 64/84 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK+ GS+ NGRDS+ + LGVKKFG E VIPGNII+RQRGTR+HPG  VG+GKDHT+++
Sbjct: 2   ATKKSGGSSSNGRDSRGRRLGVKKFGSELVIPGNIIIRQRGTRYHPGRNVGMGKDHTIFS 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
              G V F R +  G+ +V V P+
Sbjct: 62  KIAGVVCF-RKRTGGKVFVDVVPQ 84



>gb:BX572593_799775 Rhodopseudomonas palustris CGA009 complete
           genome; segment 1/16.
          Length = 90

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/83 (63%), Positives = 61/83 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  K LGVK FGGE VIPGNII RQRGT++HPG  VG+G DHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSAGKRLGVKAFGGEHVIPGNIIARQRGTQWHPGLNVGMGTDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
             EG V+F R K  GR +V V P
Sbjct: 62  KVEGRVEF-RAKANGRTYVSVLP 83



>pir|JS0767|R5EC27 ribosomal protein L27 [validated] - Escherichia
           coli (strain K-12)>pir|H91136|H91136 50S ribosomal
           subunit protein L27 [imported] - Escherichia coli
           (strain O157:H7, substrain RIMD
           0509952)>pir|C85982|C85982 50S ribosomal subunit protein
           L27 [imported] - Escherichia coli (strain O157:H7,
           substrain EDL933)>gb:AE005174_68318 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:AE005674_72809
           Shigella flexneri 2a str. 301, complete
           genome.>gb:ECORPLRPM_130161 Escherichia coli rplU and
           rpmA genes for ribosomal protein L21 and L27, complete
           cds.>gb:ECOUW67_130746 Escherichia coli K-12 chromosomal
           region from 67.4 to 76.0 minutes.>gb:U00096_202194
           Escherichia coli K-12 MG1655 complete
           genome.>gb:AE016767_327920 Escherichia coli CFT073
           section 13 of 18 of the complete
           genome.>gb:AE016989_372952 Shigella flexneri 2a str.
           2457T section 12 of 16 of the complete
           genome.>gb:BA000007_662076 Escherichia coli O157:H7 DNA,
           complete genome.>gb:AE014075_958504 Escherichia coli
           CFT073 complete genome.>gb:AE014073_997702 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 85

 Score =  101 bits (252), Expect = 1e-20
 Identities = 49/82 (59%), Positives = 61/82 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG G+DHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
             +G VKFE      RK++ +E
Sbjct: 62  KADGKVKFEVKGPKNRKFISIE 83



>sp|P02427|RL27_ECOLI 50S ribosomal protein L27.
          Length = 84

 Score =  101 bits (252), Expect = 1e-20
 Identities = 49/82 (59%), Positives = 61/82 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG G+DHTL+A
Sbjct: 1   AHKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKFHAGANVGCGRDHTLFA 60

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
             +G VKFE      RK++ +E
Sbjct: 61  KADGKVKFEVKGPKNRKFISIE 82



>gb:AY657060_2146070 Synthetic construct Peudomonas aeruginosa clone
           FLH031910.01F PA4567 gene, partial cds.
          Length = 86

 Score =  101 bits (251), Expect = 2e-20
 Identities = 49/81 (60%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK FGG+ V  GNI+VRQRGT+FH G  VG+G+DHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKLFGGQAVKAGNILVRQRGTKFHAGYGVGLGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G VKFE     GRK+V +
Sbjct: 62  KVDGVVKFETKGAFGRKYVSI 82



>sp|Q8Z0F1|RL27_ANASP 50S ribosomal protein L27.>pir|AB1825|AB1825
           50S ribosomal protein L27 [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_681138 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 92

 Score =  100 bits (250), Expect = 2e-20
 Identities = 53/83 (63%), Positives = 62/83 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LGVK+FGG+ VI GNI+VRQRGT+FH G+ VGIGKD TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNAQRLGVKRFGGQAVIAGNILVRQRGTKFHAGNNVGIGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V FER K   RK V V P
Sbjct: 62  LVDGVVTFER-KGKSRKKVSVYP 83



>pir|AF0903|AF0903 50S ribosomal chain protein L27 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:CP000026_77879 Salmonella enterica
           subsp. enterica serovar Paratypi A str. ATCC
           9150.>gb:AE008852_244944 Salmonella typhimurium LT2,
           section 156 of 220 of the complete
           genome.>gb:AE016845_347212 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, section 12 of 16 of the
           complete genome.>gb:AL627278_543542 Salmonella enterica
           serovar Typhi (Salmonella typhi) strain CT18, complete
           chromosome; segment 14/20.>gb:AE014613_984544 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, complete
           genome.>gb:AE006468_1002026 Salmonella typhimurium LT2,
           complete genome.
          Length = 85

 Score =  100 bits (249), Expect = 3e-20
 Identities = 48/81 (59%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG G+DHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSEAKRLGVKRFGGEAVLAGSIIVRQRGTKFHAGTNVGCGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G VKFE      RK++ +
Sbjct: 62  KADGKVKFEVKGPKNRKYISI 82



>sp|Q8XGK4|RL27_SALTY 50S ribosomal protein L27.
          Length = 84

 Score =  100 bits (249), Expect = 3e-20
 Identities = 48/81 (59%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK+FGGE V+ G+IIVRQRGT+FH G  VG G+DHTL+A
Sbjct: 1   AHKKAGGSTRNGRDSEAKRLGVKRFGGEAVLAGSIIVRQRGTKFHAGTNVGCGRDHTLFA 60

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G VKFE      RK++ +
Sbjct: 61  KADGKVKFEVKGPKNRKYISI 81



>sp|Q9JRI8|RL27_NEIMA 50S ribosomal protein L27.>pir|G81212|G81212
           50S ribosomal protein L27 NMB0324 [imported] - Neisseria
           meningitidis (strain MC58 serogroup B, strain Z2491
           serogroup A)>gb:AE002389_45795 Neisseria meningitidis
           serogroup B strain MC58 section 31 of 206 of the
           complete genome.>gb:NMA7Z2491_155031 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 7/7.>gb:AE002098_895908 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 90

 Score =  100 bits (248), Expect = 4e-20
 Identities = 48/86 (55%), Positives = 61/86 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A+KK  GST+NGRDS+ K LGVK +G E +  G+IIVRQRGT+FH GD VG+GKDHTL+A
Sbjct: 2   ASKKAGGSTRNGRDSEAKRLGVKAYGNELIPAGSIIVRQRGTKFHAGDNVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDG 269
             +G V+F+      RK V + P  G
Sbjct: 62  KVDGYVEFKTKGALNRKTVSIRPYTG 87



>sp|Q8REI3|RL27_FUSNN 50S ribosomal protein L27.>gb:AE010616_265016
           Fusobacterium nucleatum subsp. nucleatum ATCC 25586,
           section 158 of 197 of the complete
           genome.>gb:AE009951_912184 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 94

 Score =  100 bits (248), Expect = 4e-20
 Identities = 49/74 (66%), Positives = 59/74 (79%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           ++ +A KK  GS KNGRDS PK LGVKK+ GE V  GNIIVRQRGT++H G+ +GIGKDH
Sbjct: 7   IQLFAHKKGQGSVKNGRDSNPKYLGVKKYDGEVVKAGNIIVRQRGTKYHAGNNMGIGKDH 66

Query: 358 TLYALKEGCVKFER 317
           TL+AL +G VKFER
Sbjct: 67  TLFALIDGYVKFER 80



>gb:AE004969_61331 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 90

 Score = 99.8 bits (247), Expect = 5e-20
 Identities = 48/86 (55%), Positives = 61/86 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A+KK  GST+NGRDS+ K LGVK +G E +  G+IIVRQRGT+FH GD VG+GKDHTL+A
Sbjct: 2   ASKKAGGSTRNGRDSEAKRLGVKAYGNELIPAGSIIVRQRGTKFHAGDNVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDG 269
             +G V+F+      RK V + P  G
Sbjct: 62  KIDGYVEFKTKGALNRKTVSIRPYTG 87



>sp|Q88Q09|RL27_PSEPK 50S ribosomal protein L27.>gb:AE016776_330128
           Pseudomonas putida KT2440 section 3 of 21 of the
           complete genome.>gb:AE015451_945205 Pseudomonas putida
           KT2440 complete genome.
          Length = 85

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 48/81 (59%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK +GG+ + PGNIIVRQRGT FH G  VG+GKDHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSESKRLGVKMYGGQVIKPGNIIVRQRGTEFHAGYGVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             EG +KFE+     R++V +
Sbjct: 62  KIEGVIKFEKKGEFMRRYVSI 82



>sp|Q8F7U1|RL27_LEPIN 50S ribosomal protein L27.>gb:AE011270_271089
           Leptospira interrogans serovar lai str. 56601 chromosome
           I, section 79 of 397 of the complete
           sequence.>gb:AE017298_434939 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 12 of 14 of the complete
           sequence.>gb:AE010300_1004488 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1067950 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 84

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 47/69 (68%), Positives = 56/69 (81%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS+KNGRDS  + LGVK+FGGE V+ GNI+VRQRGT+F PG+ VG+GKDHTL+A
Sbjct: 2   AHKKGGGSSKNGRDSNSQRLGVKRFGGESVLAGNILVRQRGTKFRPGNNVGLGKDHTLFA 61

Query: 346 LKEGCVKFE 320
           L  G VKFE
Sbjct: 62  LVTGKVKFE 70



>sp|Q89X93|RL27_BRAJA 50S ribosomal protein L27.>gb:BA000040_728681
           Bradyrhizobium japonicum USDA 110 DNA, complete genome.
          Length = 89

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 52/83 (62%), Positives = 60/83 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDSK K LG+K FGGE VIPGNII RQRGT +HPG  VG+G DHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSKGKRLGIKAFGGEVVIPGNIIARQRGTTWHPGLNVGMGTDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
             EG V F+  K  GR +V V P
Sbjct: 62  KIEGRVTFQA-KANGRTFVSVLP 83



>sp|Q7VQN1|RL27_CANBF 50S ribosomal protein L27.>gb:BX248584_763719
           Blochmannia floridanus complete genome; segment 1/3.
          Length = 85

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 47/81 (58%), Positives = 58/81 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK FGGE +  G IIVRQRG +FHPG YVG G+DHTL+A
Sbjct: 2   AHKKAGGSTRNGRDSRGKRLGVKHFGGEIISAGTIIVRQRGNKFHPGKYVGCGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L+ G + FE+     R+ V +
Sbjct: 62  LQSGKLLFEKKGKLQRRLVSI 82



>gb:AP006840_567620 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 95

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 55/89 (61%), Positives = 61/89 (68%)
 Frame = -3

Query: 544 LVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           + L+ +A+KK  GSTKNGRDS PK LGVKK  G  V  G IIVRQRGT+ HPG  VG GK
Sbjct: 1   MFLQLFASKKGVGSTKNGRDSNPKYLGVKKGDGSLVTVGQIIVRQRGTKIHPGANVGRGK 60

Query: 364 DHTLYALKEGCVKFERNKLTGRKWVHVEP 278
           D TLYAL +G VKF R K   RK V V P
Sbjct: 61  DDTLYALADGIVKFGR-KGANRKQVSVVP 88



>gb:AE008692_239947 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 89

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 50/82 (60%), Positives = 61/82 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  + LGVKKFGGE VI GNII+RQRGT+ + G  VG+GKDHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSAGRRLGVKKFGGESVIGGNIIIRQRGTKVYAGRNVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
             EG V F + KL GR +V V+
Sbjct: 62  TAEGRVVFHKGKL-GRSYVSVD 82



>gb:AE017173_396670 Porphyromonas gingivalis W83 section 2 of 8 of
           the complete genome.>gb:AE015924_1032281 Porphyromonas
           gingivalis W83 complete genome.
          Length = 85

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 50/82 (60%), Positives = 59/82 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS+KNGR+S+ K LGVK +GGE    GNI+VRQRGT  HPG+ VGIGKDHTLYA
Sbjct: 2   AHKKGVGSSKNGRESESKRLGVKVYGGEMAKAGNILVRQRGTVHHPGENVGIGKDHTLYA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           LK G V F R K   R +V ++
Sbjct: 62  LKSGVVVFTRKK-NDRSYVSIK 82



>gb:AE016944_363679 Bacteroides thetaiotaomicron VPI-5482, section
           19 of 21 of the complete genome.>gb:AE015928_990167
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 89

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 48/85 (56%), Positives = 62/85 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS+KNGR+S  K LGVK FGGE    GNII+RQRGT FHPG+ +G+GKDHTL+A
Sbjct: 2   AHKKGVGSSKNGRESHSKRLGVKIFGGEACKAGNIIIRQRGTEFHPGENIGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKD 272
           L +G VKF+  +   R++V + P +
Sbjct: 62  LVDGTVKFKVGR-EDRRYVSIIPAE 85



>sp|Q87BL1|RL27_XYLFT 50S ribosomal protein L27.>gb:AE012558_284834
           Xylella fastidiosa Temecula1, section 6 of 9 of the
           complete genome.>gb:AE009442_961410 Xylella fastidiosa
           Temecula1, complete genome.
          Length = 85

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 48/83 (57%), Positives = 60/83 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS PK LGVK FGG+ +  GNII+RQRGT+FH GD VG+G+DHTL+A
Sbjct: 2   AHKKGVGSSRNGRDSNPKYLGVKLFGGQAIEAGNIIIRQRGTQFHAGDGVGLGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L  G V+F       R+ V+V P
Sbjct: 62  LVNGTVEFSIKGPKKRRTVNVIP 84



>sp|Q9PAS2|RL27_XYLFA 50S ribosomal protein L27.>pir|H82559|H82559
           50S ribosomal protein L27 XF2423 [imported] - Xylella
           fastidiosa (strain 9a5c)>gb:AE004051_50051 Xylella
           fastidiosa 9a5c, section 197 of 229 of the complete
           genome.>gb:AE003849_1117261 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 85

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 48/83 (57%), Positives = 60/83 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS PK LGVK FGG+ +  GNII+RQRGT+FH GD VG+G+DHTL+A
Sbjct: 2   AHKKGVGSSRNGRDSNPKYLGVKLFGGQAIEAGNIIIRQRGTQFHAGDGVGLGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V F       R+ V+V P
Sbjct: 62  LVDGTVAFSIKGPKKRRTVNVIP 84



>sp|P56050|RL27_HELPY 50S ribosomal protein L27.>pir|A64557|A64557
           ribosomal protein L27 - Helicobacter pylori (strain
           26695)>gb:AE000548_24474 Helicobacter pylori 26695
           section 26 of 134 of the complete
           genome.>gb:AE000511_879913 Helicobacter pylori 26695
           complete genome.
          Length = 88

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 53/81 (65%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+N RDS  + LGVKKFG E V  GNIIVRQRGT+ HPG+ VG+GKDHTLYA
Sbjct: 2   AHKKGQGSTQNNRDSAGRRLGVKKFGSEFVRAGNIIVRQRGTKMHPGNNVGMGKDHTLYA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L +G VKFE +K   RK V V
Sbjct: 62  LIDGVVKFE-HKDRNRKKVSV 81



>sp|Q9ZMD8|RL27_HELPJ 50S ribosomal protein L27.>pir|E71951|E71951
           ribosomal protein L27 - Helicobacter pylori (strain
           J99)>gb:AE001465_35276 Helicobacter pylori, strain J99
           section 26 of 132 of the complete
           genome.>gb:AE001439_884046 Helicobacter pylori, strain
           J99 complete genome.
          Length = 88

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 49/77 (63%), Positives = 57/77 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+N RDS  + LGVKKFG E V  GNIIVRQRGT+ HPG+ VG+GKDHTLYA
Sbjct: 2   AHKKGQGSTQNNRDSAGRRLGVKKFGSEFVRAGNIIVRQRGTKIHPGNNVGMGKDHTLYA 61

Query: 346 LKEGCVKFERNKLTGRK 296
           L +G VKFE    + +K
Sbjct: 62  LIDGVVKFEHKDRSRKK 78



>gb:AE017180_401523 Geobacter sulfurreducens PCA, complete genome.
          Length = 85

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 48/70 (68%), Positives = 54/70 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LG KKFGGE V  GNII RQRGT+ HPG  VG GKD+TL+A
Sbjct: 2   AHKKGVGSTRNGRDSESKRLGCKKFGGETVKAGNIIYRQRGTQIHPGTNVGCGKDYTLFA 61

Query: 346 LKEGCVKFER 317
           L +G VKFER
Sbjct: 62  LIDGVVKFER 71



>sp|Q92GG0|RL27_RICCN 50S ribosomal protein L27.>pir|C97845|C97845
           50S ribosomal protein L27 [imported] - Rickettsia
           conorii  (strain Malish 7)>gb:AE008664_239527 Rickettsia
           conorii str. Malish 7, section 96 of 114 of the complete
           genome.>gb:AE006914_1121645 Rickettsia conorii str.
           Malish 7, complete genome.
          Length = 86

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 46/68 (67%), Positives = 55/68 (80%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GS++NGRDS  + LGVKK  G+ VIPGNIIVRQRGT+ HPG  VG+GKDHT++A
Sbjct: 2   ATKKAGGSSRNGRDSAGRRLGVKKADGQYVIPGNIIVRQRGTKIHPGTNVGLGKDHTIFA 61

Query: 346 LKEGCVKF 323
           L EG V+F
Sbjct: 62  LIEGRVEF 69



>sp|P30155|RK27_TOBAC 50S ribosomal protein L27, chloroplast
           precursor (CL27).>pir|A42840|A42840 ribosomal protein
           L27 precursor, chloroplast [similarity] - common
           tobacco>gb:TOBPRL27A_1725510 Nicotiana tabacum ribosomal
           protein L27 mRNA, complete cds.>gb:TOBRPL27_1725537
           Nicotiana tabacum ribosomal protein L27 mRNA, complete
           cds.
          Length = 179

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 50/85 (58%), Positives = 63/85 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK AGSTKNGRDS  + LGVK FG +   PG+IIVRQRGT+FHPG  VG+GKDHT+++
Sbjct: 52  AHKKGAGSTKNGRDSPGQRLGVKIFGDQVAKPGSIIVRQRGTKFHPGKNVGLGKDHTIFS 111

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKD 272
           L +G VKFE+     RK + V P++
Sbjct: 112 LIDGLVKFEKFG-PDRKKISVYPRE 135



>gb:CP000009_862177 Gluconobacter oxydans 621H, complete genome.
          Length = 88

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 52/81 (64%), Positives = 61/81 (75%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  + LGVKKFGGE VI GNIIVRQRGT+   G  VGIG+DHTL+A
Sbjct: 2   AQKKAGGSSRNGRDSAGRRLGVKKFGGESVIAGNIIVRQRGTKMKAGANVGIGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L +G VKF+R +  GR  VHV
Sbjct: 62  LVDGHVKFQR-RAEGR--VHV 79



>gb:AP006841_571536 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 89

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 48/85 (56%), Positives = 62/85 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS+KNGR+S+ K LGVK FGGE    GNIIVRQRGT FHPG+ +G+GKDHTL+A
Sbjct: 2   AHKKGVGSSKNGRESQSKRLGVKIFGGEACKAGNIIVRQRGTEFHPGENIGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKD 272
           L +G V F+  +   R++V + P +
Sbjct: 62  LVDGTVNFKVGR-EDRRYVSIIPAE 85



>gb:AE013598_295322 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 86

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 48/81 (59%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS PK LGVK FGG+ +  GNIIVRQRGT+FHPG  VG+G+DHTL+A
Sbjct: 2   AHKKGVGSSRNGRDSNPKYLGVKIFGGQAIDAGNIIVRQRGTQFHPGAGVGLGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L +G V+F    +  R+ V V
Sbjct: 62  LVDGKVEFSVKGVKKRRTVSV 82



>sp|Q7VK83|RL27_HELHP 50S ribosomal protein L27.>gb:AE017144_389762
           Helicobacter hepaticus ATCC 51449 section 1 of 6 of the
           complete genome.>gb:AE017125_1024024 Helicobacter
           hepaticus ATCC 51449 complete genome.
          Length = 85

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 51/83 (61%), Positives = 61/83 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+N RDS  + LGVK+FG + V  GNIIVRQRGT+ HPGD VG+GKDHT+YA
Sbjct: 2   AHKKGQGSTQNNRDSAGRRLGVKRFGSQFVRAGNIIVRQRGTKVHPGDNVGLGKDHTIYA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G VKF++ K   RK V V P
Sbjct: 62  LIDGVVKFQQ-KDKNRKKVSVIP 83



>gb:BX571658_777896 Wolinella succinogenes, complete genome; segment
           2/7.
          Length = 85

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 51/83 (61%), Positives = 60/83 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+N RDS  + LGVKKFGGE V  GNII+RQRGT+ HPG  VG+G DHT++A
Sbjct: 2   AHKKGQGSTQNNRDSAGRRLGVKKFGGEFVRAGNIIIRQRGTKVHPGSNVGMGTDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G VKFER K   RK V + P
Sbjct: 62  LIDGIVKFER-KDKERKKVSIYP 83



>sp|Q9RY65|RL27_DEIRA 50S ribosomal protein L27.>pir|E75560|E75560
           ribosomal protein L27 - Deinococcus radiodurans (strain
           R1)>gb:AE001872_40375 Deinococcus radiodurans R1 section
           9 of 229 of the complete chromosome
           1.>gb:AE000513_881270 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 91

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 50/82 (60%), Positives = 61/82 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS+KNGRDS PK LGVKKFGGE V  GNI+VRQRGT+F  G  VG+G+DHTL+A
Sbjct: 2   AHKKGVGSSKNGRDSNPKYLGVKKFGGEVVKAGNILVRQRGTKFKAGQGVGMGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVE 281
           L +G V F  NK  G +++ +E
Sbjct: 62  LSDGKVVF-INKGKGARFISIE 82



>sp|Q8PN24|RL27_XANAC 50S ribosomal protein L27.>gb:AE011754_276192
           Xanthomonas axonopodis pv. citri str. 306, section 132
           of 469 of the complete genome.>gb:AE008923_917967
           Xanthomonas axonopodis pv. citri str. 306, complete
           genome.
          Length = 86

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 48/81 (59%), Positives = 59/81 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS PK LGVK FGG+ +  GNIIVRQRGT+FHPG  VG+G+DHTL+A
Sbjct: 2   AHKKGVGSSRNGRDSNPKYLGVKIFGGQAIDAGNIIVRQRGTQFHPGAGVGLGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L +G V+F       R+ V V
Sbjct: 62  LVDGKVEFSTKGPKKRRTVSV 82



>sp|Q7WQL7|RL27_BORBR 50S ribosomal protein
           L27.>sp|Q7W1P1|RL27_BORPA 50S ribosomal protein
           L27.>sp|Q7VZX5|RL27_BORPE 50S ribosomal protein
           L27.>gb:BX640413_805182 Bordetella pertussis strain
           Tohama I, complete genome; segment
           3/12.>gb:BX640423_808564 Bordetella parapertussis strain
           12822, complete genome; segment 1/14.>gb:BX640437_812965
           Bordetella bronchiseptica strain RB50, complete genome;
           segment 1/16.
          Length = 86

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 45/68 (66%), Positives = 54/68 (79%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK +GG+ ++ G+IIVRQRGTRFHPG  VG+GKDHTL+A
Sbjct: 2   AQKKGGGSTRNGRDSESKRLGVKVYGGQSILAGSIIVRQRGTRFHPGVNVGVGKDHTLFA 61

Query: 346 LKEGCVKF 323
           L  G V F
Sbjct: 62  LANGKVHF 69



>sp|Q9ZCI8|RL27_RICPR 50S ribosomal protein L27.>pir|D71635|D71635
           ribosomal protein L27 - Rickettsia
           prowazekii>gb:RPXX04_167514 Rickettsia prowazekii strain
           Madrid E, complete genome; segment 4/4.
          Length = 86

 Score = 95.5 bits (236), Expect = 9e-19
 Identities = 45/68 (66%), Positives = 55/68 (80%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GS++NGRDS  + LGVKK  G+ VIPGNIIVRQRGT+ HPG  VG+GKDHT+++
Sbjct: 2   ATKKAGGSSRNGRDSAGRRLGVKKSDGQYVIPGNIIVRQRGTKIHPGINVGLGKDHTIFS 61

Query: 346 LKEGCVKF 323
           L EG V+F
Sbjct: 62  LIEGRVEF 69



>sp|P57468|RL27_BUCAI 50S ribosomal protein L27.>pir|C84975|C84975
           50S ribosomal protein L27 [imported] - Buchnera sp.
           (strain APS)>gb:BA000003_653745 Buchnera aphidicola str.
           APS (Acyrthosiphon pisum) genomic DNA, complete
           sequence.
          Length = 84

 Score = 95.5 bits (236), Expect = 9e-19
 Identities = 43/81 (53%), Positives = 61/81 (75%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LGVK FGG+ +  G+IIV+QRGT+FHPG  VG GKDHT++A
Sbjct: 2   AHKKAGGSTRNGRDSNAQRLGVKCFGGQLISAGSIIVKQRGTKFHPGKNVGCGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           + +G V+F++  L  R ++++
Sbjct: 62  IVKGKVEFKKKGLKKRTYINI 82



>gb:AE017305_437057 Thermus thermophilus HB27 section 5 of 7 of the
           complete genome.>gb:AE017221_1079035 Thermus
           thermophilus HB27 complete genome.
          Length = 85

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 49/83 (59%), Positives = 61/83 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GSTKNGRDS+ K LGVK++ G+ V  GNI+VRQRGTRF PG  VG+G+D TL+A
Sbjct: 2   AHKKGLGSTKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V+F+     GR +VHV P
Sbjct: 62  LVDGVVEFQDRGRLGR-YVHVRP 83



>sp|Q8PBH1|RL27_XANCP 50S ribosomal protein L27.>gb:AE012213_280405
           Xanthomonas campestris pv. campestris str. ATCC 33913,
           section 121 of 460 of the complete
           genome.>gb:AE008922_913687 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 86

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 48/81 (59%), Positives = 58/81 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS PK LGVK FGG+ +  GNIIVRQRGT+FHPG  VG+G+DHTL+A
Sbjct: 2   AHKKGVGSSRNGRDSNPKYLGVKIFGGQAIDAGNIIVRQRGTQFHPGAGVGLGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L  G V+F       R+ V V
Sbjct: 62  LVNGKVEFTTKGPKKRRTVSV 82



>sp|Q8RBA7|RL27_THETN 50S ribosomal protein L27.>gb:AE013057_288596
           Thermoanaerobacter tengcongensis MB4, section 84 of 244
           of the complete genome.>gb:AE008691_1110661
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 95

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 50/90 (55%), Positives = 66/90 (73%)
 Frame = -3

Query: 544 LVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           ++L+ +A KK  GS++NGRDS+ K LGVK+  G+ V+ GNI+VRQRGT+ HPG  VGIGK
Sbjct: 1   MILQLFAHKKGVGSSRNGRDSESKRLGVKRSDGQFVLAGNILVRQRGTKIHPGANVGIGK 60

Query: 364 DHTLYALKEGCVKFERNKLTGRKWVHVEPK 275
           D TL+AL +G V FER K   +K V V P+
Sbjct: 61  DDTLFALIDGYVVFER-KGRDKKQVSVYPE 89



>sp|Q8K9G2|RL27_BUCAP 50S ribosomal protein L27.>gb:AE014114_303287
           Buchnera aphidicola str. Sg (Schizaphis graminum)
           section 39 of 57 of the complete
           genome.>gb:AE013218_935265 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 84

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 43/81 (53%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LG+K FGGE +  G+IIVRQRGT+FHPG  VG GKDHT++A
Sbjct: 2   AHKKAGGSTRNGRDSNAQRLGIKCFGGELIPAGSIIVRQRGTKFHPGKNVGCGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
             +G V+F++  +  R ++++
Sbjct: 62  TVKGKVEFKKKGIKKRTYINI 82



>gb:BA000045_740899 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 95

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 51/92 (55%), Positives = 61/92 (66%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LGVK++GGERV  GNI++RQRGT+ HPG  VG G D TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNAQRLGVKRYGGERVKAGNILIRQRGTKIHPGANVGRGSDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDGHVLHPI 251
           L EG V FER     RK V V P     + P+
Sbjct: 62  LIEGIVTFERLG-RDRKKVSVYPLAQTAMQPV 92



>gb:AE017256_417942 Wolbachia endosymbiont of Drosophila
           melanogaster, section 1 of 5 of the complete
           genome.>gb:AE017196_1058579 Wolbachia endosymbiont of
           Drosophila melanogaster, complete genome.
          Length = 89

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 49/85 (57%), Positives = 62/85 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK+ GS+ NGRDS  + LG+KK G  +VIPGNIIVRQRGT+FHPG  VGIGKDHT++A
Sbjct: 2   ATKKSGGSSCNGRDSAGRRLGIKKDG--KVIPGNIIVRQRGTKFHPGKNVGIGKDHTIFA 59

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKD 272
             EG V F R+    + ++ + P D
Sbjct: 60  KIEGWVSFRRS-ANKKTFIDILPTD 83



>gb:AE017197_402699 Rickettsia typhi str. Wilmington complete
           genome.
          Length = 86

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 44/68 (64%), Positives = 55/68 (80%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK  GS++NGRDS  + LG+KK  G+ VIPGNIIVRQRGT+ HPG  VG+GKDHT+++
Sbjct: 2   ATKKAGGSSRNGRDSAGRRLGIKKSDGQYVIPGNIIVRQRGTKVHPGINVGLGKDHTIFS 61

Query: 346 LKEGCVKF 323
           L EG V+F
Sbjct: 62  LIEGRVEF 69



>sp|Q82V19|RL27_NITEU 50S ribosomal protein L27.>gb:BX321860_773620
           Nitrosomonas europaea ATCC 19718, complete genome;
           segment 5/10.
          Length = 85

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 47/83 (56%), Positives = 58/83 (69%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  K LGVK++GGE +  G IIVRQRGT+FHPGD VGIG+DHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSHSKRLGVKRYGGEIIRAGGIIVRQRGTQFHPGDNVGIGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
             +G + F       R+ V V P
Sbjct: 62  KVDGKIVFAVKGRMNRRTVAVIP 84



>sp|P59513|RL27_BUCBP 50S ribosomal protein L27.>gb:AE014017_302754
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 2 of 2 of the complete
           genome.>gb:AE016826_981355 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 85

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 46/84 (54%), Positives = 58/84 (69%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  K LGVK FGGE +  G+IIVRQRGT+FH G+ V   KDHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSHSKRLGVKHFGGETIRSGSIIVRQRGTKFHAGNNVDCAKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
             +G VKFE+     R +V + P+
Sbjct: 62  TSQGKVKFEKKGKCNRTYVSIIPE 85



>gb:CP000031_86022 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 89

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 47/83 (56%), Positives = 61/83 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  + LGVKK+GGE V  GNI+VRQRGT+F PG+ VG+GKDHT++A
Sbjct: 2   AHKKAGGSSRNGRDSIGRRLGVKKYGGEAVGAGNILVRQRGTKFWPGEGVGMGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
             +G VKF +  L  R ++ V P
Sbjct: 62  TVDGAVKFHKG-LKKRTFISVLP 83



>sp|P74267|RL27_SYNY3 50S ribosomal protein L27.>pir|S75902|S75902
           ribosomal protein L27 - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_689140 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 87

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 49/83 (59%), Positives = 61/83 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LGVK++GG+ V  G+IIVRQRGT+ HPG+ VG GKD TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNAQRLGVKRYGGQTVTAGSIIVRQRGTQVHPGNNVGRGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G VKFE +K   R+ V V P
Sbjct: 62  LIDGVVKFE-HKTRSRRKVSVYP 83



>sp|Q9Z3H6|RL27_SYNP7 50S ribosomal protein L27.>pir|T44265|T44265
           ribosomal protein L27 [imported] - Synechococcus sp.
           (strain PCC7942)>gb:AB010691_1575 Synechococcus sp.
           KaiABC gene cluster, complete cds.>gb:AP008231_580025
           Synechococcus elongatus PCC 6301 DNA, complete
           genome.>gb:AY120853_590187 Synechococcus sp. PCC 7942
           processing protease-like protein gene, partial cds;
           phycocyanobilin:ferredoxin oxidoreductase-like protein,
           DevB (devB), DevC (devC), tRNA pseudoridine 55 synthase,
           CheY (cheY), 50S ribosomal protein L27, 50S ribosomal
           protein L21, KaiA (kaiA), KaiB (kaiB), KaiC (kaiC),
           glutathione peroxidase, virulence associated protein C,
           rRNA methylase-like protein, PhdD (phdD),
           indole-3-glycerol phosphate synthase-like protein, PdxJ
           (pdxJ), KguA (kguA), AmpA (ampA), MobA (mobA),
           transferrin variant A-like protein,
           6-pyruvoyl-tetrahydropterin synthase-like protein, NugC
           (nugC), NdhK (ndhK), Nu3C (nu3C), RubR (rubR), PsbE
           (psbE), PsbF (psbF), PsbL (psbL), PsbJ (psbJ),
           apolipoprotein N-acyltransferase-like protein, unknown
           protein, IspF (ispF), Ap-4-A phosphorylase II-like
           protein, PanC (panC), Kcy (kcy), and dTDP-glucose
           4-6-dehydratase-like protein genes, complete cds; and
           unknown genes.
          Length = 88

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 49/77 (63%), Positives = 56/77 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LGVKKFGGE V  G+IIVRQRGT+FHPG  VG G D TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNAQRLGVKKFGGEVVRSGSIIVRQRGTKFHPGVNVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRK 296
           L +G V FER    G+K
Sbjct: 62  LIDGVVTFERKGKGGKK 78



>sp|Q9PJ31|RL27_CAMJE 50S ribosomal protein L27.>pir|G81425|G81425
           50S ribosomal protein L27 Cj0095 [imported] -
           Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X1_846518 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment
           1/6.>gb:CP000025_877867 Campylobacter jejuni RM1221,
           complete genome.
          Length = 84

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 52/83 (62%), Positives = 60/83 (72%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+N RDS  + LGVKKFGGE V  GNII+RQRGT  H G+ VG+GKDHT++A
Sbjct: 2   AHKKGQGSTQNNRDSIGRRLGVKKFGGEFVRAGNIIIRQRGTATHAGNNVGMGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G VKFER K   RK V V P
Sbjct: 62  LIDGFVKFER-KDKDRKKVSVYP 83



>sp|P49561|RK27_ODOSI Chloroplast 50S ribosomal protein
           L27.>pir|S78289|S78289 ribosomal protein L27,
           chloroplast - Odontella sinensis
           chloroplast>gb:OSCHLPLXX_1692874 Odontella sinensis
           complete chloroplast genome.
          Length = 83

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 47/69 (68%), Positives = 53/69 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK AGSTKNGRDS  K LGVK+FGG+RV  GNI+VRQRG +F PG  VG GKD TLYA
Sbjct: 2   AHKKGAGSTKNGRDSNAKRLGVKRFGGQRVKAGNILVRQRGMKFTPGLNVGCGKDFTLYA 61

Query: 346 LKEGCVKFE 320
           L +G V F+
Sbjct: 62  LTDGIVNFD 70



>gb:AP008226_579239 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 85

 Score = 94.0 bits (232), Expect = 3e-18
 Identities = 48/83 (57%), Positives = 61/83 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK++ G+ V  GNI+VRQRGTRF PG  VG+G+D TL+A
Sbjct: 2   AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V+F+     GR +VHV P
Sbjct: 62  LVDGVVEFQDRGRLGR-YVHVRP 83



>gb:BX572093_796971 Prochlorococcus marinus MED4 complete genome;
           segment 4/5.
          Length = 86

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 50/83 (60%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  K LGVK +GGE+V  G+II+RQRGT F PG  VG GKD TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNSKRLGVKAYGGEKVSAGSIIIRQRGTSFLPGINVGKGKDDTLFA 61

Query: 346 LKEGCVKFE--RNKLTGRKWVHV 284
           LKEG V F+  +  L  RK V+V
Sbjct: 62  LKEGTVSFDSIKRNLRNRKRVNV 84



>sp|Q8FN77|RL27_COREF 50S ribosomal protein L27.>gb:BA000035_717053
           Corynebacterium efficiens YS-314 DNA, complete genome.
          Length = 88

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 46/81 (56%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK A S+ NGRDS+ K LGVK+FGG++V  G I+VRQRGT+FHPG+ VG G D TL+A
Sbjct: 2   ATKKGASSSSNGRDSEAKRLGVKRFGGQQVNAGEILVRQRGTKFHPGENVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           LK G V+F   +   R+ V++
Sbjct: 62  LKTGAVQFSTKR--NRRMVNI 80



>gb:AY085449_1570518 Arabidopsis thaliana clone 152076 mRNA,
           complete sequence.
          Length = 196

 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 49/85 (57%), Positives = 61/85 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK AGSTKNGRDS  + LGVK +G +   PG IIVRQRGT+FH G  VGIGKDHT+++
Sbjct: 57  AHKKGAGSTKNGRDSPGQRLGVKIYGDQVAKPGAIIVRQRGTKFHAGKNVGIGKDHTIFS 116

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKD 272
           L +G VKFE+     RK + V P++
Sbjct: 117 LIDGLVKFEKFG-PDRKKISVYPRE 140



>sp|P46288|RL27_CRYNE 60S ribosomal protein L27, mitochondrial
           precursor.>pir|JC4568|JC4568 ribosomal protein L27
           precursor, mitochondrial - fungus  (Filobasidium
           floriforme)>gb:CPCRPL27P_1648574 Cryptococcus neoformans
           ribosomal protein L27 (CL27) gene, complete
           cds.>gb:AE017341_1754525 Cryptococcus neoformans var.
           neoformans JEC21 chromosome 1, complete sequence.
          Length = 183

 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 42/75 (56%), Positives = 54/75 (72%)
 Frame = -3

Query: 532 RWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTL 353
           RWA+K   G +KNGR+S  + LGVK++G + V PG IIVRQRG  FHPG  V +GKD T+
Sbjct: 33  RWASKAAGGKSKNGRESAGRRLGVKRYGDQYVTPGTIIVRQRGANFHPGQNVAVGKDFTI 92

Query: 352 YALKEGCVKFERNKL 308
           YAL+ G VKF ++ L
Sbjct: 93  YALQPGYVKFYQHHL 107



>sp|Q9FLN4|RK27_ARATH 50S ribosomal protein L27, chloroplast
           precursor.>gb:AB010072_1510911 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MEE6.>gb:AY046039_1561529 Arabidopsis thaliana
           putative 50S ribosomal protein L27 (At5g40950) mRNA,
           complete cds.>gb:AY117267_1579308 Arabidopsis thaliana
           putative 50S ribosomal protein L27 (At5g40950) mRNA,
           complete cds.
          Length = 198

 Score = 92.8 bits (229), Expect = 6e-18
 Identities = 49/85 (57%), Positives = 61/85 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK AGSTKNGRDS  + LGVK +G +   PG IIVRQRGT+FH G  VGIGKDHT+++
Sbjct: 59  AHKKGAGSTKNGRDSPGQRLGVKIYGDQVAKPGAIIVRQRGTKFHAGKNVGIGKDHTIFS 118

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKD 272
           L +G VKFE+     RK + V P++
Sbjct: 119 LIDGLVKFEKFG-PDRKKISVYPRE 142



>gb:AE017283_430616 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 89

 Score = 92.4 bits (228), Expect = 8e-18
 Identities = 49/88 (55%), Positives = 62/88 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS  + LGVK+FGG+ V  G IIVRQRGT FHPGD VG G D TL+A
Sbjct: 2   AHKKGASSSRNGRDSNAQRLGVKRFGGQLVNAGEIIVRQRGTHFHPGDGVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDGHV 263
           L++G V+F   +  GR+ V+V P +  V
Sbjct: 62  LRDGNVEFGTRR--GRRVVNVTPVEAPV 87



>gb:BX571965_792803 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.>gb:CP000010_866682
           Burkholderia mallei ATCC 23344 chromosome 1, complete
           sequence.
          Length = 87

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 46/83 (55%), Positives = 57/83 (68%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVK +GG+ +  G IIVRQRGTR H G+ VG+GKDHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKVYGGQAINAGGIIVRQRGTRMHAGENVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G VKF       +  V V P
Sbjct: 62  LVDGHVKFTTKGAAKKHTVVVVP 84



>gb:BX294144_768793 Pirellula sp. strain 1 complete genome; segment
           12/24.
          Length = 81

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 44/70 (62%), Positives = 55/70 (78%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  +  GVKKFGGE VI GNI+VRQ GT+FHPG  VG+G D+TL+A
Sbjct: 2   AHKKGQGSSRNGRDSNAQRRGVKKFGGEAVIAGNILVRQVGTKFHPGAGVGMGNDYTLFA 61

Query: 346 LKEGCVKFER 317
           L +G V+F+R
Sbjct: 62  LVDGKVRFDR 71



>gb:AE016912_355810 Chromobacterium violaceum ATCC 12472 section 3
           of 16 of the complete genome.>gb:AE016825_1040964
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 91

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 47/86 (54%), Positives = 59/86 (68%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVK +G E +  G+IIVRQRGT+FH G+ VG GKDHTL+A
Sbjct: 2   AHKKAGGSSRNGRDSEAKRLGVKVYGSELIPAGSIIVRQRGTKFHAGENVGQGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDG 269
             +G V+F       RK V+V P  G
Sbjct: 62  KVDGYVEFTVKGAQQRKTVNVVPYTG 87



>sp|Q82C86|RL27_STRAW 50S ribosomal protein L27.>gb:BA000030_703355
           Streptomyces avermitilis MA-4680 genomic DNA, complete
           genome.
          Length = 84

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 48/83 (57%), Positives = 59/83 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A ST+NGRDS  + LGVK+FGG+ V  G I+VRQRGT FHPG  VG GKD TL+A
Sbjct: 2   AHKKGASSTRNGRDSNAQRLGVKRFGGQVVNAGEILVRQRGTHFHPGSGVGRGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L  G V+F  ++  GRK V++ P
Sbjct: 62  LDAGAVEFGTHR--GRKVVNIVP 82



>sp|P51210|RK27_PORPU Chloroplast 50S ribosomal protein
           L27.>pir|S73131|S73131 ribosomal protein L27,
           chloroplast - red alga (Porphyra purpurea)
           chloroplast>gb:PPU38804_1701526 Porphyra purpurea
           chloroplast, complete genome.
          Length = 86

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 44/71 (61%), Positives = 55/71 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK +GST+NGRDS  K LGVKK+GGE+V  GNI++RQRGT+  PG  VG GKD TL+A
Sbjct: 2   AHKKGSGSTRNGRDSNSKRLGVKKYGGEQVTAGNILIRQRGTKVKPGQNVGKGKDDTLFA 61

Query: 346 LKEGCVKFERN 314
           L +G V FE++
Sbjct: 62  LIDGFVLFEKS 72



>sp|O65037|RK27_ORYSA 50S ribosomal protein L27, chloroplast
           precursor.>pir|T02788|T02788 probable ribosomal protein
           L27 - rice>gb:AF050674_1764182 Oryza sativa ribosomal
           protein L27 precursor, mRNA, nuclear gene encoding
           chloroplast protein, complete cds.>gb:AP004223_1838902
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, BAC clone:B1033B05.>gb:AP004672_1843112
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0592G05.
          Length = 195

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 48/90 (53%), Positives = 63/90 (70%), Gaps = 4/90 (4%)
 Frame = -3

Query: 574 GSDASGEGLSLVLRR----WATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQR 407
           G    G  +++ +RR     A KK AGSTKNGRDS  + LGVK +G +   PG II+RQR
Sbjct: 41  GGVGMGVPMTMPVRRLTIQMAHKKGAGSTKNGRDSPGQRLGVKIYGDQVAKPGAIIIRQR 100

Query: 406 GTRFHPGDYVGIGKDHTLYALKEGCVKFER 317
           GTR +PG+ VG+GKDHTL++L +G VKFE+
Sbjct: 101 GTRVYPGNNVGMGKDHTLFSLIDGLVKFEK 130



>sp|O78430|RK27_GUITH Chloroplast 50S ribosomal protein
           L27.>gb:AF041468_1763484 Guillardia theta complete
           plastid genome.
          Length = 86

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 46/70 (65%), Positives = 54/70 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK +GST+NGRDS  + LGVKK+GGE VI GNI++RQRGT    G  VGIGKD+TLY+
Sbjct: 2   AHKKGSGSTRNGRDSNAQRLGVKKYGGEYVIAGNILIRQRGTNVKAGFNVGIGKDNTLYS 61

Query: 346 LKEGCVKFER 317
           L  G VKFER
Sbjct: 62  LINGEVKFER 71



>gb:AE017321_442332 Wolbachia endosymbiont strain TRS of Brugia
           malayi, complete genome.
          Length = 85

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 46/85 (54%), Positives = 61/85 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK+ G + NGRDS    LG+KK G  +VIPGNIIVRQRGT+FHPG  VG+GKDHT++A
Sbjct: 2   ATKKSGGGSCNGRDSAGCRLGIKKNG--KVIPGNIIVRQRGTKFHPGKNVGMGKDHTIFA 59

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKD 272
             EG ++F R  +  + ++ + P D
Sbjct: 60  KVEGWIRF-RKSVNKKTFIDIVPVD 83



>sp|Q8XVK9|RL27_RALSO 50S ribosomal protein L27.>gb:AL646072_547749
           Ralstonia solanacearum GMI1000 chromosome, complete
           sequence; segment 16/19.
          Length = 86

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 46/83 (55%), Positives = 58/83 (69%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS+ K LGVK +GG+ +  G II+RQRGTR H G  VG+GKDHTL+A
Sbjct: 2   AQKKGGGSTRNGRDSESKRLGVKVYGGQAINAGGIIIRQRGTRTHAGVNVGMGKDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G VKF       +++V V P
Sbjct: 62  LVDGHVKFATRGEGKKQFVDVVP 84



>sp|O51721|RL27_BORBU 50S ribosomal protein L27.>pir|C70197|C70197
           ribosomal protein L27 (rpmA) - Lyme disease
           spirochete>gb:AE001177_32760 Borrelia burgdorferi B31
           (section 63 of 70) of the complete
           genome.>gb:AE000783_1120411 Borrelia burgdorferi B31
           complete genome.
          Length = 81

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 46/81 (56%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           AT K+ GS+KNGRDS  K LGVK+ GG+ V  G IIVRQRGT+FH G  VG+G+D+T++A
Sbjct: 2   ATSKSGGSSKNGRDSISKRLGVKRSGGQFVKAGEIIVRQRGTKFHKGKNVGLGRDYTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L  G V+F+   L GRK+V +
Sbjct: 62  LSSGKVEFK--TLKGRKYVSI 80



>sp|O21275|RM27_RECAM Mitochondrial 60S ribosomal protein
           L27.>pir|S78169|S78169 ribosomal protein L27 -
           Reclinomonas americana (ATCC 50394)
           mitochondrion>gb:AF007261_1231416 Reclinomonas americana
           mitochondrial DNA, complete genome.
          Length = 81

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 43/72 (59%), Positives = 56/72 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           ATKK+ GS++NGRDSK + LGVK FGGE    G+IIVRQRGT+  P   VG+G+DHT++A
Sbjct: 2   ATKKSGGSSRNGRDSKGRRLGVKLFGGEYATIGSIIVRQRGTKILPYKNVGLGRDHTIFA 61

Query: 346 LKEGCVKFERNK 311
           LKEG V + ++K
Sbjct: 62  LKEGIVSYYKDK 73



>sp|Q97JL5|RL27_CLOAB 50S ribosomal protein L27.>pir|C97055|C97055
           ribosomal protein L27 [imported] - Clostridium
           acetobutylicum>gb:AE007639_228591 Clostridium
           acetobutylicum ATCC 824 section 127 of 356 of the
           complete genome.>gb:AE001437_1091546 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 100

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 48/78 (61%), Positives = 56/78 (71%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           LS+ L   A KK  GS+KNGRDS+ K LGVK   GE V+ GNIIVRQRGT+ HPG  VG 
Sbjct: 2   LSINLSLCAHKKGMGSSKNGRDSESKRLGVKASDGEFVLAGNIIVRQRGTKIHPGVNVGR 61

Query: 370 GKDHTLYALKEGCVKFER 317
           GKD TL+A  +G VKFE+
Sbjct: 62  GKDDTLFAKADGLVKFEK 79



>gb:AY673996_1621373 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 87

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 44/72 (61%), Positives = 56/72 (77%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK +GSTKNGRDS+ + LG+KK+GGE VI GNII+RQRG++F PG  V +GKD TL+A
Sbjct: 2   AHKKGSGSTKNGRDSRSQRLGIKKYGGESVIIGNIIIRQRGSQFKPGVNVKLGKDDTLFA 61

Query: 346 LKEGCVKFERNK 311
           L  G V F++ K
Sbjct: 62  LANGKVIFKKKK 73



>sp|Q8NN51|RL27_CORGL 50S ribosomal protein L27.>gb:BA000036_720089
           Corynebacterium glutamicum ATCC 13032 DNA, complete
           genome.>gb:BX927155_833900 Corynebacterium glutamicum
           ATCC 13032, IS fingerprint type 4-5, complete genome;
           segment 8/10.
          Length = 88

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 43/72 (59%), Positives = 54/72 (75%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S+ NGRDS+ K LGVK+FGG++V  G I+VRQRGT+FHPG+ VG G D TL+A
Sbjct: 2   AHKKGASSSSNGRDSEAKRLGVKRFGGQQVSAGEILVRQRGTKFHPGENVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNK 311
           LK G V+F   +
Sbjct: 62  LKTGAVQFSTKR 73



>sp|Q9FD28|RL27_BURPS 50S ribosomal protein L27.>gb:AF292383_496506
           Burkholderia pseudomallei ribosomal protein L21,
           ribosomal protein L27, and GTP-binding protein genes,
           complete cds; and gamma-glutamyl kinase gene, partial
           cds.
          Length = 87

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 46/83 (55%), Positives = 56/83 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ K LGVK +GG+ +  G IIVRQRGTR H G+ VG+GKDHTL A
Sbjct: 2   AHKKAGGSSRNGRDSESKRLGVKVYGGQAINAGGIIVRQRGTRMHAGENVGMGKDHTLVA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G VKF       +  V V P
Sbjct: 62  LVDGHVKFTTKGAAKKHTVVVVP 84



>gb:BX248359_763050 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 6/8.
          Length = 88

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 45/74 (60%), Positives = 57/74 (77%), Gaps = 2/74 (2%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S+ NGRDS+ K LGVK+FGG++V  G I+VRQRGT+FHPG+ VG G D TL+A
Sbjct: 2   AHKKGASSSSNGRDSEAKRLGVKRFGGQQVNAGEILVRQRGTKFHPGENVGRGGDDTLFA 61

Query: 346 LKEGCVKF--ERNK 311
           LK G V+F  +RN+
Sbjct: 62  LKAGAVEFITKRNR 75



>gb:AY552545_627882 Uncultured marine gamma proteobacterium
           EBAC20E09 clone EBAC20E09, complete sequence.
          Length = 85

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 47/84 (55%), Positives = 56/84 (66%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS+KNGRDS  K LGVK+FGG+ V  G I++RQRGT  HPG  VGIGKD TL+A
Sbjct: 2   AHKKAGGSSKNGRDSNSKRLGVKRFGGQFVKAGEILIRQRGTSTHPGLNVGIGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
             EG V+F       RK  +V P+
Sbjct: 62  KSEGIVQFTYKGPKKRKTANVIPQ 85



>sp|Q9X1G7|RL27_THEMA 50S ribosomal protein L27.>pir|A72251|A72251
           ribosomal protein L27 - Thermotoga maritima (strain
           MSB8)>gb:AE001797_39352 Thermotoga maritima MSB8 section
           109 of 136 of the complete genome.>gb:AE000512_1113825
           Thermotoga maritima MSB8, complete genome.
          Length = 83

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 48/81 (59%), Positives = 58/81 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK+ G  KNGRDS PK LGVK   G+ V  GNI+VRQRGTRF+PG  VG+G+D TL+A
Sbjct: 2   AHKKSGGVAKNGRDSLPKYLGVKVGDGQIVKAGNILVRQRGTRFYPGKNVGMGRDFTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           LK+G VKFE      +K+V V
Sbjct: 62  LKDGRVKFETK--NNKKYVSV 80



>sp|Q7U8R7|RL27_SYNPX 50S ribosomal protein L27.>gb:BX569690_775448
           Synechococcus sp. WH8102 complete genome; segment 2/7.
          Length = 88

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 48/83 (57%), Positives = 57/83 (68%), Gaps = 2/83 (2%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  K LGVK +GGE V  G+I++RQRGT   PG  VGIGKD TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNAKRLGVKAYGGETVTAGSILIRQRGTSVLPGINVGIGKDDTLFA 61

Query: 346 LKEGCVKFE--RNKLTGRKWVHV 284
           L  G VKFE  R  L  RK +++
Sbjct: 62  LTAGVVKFETIRRGLRNRKRINI 84



>sp|Q9L1I1|RL27_STRCO 50S ribosomal protein L27.>gb:SCO939113_176270
           Streptomyces coelicolor A3(2) complete genome; segment
           10/29.
          Length = 84

 Score = 90.1 bits (222), Expect = 4e-17
 Identities = 47/83 (56%), Positives = 59/83 (71%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A ST+NGRDS  + LGVK+FGG+ V  G I+VRQRGT FHPG  VG G D TL+A
Sbjct: 2   AHKKGASSTRNGRDSNAQRLGVKRFGGQAVNAGEILVRQRGTHFHPGAGVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L+ G V+F  ++  GRK V++ P
Sbjct: 62  LQAGAVQFGTHR--GRKVVNIVP 82



>gb:AY268081_604357 Candidatus Portiera aleyrodidarum, partial
           genomic sequence.
          Length = 88

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 46/77 (59%), Positives = 54/77 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK AGS++NGRDS  K LGVK +GG+ V  GNIIVRQRGT+   G  VGIG+DHTL+A
Sbjct: 2   AQKKAAGSSRNGRDSNSKRLGVKIYGGQYVNSGNIIVRQRGTKVLAGHGVGIGRDHTLFA 61

Query: 346 LKEGCVKFERNKLTGRK 296
           L  GC+ F   K   RK
Sbjct: 62  LINGCIFFYNIKKGNRK 78



>sp|P95757|RL27_STRGR 50S ribosomal protein L27.>gb:D87916_120983
           Streptomyces griseus DNA for ribosoma protein L21,
           ribosomal protein L27, Obg, complete cds.
          Length = 85

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 47/83 (56%), Positives = 58/83 (69%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A ST+NGRDS  + LGVK+FGG+ V  G I+VRQRGT FHPG  VG G D TL+A
Sbjct: 2   AHKKGASSTRNGRDSNAQRLGVKRFGGQAVNAGEILVRQRGTHFHPGTGVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L  G V+F  ++  GRK V++ P
Sbjct: 62  LAAGAVQFGTHR--GRKVVNIVP 82



>gb:AE016814_1745810 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome I, complete sequence.
          Length = 359

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 49/88 (55%), Positives = 63/88 (71%), Gaps = 1/88 (1%)
 Frame = -3

Query: 544 LVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           LV  R ATK+ AGS  + +DS  + LG KK  G+RV  G II+RQRGTRF+PG+ VGIGK
Sbjct: 19  LVQVRTATKRAAGSRTSMKDSAGRRLGPKKTEGQRVEVGQIIMRQRGTRFYPGENVGIGK 78

Query: 364 DHTLYALKEGCVKFERNKL-TGRKWVHV 284
           DHTL+AL+ G V++  +   TGRK+V V
Sbjct: 79  DHTLFALEPGWVRYYLDPFHTGRKFVGV 106



>sp|O67650|RL27_AQUAE 50S ribosomal protein L27.>pir|H70452|H70452
           ribosomal protein L27 - Aquifex
           aeolicus>gb:AE000755_27004 Aquifex aeolicus VF5 section
           87 of 109 of the complete genome.>gb:AE000657_977535
           Aquifex aeolicus VF5 complete genome.
          Length = 98

 Score = 89.4 bits (220), Expect = 7e-17
 Identities = 43/72 (59%), Positives = 55/72 (76%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A+K + GST+NGRDS  K LGVK++ G+ V  GNIIVRQRGTR +PG  VG+G D+TL+A
Sbjct: 2   ASKASGGSTRNGRDSISKRLGVKRYDGQFVKAGNIIVRQRGTRIYPGKNVGMGSDYTLFA 61

Query: 346 LKEGCVKFERNK 311
           LK+G V FE  +
Sbjct: 62  LKDGYVYFETRR 73



>sp|Q9CGL5|RL27_LACLA 50S ribosomal protein L27.>pir|A86760|A86760
           50S ribosomal protein L27 [imported] - Lactococcus
           lactis subsp. lactis (strain IL1403)>gb:AE006340_217983
           Lactococcus lactis subsp. lactis IL1403 section 102 of
           218 of the complete genome.>gb:AE005176_1095056
           Lactococcus lactis subsp. lactis IL1403, complete
           genome.
          Length = 94

 Score = 89.0 bits (219), Expect = 9e-17
 Identities = 50/91 (54%), Positives = 58/91 (63%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A KK  GST NGRDS+ K LG K   GE V  G+I+ RQRGT  HPG  VG 
Sbjct: 2   LELNLQLFAHKKGGGSTSNGRDSQAKRLGAKASDGELVSGGSILFRQRGTHIHPGTNVGR 61

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHVEP 278
           G DHTL+A  EG VKFE  +  G+K V V P
Sbjct: 62  GGDHTLFAKIEGTVKFEMKR--GKKHVSVYP 90



>gb:AE017251_416791 Treponema denticola ATCC 35405, section 6 of 10
           of the complete genome.>gb:AE017226_1070387 Treponema
           denticola ATCC 35405, complete genome.
          Length = 83

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 45/84 (53%), Positives = 54/84 (64%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK     KNGRDS PK LGVK +GG  V  G+I+VRQRGT  HPG+ VG GKD+TL+A
Sbjct: 2   ARKKGGSGAKNGRDSNPKYLGVKVYGGTEVSAGSILVRQRGTSIHPGNNVGCGKDYTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
             +G V +   K  GRK   +E K
Sbjct: 62  KADGVVTYHERK--GRKLASIEAK 83



>gb:CP000013_870007 Borrelia garinii PBi, complete genome.
          Length = 81

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 45/81 (55%), Positives = 60/81 (74%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           AT K+ GS+KNGRDS  K LGVK+ GG+ V    IIVRQRGT+FH G  VG+G+D+TL+A
Sbjct: 2   ATSKSGGSSKNGRDSISKRLGVKRSGGQFVKAEEIIVRQRGTKFHKGRNVGLGRDYTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L  G V+F+   L G+K+V++
Sbjct: 62  LSSGKVEFK--TLKGKKYVNI 80



>sp|O87885|RL27_LAWIN 50S ribosomal protein L27.>gb:LIU45241_140672
           Lawsonia intracellularis plasmid pISI-2 GTP-binding
           protein homolog gene, partial cds, L27 50S ribosomal
           binding protein homolog, L21 50S ribosomal binding
           protein homolog, GroES/HSP10 homolog, and GroEL/HSP60
           homolog genes, complete cds.
          Length = 88

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 2/85 (2%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  +  G+K+FGG++V+ GNI+VRQ GT+ HPG+ VG+G+D+TL+A
Sbjct: 2   AHKKAGGSSRNGRDSPGQRRGIKRFGGQKVLAGNILVRQLGTKIHPGENVGMGRDYTLFA 61

Query: 346 LKEGCVKFER--NKLTGRKWVHVEP 278
              G V +E    K      VH++P
Sbjct: 62  KVNGIVTYETYFRKCKRYSRVHIQP 86



>sp|P94689|RL27_CHLVI 50S ribosomal protein L27
           (Fragment).>gb:CVRPL27_119794 Chlorobium vibrioforme
           rpl27 gene.
          Length = 84

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 47/83 (56%), Positives = 54/83 (65%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GSTKNGRDS PK LGVK  G   V  G II+RQRGT   PGD  G+GKDHT++A
Sbjct: 2   AHKKGGGSTKNGRDSNPKYLGVKAAGVSTVNAGTIILRQRGTAIKPGDNAGLGKDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V F RN    +K V + P
Sbjct: 62  LVDGTVHF-RNGRNNKKQVDIIP 83



>sp|P41545|RK27_PLECA Chloroplast 50S ribosomal protein
           L27.>pir|S42638|S42638 ribosomal protein L27 - non-green
           alga (Pleurochrysis carterae)
           chloroplast>gb:PEHCPRP27E_1699782 Pleurochrysis carterae
           chloroplast rpl27 gene for ribosomal protein L27,
           complete cds.
          Length = 82

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 47/81 (58%), Positives = 57/81 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK AGSTKNGRDS  K LGVK +G + V  G II+RQRG  F PG  V +G+D+TL+A
Sbjct: 2   AHKKGAGSTKNGRDSNSKRLGVKVYGDQPVKKGGIIIRQRGLTFKPGINVAVGRDYTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L+EG VKFE   +  RK+V V
Sbjct: 62  LQEGDVKFE--TIADRKFVSV 80



>sp|Q8EVW5|RL27_MYCPE 50S ribosomal protein L27.>gb:BA000026_693794
           Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 95

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 43/74 (58%), Positives = 53/74 (71%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A+KK  GSTKNGRDS PK LG KK  GE    G II RQRGT+ +PG  VG+G+DH
Sbjct: 9   LQFFASKKGVGSTKNGRDSNPKYLGAKKSDGEFAKSGQIIYRQRGTKIYPGKNVGLGRDH 68

Query: 358 TLYALKEGCVKFER 317
           TL+A  +G VKF +
Sbjct: 69  TLFAKIDGIVKFTK 82



>gb:AE017312_439181 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 4 of 12 of the complete
           genome.>gb:AE017285_1072342 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 87

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 37/70 (52%), Positives = 56/70 (80%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS+ +  GVK+FGG+ V+ GNI++RQ GT+ HPG+ VG+G+D+TL+A
Sbjct: 2   AHKKAGGSSRNGRDSQGQRRGVKRFGGQLVLAGNILIRQLGTKVHPGENVGMGRDYTLFA 61

Query: 346 LKEGCVKFER 317
             +G V++E+
Sbjct: 62  KVDGTVRYEK 71



>sp|Q8KCB7|RL27_CHLTE 50S ribosomal protein L27.>gb:AE012907_286975
           Chlorobium tepidum TLS section 128 of 194 of the
           complete genome.>gb:AE006470_934143 Chlorobium tepidum
           TLS complete genome.
          Length = 84

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 46/83 (55%), Positives = 55/83 (66%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GSTKNGRDS PK LGVK  GG  V  G II+RQRGT   PG+  G+G+DHT++A
Sbjct: 2   AHKKGGGSTKNGRDSNPKYLGVKAAGGSVVNAGTIILRQRGTAIKPGNNAGLGRDHTIFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEP 278
           L +G V F RN    +K V + P
Sbjct: 62  LVDGTVHF-RNGRNNKKRVDIIP 83



>sp|O83725|RL27_TREPA 50S ribosomal protein L27.>pir|D71286|D71286
           probable ribosomal protein L27 (rpl27) - syphilis
           spirochete>gb:AE001246_33566 Treponema pallidum subsp.
           pallidum str. Nichols section 62 of 87 of the complete
           genome.>gb:AE000520_1049794 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 87

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 45/81 (55%), Positives = 55/81 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A K+    +KNGRDS PK LGVK FGG+    G+I+VRQRGTR HPG+ VG GKD TL+A
Sbjct: 2   ARKRGGSGSKNGRDSNPKYLGVKLFGGQHARAGSILVRQRGTRIHPGENVGRGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L  G V + + K  GR+ V V
Sbjct: 62  LAPGVVTYLQRK--GRRLVSV 80



>sp|Q7V5W4|RL27_PROMM 50S ribosomal protein L27.>gb:BX572099_798763
           Prochlorococcus marinus MIT9313 complete genome; segment
           5/7.
          Length = 88

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 47/83 (56%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  K LGVK +GGE V  G+I++RQRGT   PG  VG GKD TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNSKRLGVKAYGGETVTAGSILIRQRGTSVLPGVNVGQGKDDTLFA 61

Query: 346 LKEGCVKFE--RNKLTGRKWVHV 284
           L +G V FE  R  L  RK + V
Sbjct: 62  LTDGVVAFESIRRSLRNRKRISV 84



>sp|O19885|RK27_CYACA Chloroplast 50S ribosomal protein
           L27.>pir|T11953|T11953 ribosomal protein L27 - red alga
           (Cyanidium caldarium) chloroplast>gb:AF022186_1761821
           Cyanidium caldarium strain RK1 chloroplast, complete
           genome.
          Length = 100

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 44/88 (50%), Positives = 60/88 (68%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK +GS+KNGRDS  K LG+KKFG + V PG IIVRQRGT+  PG  VG+G+D+T+++
Sbjct: 2   AHKKGSGSSKNGRDSNAKYLGIKKFGKQIVTPGQIIVRQRGTKIKPGLNVGLGRDYTIFS 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDGHV 263
           +  G V +   K   +K V V+P  G +
Sbjct: 62  MIAGRVNYSTQK--NKKIVSVDPSYGKI 87



>sp|Q8DMF2|RL27_SYNEL 50S ribosomal protein L27.>gb:BA000039_725951
           Thermosynechococcus elongatus BP-1 DNA, complete genome.
          Length = 86

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 49/86 (56%), Positives = 56/86 (65%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  + LGVK+FGGE V  G I+VRQRGT+FHPG  V  G D TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNAQRLGVKRFGGEVVKAGYILVRQRGTKFHPGVNVARGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDG 269
              G V FER     RK V V P +G
Sbjct: 62  TIAGVVTFERYG-KNRKRVSVYPLEG 86



>sp|Q7VAN2|RL27_PROMA 50S ribosomal protein L27.>gb:AE017165_395881
           Prochlorococcus marinus subsp. marinus str. CCMP1375
           section 5 of 6 of the complete
           genome.>gb:AE017126_1031550 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 87

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 44/77 (57%), Positives = 54/77 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  K LGVK +GGE+V  G+I++RQRGT   PG  VG GKD TL+A
Sbjct: 2   AHKKGTGSTRNGRDSNSKRLGVKAYGGEKVTAGSILIRQRGTSVLPGANVGQGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRK 296
           L +G V FE  K + +K
Sbjct: 62  LVDGIVNFETIKRSLKK 78



>sp|Q9K8J7|RL27_BACHD 50S ribosomal protein L27.>pir|A84026|A84026
           ribosomal protein L27 rpmA [imported] - Bacillus
           halodurans  (strain C-125)>gb:BA000004_656955 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 94

 Score = 86.3 bits (212), Expect = 6e-16
 Identities = 50/92 (54%), Positives = 61/92 (66%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L + L+ +A+KK  GSTKNGRDS  K LG K+  G+ V  G+I+VRQRGTR +PG  VG 
Sbjct: 2   LKMNLQFFASKKGVGSTKNGRDSISKRLGTKRADGQLVTGGSILVRQRGTRIYPGVNVGK 61

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHVEPK 275
           G D TL+A  +G VKFER     RK V V PK
Sbjct: 62  GGDDTLFAKVDGVVKFERVG-RDRKQVSVYPK 92



>gb:AY458644_619833 Uncultured bacterium 562 clone EBAC000-45B06
           genomic sequence.
          Length = 85

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 44/81 (54%), Positives = 53/81 (65%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS+KNGRDS  K LGVK++GG+ V  G I++RQRGT  HPG  VGIGKD TL+A
Sbjct: 2   AHKKAGGSSKNGRDSNAKRLGVKRYGGQVVKAGEILIRQRGTNTHPGINVGIGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
              G V+F       RK  +V
Sbjct: 62  KAAGVVEFTYKGPKSRKTANV 82



>gb:AP006618_557748 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 88

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 45/81 (55%), Positives = 56/81 (69%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS  + LGVK+FGG+ V  G I+VRQRGT FHPG  VG G D TL+A
Sbjct: 2   AHKKGASSSRNGRDSNAQRLGVKRFGGQTVKAGEILVRQRGTHFHPGVNVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L  G V+F   +  GRK V++
Sbjct: 62  LAAGAVQFGTKR--GRKTVNI 80



>gb:AE017333_448751 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858552 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 93

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 49/91 (53%), Positives = 61/91 (67%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK  GSTKNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG+ VG 
Sbjct: 2   LRLDLQFFASKKGVGSTKNGRDSEAKRLGAKRADGQFVSGGSILYRQRGTKIYPGENVGR 61

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHVEP 278
           G D TLYA  +G VKFER     RK V V P
Sbjct: 62  GGDDTLYAKVDGTVKFERFG-RNRKKVSVYP 91



>gb:CR522870_101436 Desulfotalea psychrophila LSv54 chromosome.
          Length = 86

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 41/69 (59%), Positives = 51/69 (73%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GS++NGRDS  +  GVKKFGGE V  GNI++RQ GT+ HPG  VG G+D+TL+A
Sbjct: 2   AHKKAGGSSRNGRDSAGQRRGVKKFGGEPVRSGNILIRQLGTKVHPGTNVGCGRDYTLFA 61

Query: 346 LKEGCVKFE 320
             +G VKFE
Sbjct: 62  KIDGVVKFE 70



>sp|Q8XIJ1|RL27_CLOPE 50S ribosomal protein L27.>gb:BA000016_675168
           Clostridium perfringens str. 13 DNA, complete genome.
          Length = 100

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 44/78 (56%), Positives = 56/78 (71%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L + L+ +A KK  GS+KNGRDS+ K LGVK   G+ V+ GNI+VRQRGT+ HPG  VG 
Sbjct: 2   LKMNLQLFAHKKGVGSSKNGRDSEAKRLGVKCADGQFVLAGNILVRQRGTKIHPGANVGK 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TL+A  +G VK+ER
Sbjct: 62  GGDDTLFAKIDGVVKYER 79



>gb:AE016822_339940 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 85

 Score = 85.5 bits (210), Expect = 9e-16
 Identities = 46/81 (56%), Positives = 55/81 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A ST+NGRDS  + LGVK+FGG+ V  G I+VRQRGT FHPG  VG G D TL+A
Sbjct: 2   AHKKGASSTRNGRDSNAQRLGVKRFGGQTVNAGEILVRQRGTHFHPGANVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L  G V+F      GRK V++
Sbjct: 62  LAAGSVEF--GAKGGRKVVNI 80



>gb:AB002583_1508744 Cyanidioschyzon merolae chloroplast DNA,
           complete genome, strain:10D.
          Length = 104

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 45/92 (48%), Positives = 60/92 (65%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK +GSTKNGRDS PK LGVK    + V  G+I+VRQRG++F PG YV   KD +L+A
Sbjct: 2   AHKKGSGSTKNGRDSNPKYLGVKVGHAKLVSAGSILVRQRGSKFDPGMYVARAKDFSLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPKDGHVLHPI 251
           L +G V+F   +  G+  +H+ P    + HPI
Sbjct: 62  LIDGYVQFAYRR--GKPTIHIHPISHPISHPI 91



>gb:AP006627_564919 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 92

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 43/78 (55%), Positives = 56/78 (71%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L + L+ +A+KK  GSTKNGRDS  K LG K+  G+ V  G+I+VRQRGTR +PG+ VG 
Sbjct: 2   LKMDLQFFASKKGVGSTKNGRDSHSKRLGAKRADGQAVTGGSILVRQRGTRVYPGENVGK 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TL+A  +G VK+ER
Sbjct: 62  GGDDTLFAKIDGVVKYER 79



>gb:SPBP19A11_1720578 S.pombe chromosome II cosmid p19A11.
          Length = 153

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 47/112 (41%), Positives = 68/112 (60%)
 Frame = -3

Query: 631 LFRRLNIRELVSNAPVYSSGSDASGEGLSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKF 452
           LF R+N  +L+  +  Y   S+     L+    R +TK   GS+KN  DS  + LG+K+ 
Sbjct: 6   LFIRVNNFQLLKASLAYKKASNI----LTFPPIRTSTKHGGGSSKNTGDSAGRRLGIKRS 61

Query: 451 GGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVKFERNKLTGRK 296
             + V  G I++RQRGT+FHPGD  G+GKDHT+Y+L  G VKF +  ++ RK
Sbjct: 62  ENQFVRAGEILIRQRGTKFHPGDNTGLGKDHTIYSLVSGYVKFFQMDVSLRK 113



>sp|P75458|RL27_MYCPN 50S ribosomal protein L27.>pir|S73835|S73835
           ribosomal protein L27 - Mycoplasma pneumoniae (strain
           ATCC 29342)>gb:AE000050_19405 Mycoplasma pneumoniae M129
           section 30 of 63 of the complete
           genome.>gb:U00089_1101367 Mycoplasma pneumoniae M129,
           complete genome.
          Length = 104

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 41/74 (55%), Positives = 53/74 (71%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A+KK  GSTKNGRDS  K LG KK  G+ +  G II RQRGTR +PG  VG+G D 
Sbjct: 12  LQFFASKKGVGSTKNGRDSHAKRLGAKKADGQMIRTGQIIYRQRGTRVYPGVNVGLGSDD 71

Query: 358 TLYALKEGCVKFER 317
           TL+AL +G VK+++
Sbjct: 72  TLFALSDGLVKYQK 85



>sp|Q892N6|RL27_CLOTE 50S ribosomal protein L27.>gb:AE015943_321121
           Clostridium tetani E88, section 8 of 10 of the complete
           genome.>gb:AE015927_963910 Clostridium tetani E88,
           complete genome.
          Length = 101

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 42/78 (53%), Positives = 57/78 (73%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L + L+ +ATKK  GS+KNGRDS+ K LGVK   G+ V+ G+I+VRQRGT+ HPG  VG 
Sbjct: 2   LLMNLQLFATKKGVGSSKNGRDSEAKRLGVKCADGQFVLAGSILVRQRGTKIHPGQNVGR 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TL++  +G V++ER
Sbjct: 62  GGDDTLFSKVDGVVRYER 79



>gb:AE017235_412970 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 9 of 16 of the complete
           genome.>gb:AE016958_1056374 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 88

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 45/81 (55%), Positives = 57/81 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS  + LGVK+FGG+ V  G IIVRQRGT+FHPG  VG G D TL+A
Sbjct: 2   AHKKGASSSRNGRDSAAQRLGVKRFGGQIVKAGEIIVRQRGTKFHPGTGVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
            + G V+F   +  GRK V++
Sbjct: 62  KQAGAVEFGIKR--GRKTVNI 80



>gb:AE017263_420994 Mesoplasma florum L1 complete genome.
          Length = 95

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 43/76 (56%), Positives = 53/76 (69%)
 Frame = -3

Query: 544 LVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           L L+ +A+KK  GSTKNGRDS+ K LG KK  G+    G+II RQRGT+ HPG  VG G 
Sbjct: 5   LNLQFFASKKGVGSTKNGRDSESKRLGAKKADGQFANAGSIIFRQRGTKIHPGQNVGRGG 64

Query: 364 DHTLYALKEGCVKFER 317
           D TL+AL  G VK+E+
Sbjct: 65  DDTLFALVSGIVKYEK 80



>sp|P05657|RL27_BACSU 50S ribosomal protein L27 (BL30)
           (BL24).>pir|C21895|C21895 ribosomal protein L27 -
           Bacillus subtilis>gb:BSSPOOUP_751248 Bacillus subtilis
           gene upstream of spoOB locus for homolog of ribosomal
           protein L27 of E. coli.>gb:BSUB0015_754759 Bacillus
           subtilis complete genome (section 15 of 21): from
           2812801 to 3013507.
          Length = 94

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 43/78 (55%), Positives = 56/78 (71%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK  GSTKNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG+ VG 
Sbjct: 2   LRLDLQFFASKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGR 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TL+A  +G VKFER
Sbjct: 62  GGDDTLFAKIDGTVKFER 79



>sp|Q817U4|RL27_BACCR 50S ribosomal protein L27.>gb:AE017012_379305
           Bacillus cereus ATCC 14579 section 15 of 18 of the
           complete genome.>gb:AE017278_425734 Bacillus cereus ATCC
           10987, section 15 of 18 of the complete
           genome.>gb:AE016877_1019555 Bacillus cereus ATCC 14579
           complete genome.>gb:AE017194_1064153 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 96

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 48/91 (52%), Positives = 60/91 (65%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK  GSTKNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG  VG 
Sbjct: 2   LRLDLQFFASKKGVGSTKNGRDSQSKRLGAKRADGQTVTGGSILYRQRGTKIYPGVNVGR 61

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHVEP 278
           G D TLYA  +G V+FER     RK V V P
Sbjct: 62  GGDDTLYAKVDGVVRFERLG-RDRKQVSVYP 91



>gb:AE017308_437927 Mycoplasma mobile 163K complete genome.
          Length = 85

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 41/74 (55%), Positives = 53/74 (71%), Gaps = 2/74 (2%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A  K+ GST NGRDSK + LG K   G+  + G+II RQRGT+ HPG+ VGIGKDHTLY 
Sbjct: 2   AKTKSGGSTSNGRDSKGRRLGQKLGDGQFALAGSIIYRQRGTKIHPGENVGIGKDHTLYT 61

Query: 346 LKEGCVKF--ERNK 311
           L +G +K+  +RN+
Sbjct: 62  LIDGYIKYAIKRNR 75



>sp|Q81LE8|RL27_BACAN 50S ribosomal protein L27.>gb:AE017038_384616
           Bacillus anthracis str. Ames section 15 of 18 of the
           complete genome.>gb:AE017225_409714 Bacillus anthracis
           str. Sterne, complete genome.>gb:AE017334_454463
           Bacillus anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE017355_465469 Bacillus thuringiensis
           serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_854786 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1014321 Bacillus anthracis str. Ames
           complete genome.
          Length = 96

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 48/91 (52%), Positives = 60/91 (65%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK  GSTKNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG  VG 
Sbjct: 2   LRLDLQFFASKKGVGSTKNGRDSQSKRLGAKRADGQTVSGGSILYRQRGTKIYPGVNVGR 61

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHVEP 278
           G D TLYA  +G V+FER     RK V V P
Sbjct: 62  GGDDTLYAKVDGVVRFERLG-RDRKQVSVYP 91



>sp|Q9CBZ3|RL27_MYCLE 50S ribosomal protein L27.>pir|C87092|C87092
           50S ribosomal protein L27 [imported] - Mycobacterium
           leprae>gb:MLEPRTN6_147267 Mycobacterium leprae strain TN
           complete genome; segment 6/10.
          Length = 88

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 44/81 (54%), Positives = 56/81 (69%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS  + LGVK+FGG+ V  G I+VRQRGT+FHPG  VG G D TL+A
Sbjct: 2   AHKKGASSSRNGRDSAAQRLGVKRFGGQVVKAGEILVRQRGTKFHPGVNVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
              G V+F   +  GRK V++
Sbjct: 62  TSAGAVEFGVKR--GRKTVNI 80



>gb:BA000043_739185 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 96

 Score = 82.8 bits (203), Expect = 6e-15
 Identities = 44/78 (56%), Positives = 54/78 (69%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK  GSTKNGRDS  K LG K+  G+ V  G+I+ RQRGT+ HPG  VG 
Sbjct: 2   LRLDLQFFASKKGVGSTKNGRDSIAKRLGAKRADGQFVTSGSILYRQRGTKVHPGLNVGR 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TLYA  +G V+FER
Sbjct: 62  GGDDTLYAKIDGIVRFER 79



>gb:AE016851_348996 Tropheryma whipplei str. Twist, section 2 of 3
           of the complete genome.>gb:AE014184_1029192 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 82

 Score = 82.8 bits (203), Expect = 6e-15
 Identities = 42/71 (59%), Positives = 50/71 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS  K LGVK+F G+ V  G I+VRQRGTRFHPG  V  G D TL+A
Sbjct: 2   AHKKGASSSRNGRDSNAKRLGVKRFAGQVVSAGEILVRQRGTRFHPGTNVRRGDDDTLFA 61

Query: 346 LKEGCVKFERN 314
           L  G V+F R+
Sbjct: 62  LASGRVRFGRS 72



>sp|Q836X4|RL27_ENTFA 50S ribosomal protein L27.>gb:AE016950_365038
           Enterococcus faecalis V583, section 4 of 11 of the
           complete genome.>gb:AE016830_991526 Enterococcus
           faecalis V583, complete genome.
          Length = 95

 Score = 82.8 bits (203), Expect = 6e-15
 Identities = 46/91 (50%), Positives = 60/91 (65%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L++ L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT+ +PG  VGI
Sbjct: 3   LTMNLQLFAHKKGGGSTSNGRDSESKRLGAKSADGQTVTGGSILYRQRGTKIYPGVNVGI 62

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHVEP 278
           G D TL+A  +G V+FER K   +K V V P
Sbjct: 63  GGDDTLFAKVDGVVRFER-KGRDKKQVSVYP 92



>gb:BX842643_822570 Mycoplasma mycoides subsp. mycoides SC genomic
           DNA, complete sequence; segment 2/4.
          Length = 93

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 43/76 (56%), Positives = 53/76 (69%)
 Frame = -3

Query: 544 LVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           L L+ +A+KK  GSTKNGRDS+ K LG KK  G+    G+II RQRGT+ HPG  VG G 
Sbjct: 5   LGLQYFASKKGVGSTKNGRDSESKRLGAKKSDGQFTNAGSIIYRQRGTKIHPGLNVGRGG 64

Query: 364 DHTLYALKEGCVKFER 317
           D TL+AL  G VK+E+
Sbjct: 65  DDTLFALIAGTVKYEK 80



>sp|Q8CS89|RL27_STAEP 50S ribosomal protein L27.>gb:CP000029_81812
           Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016748_322978 Staphylococcus epidermidis
           ATCC 12228, section 5 of 9 of the complete
           genome.>gb:AE015929_1147647 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 94

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 42/78 (53%), Positives = 55/78 (70%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK   STKNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG+ VG 
Sbjct: 2   LKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQYVSGGSILYRQRGTKIYPGENVGR 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TL+A  +G VKFER
Sbjct: 62  GGDDTLFAKIDGVVKFER 79



>sp|Q931Q3|RL27_STAAM 50S ribosomal protein
           L27.>sp|Q99TK8|RL27_STAAN 50S ribosomal protein
           L27.>pir|D89947|D89947 50S ribosomal protei L27 (BL30)
           [imported] - Staphylococcus aureus (strain
           N315)>gb:CP000046_91818 Staphylococcus aureus subsp.
           aureus COL, complete genome.>gb:BA000017_677333
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_679919 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete
           genome.>gb:BA000033_711887 Staphylococcus aureus subsp.
           aureus MW2 DNA, complete genome,
           strain:MW2.>gb:BX571856_781160 Staphylococcus aureus
           subsp. aureus strain MRSA252, complete
           genome.>gb:BX571857_783802 Staphylococcus aureus strain
           MSSA476, complete genome.
          Length = 94

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 42/78 (53%), Positives = 55/78 (70%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK   STKNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG+ VG 
Sbjct: 2   LKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGR 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TL+A  +G VKFER
Sbjct: 62  GGDDTLFAKIDGVVKFER 79



>gb:AE017204_404712 Lactobacillus johnsonii NCC 533, section 5 of 7
           of the complete genome.>gb:AE017198_1123199
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 99

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 45/87 (51%), Positives = 56/87 (64%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A  K  GST NGR+S  + LG K+  G+++  G+II RQRGT+ HPG  VGIG D 
Sbjct: 9   LKLFAHHKGGGSTANGRNSAGRRLGAKRADGQKINAGSIIFRQRGTKIHPGKNVGIGGDD 68

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+AL  G VKFER     RK V V P
Sbjct: 69  TLFALTSGVVKFERLG-RDRKQVSVYP 94



>sp|P41552|RK27_PLEHA Chloroplast 50S ribosomal protein L27
           (Fragment).>gb:PEHCPRP27G_1699784 Pleurochrysis
           haptonemofera chloroplast rpl27 gene for ribosomal
           protein L27, partial cds.
          Length = 74

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 42/74 (56%), Positives = 52/74 (70%)
 Frame = -3

Query: 505 STKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVK 326
           STKNGRDS  K LGVK +G + +  G II+RQRG  F PG  V +GKD+TL+AL+EG VK
Sbjct: 1   STKNGRDSNSKRLGVKVYGNQPIKKGGIIIRQRGLTFKPGINVAVGKDYTLFALQEGDVK 60

Query: 325 FERNKLTGRKWVHV 284
           FE   +  RK+V V
Sbjct: 61  FE--TIANRKFVSV 72



>gb:CR382126_1658904 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 364

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 41/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query: 532 RWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTL 353
           R ATK+ AGS  + +DS  + LG KK+ G+    G II+RQRGT+F+PG+ VGIGKDHTL
Sbjct: 18  RTATKRAAGSRTSMKDSAGRRLGPKKYEGQATQVGEIIMRQRGTKFYPGENVGIGKDHTL 77

Query: 352 YALKEGCVKFERNKL-TGRKWVHV 284
           +AL+ G V++  +    G+K++ V
Sbjct: 78  FALEPGYVRYYLDPFHPGKKFIGV 101



>gb:CR380954_1651222 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 368

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 41/86 (47%), Positives = 60/86 (69%), Gaps = 1/86 (1%)
 Frame = -3

Query: 577 SGSDASGEGLSLVLR-RWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGT 401
           SG   S     +V++ R ATK+ AGS  + +DS  + LG KK+ G+ V PG II+RQRGT
Sbjct: 3   SGLHTSKYACQVVVQIRTATKRAAGSRTSMKDSAGRRLGPKKYEGQDVKPGEIIMRQRGT 62

Query: 400 RFHPGDYVGIGKDHTLYALKEGCVKF 323
           +F+PG+ V IG+DHT+YA++ G V++
Sbjct: 63  KFYPGENVKIGRDHTIYAVEPGVVRY 88



>gb:ARGTE1826_582538 Arthrobacter sp. gene for sarcosine oxidase,
           complete cds.
          Length = 84

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 41/74 (55%), Positives = 53/74 (71%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A+KK  GSTKNGRDS  K LG K+  G+ V  G+I+ RQRGT+ +PG+ VG G D 
Sbjct: 7   LQLFASKKGVGSTKNGRDSISKRLGAKRADGQFVSGGSILYRQRGTKIYPGENVGRGGDD 66

Query: 358 TLYALKEGCVKFER 317
           TL+A  +G VKFER
Sbjct: 67  TLFAKVDGVVKFER 80



>gb:AP006628_566523 Onion yellows phytoplasma OY-M DNA, complete
           genome.
          Length = 92

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 47/89 (52%), Positives = 56/89 (62%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L ++ +A+KK AGST+NGRDS  K LG K   G+    G II RQRGT+ HPG  VG 
Sbjct: 3   LQLQIQLFASKKGAGSTRNGRDSHSKRLGAKLSDGQFAKAGAIIYRQRGTKIHPGFNVGR 62

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHV 284
           G D TL+A   G +KFE  K  GRK V V
Sbjct: 63  GGDDTLFAKMSGIIKFE--KKHGRKKVSV 89



>sp|P48535|RM02_KLULA 60S ribosomal protein L2, mitochondrial
           precursor.>gb:KLU38369_1683695 Kluyveromyces lactis 50S
           subunit ribosomal protein (MRP7) gene, nuclear gene
           encoding mitochondrial protein, complete cds.
          Length = 364

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 41/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query: 532 RWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTL 353
           R ATK+ AGS  + +DS  + LG KK+ G+    G II+RQRGT+F+PG+ VGIGKDHTL
Sbjct: 18  RTATKRAAGSRTSMKDSAGRRLGPKKYEGQATQVGEIIMRQRGTKFYPGENVGIGKDHTL 77

Query: 352 YALKEGCVKFERNKL-TGRKWVHV 284
           +AL+ G V++  +    G+K++ V
Sbjct: 78  FALEPGYVRYYLDPFHPGKKFIGV 101



>gb:BX251411_764494 Tropheryma whipplei TW08/27, complete genome;
           segment 2/3.
          Length = 82

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 41/71 (57%), Positives = 49/71 (69%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS  K LGVK+F G+ V  G I+VRQRGTRFHPG  V  G D TL+A
Sbjct: 2   AHKKGASSSRNGRDSNAKRLGVKRFAGQVVSAGEILVRQRGTRFHPGTNVRRGDDDTLFA 61

Query: 346 LKEGCVKFERN 314
              G V+F R+
Sbjct: 62  CASGRVRFGRS 72



>sp|Q8EPP8|RL27_OCEIH 50S ribosomal protein L27.>gb:BA000028_696431
           Oceanobacillus iheyensis HTE831 DNA, complete genome.
          Length = 96

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 46/91 (50%), Positives = 61/91 (67%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ ++TKK  GS+KNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG+ VG 
Sbjct: 2   LRLDLQFFSTKKGQGSSKNGRDSESKRLGSKRADGQFVSGGSILYRQRGTKIYPGENVGR 61

Query: 370 GKDHTLYALKEGCVKFERNKLTGRKWVHVEP 278
           G D TL++  +G VKFER     RK V V P
Sbjct: 62  GGDDTLFSKIDGVVKFERYG-RNRKKVSVYP 91



>gb:AE014185_937908 Plasmodium falciparum 3D7 chromosome 10 complete
           sequence.>gb:AE014834_1228642 Plasmodium falciparum 3D7
           chromosome 10 section 6 of 7 of the complete sequence.
          Length = 214

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 41/69 (59%), Positives = 46/69 (66%)
 Frame = -3

Query: 529 WATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLY 350
           WA KK  GS++NGRDS PKNLGVK  G      GNIIVRQRG  F PG+ V  G+D TL 
Sbjct: 108 WAKKKGVGSSRNGRDSNPKNLGVKVLGNNFAHAGNIIVRQRGRTFKPGNGVKQGRDFTLI 167

Query: 349 ALKEGCVKF 323
           A+K G V F
Sbjct: 168 AVKSGKVHF 176



>sp|P71908|RL27_MYCTU 50S ribosomal protein L27.>pir|G70680|G70680
           probable ribosomal protein L27 rpmA - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_22585
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248342_759824 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           9/14.>gb:BX842579_820528 Mycobacterium tuberculosis
           H37Rv complete genome; segment 8/13.
          Length = 86

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 43/81 (53%), Positives = 55/81 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK A S++NGRDS  + LGVK++GG+ V  G I+VRQRGT+FHPG  VG G D TL+A
Sbjct: 2   AHKKGASSSRNGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFHPGVNVGRGGDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
              G V+F   +  GRK V +
Sbjct: 62  KTAGAVEFGIKR--GRKTVSI 80



>gb:CR382139_1672501 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 394

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 38/70 (54%), Positives = 49/70 (70%)
 Frame = -3

Query: 532 RWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTL 353
           R ATK+ AGS  N  DS  + LG K + G  V PG II+RQRGT+ HPG+ V IGKDHT+
Sbjct: 33  RTATKRAAGSKTNKNDSAGRRLGPKAYEGHFVKPGQIIMRQRGTKIHPGENVDIGKDHTI 92

Query: 352 YALKEGCVKF 323
           +A++ G V+F
Sbjct: 93  FAIEPGYVRF 102



>sp|P41550|RK27_CHRHI Chloroplast 50S ribosomal protein L27
           (Fragment).>gb:CA3CPRP27D_1644702 Chrysochromulina hirta
           chloroplast rpl27 gene for ribosomal protein L27,
           partial cds.
          Length = 73

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 40/74 (54%), Positives = 53/74 (71%)
 Frame = -3

Query: 505 STKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVK 326
           STKNGRDS  + LGVK +G + V  G I+VRQRG  F PG+ + +GKD+TL++ K+G V+
Sbjct: 1   STKNGRDSNSQRLGVKVYGNQPVKAGGIVVRQRGLTFKPGNSMKVGKDYTLFSCKDGIVQ 60

Query: 325 FERNKLTGRKWVHV 284
           FE N  T  K+VHV
Sbjct: 61  FETNGKT--KFVHV 72



>gb:SCN200XG_1708816 s.cerevisiae N2005, N2007, N2009, N2012, N2014,
           N2016 genes.
          Length = 371

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 37/70 (52%), Positives = 53/70 (75%)
 Frame = -3

Query: 532 RWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTL 353
           R ATK+ AGS  + +DS  + LG KK+ G+ V  G II+RQRGT+F+PG+ VGIGKDH++
Sbjct: 26  RNATKRAAGSRTSMKDSAGRRLGPKKYEGQDVSTGEIIMRQRGTKFYPGENVGIGKDHSI 85

Query: 352 YALKEGCVKF 323
           +AL+ G V++
Sbjct: 86  FALEPGVVRY 95



>sp|P12687|RM02_YEAST 60S ribosomal protein L2, mitochondrial
           precursor (YmL2) (YMR6).>pir|S62914|R6BYM7 ribosomal
           protein YmL2 precursor, mitochondrial - yeast
           (Saccharomyces cerevisiae)>gb:AY693088_1623135
           Saccharomyces cerevisiae clone FLH158376.01X YNL005C
           gene, complete cds.>gb:SCYNL005C_1713588 S.cerevisiae
           chromosome XIV reading frame ORF
           YNL005c.>gb:YSCMRP7_1729931 Yeast (S.cerevisiae)
           mitochondrial 40 kd ribosomal protein large subunit
           gene, complete cds.
          Length = 371

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 37/70 (52%), Positives = 53/70 (75%)
 Frame = -3

Query: 532 RWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTL 353
           R ATK+ AGS  + +DS  + LG KK+ G+ V  G II+RQRGT+F+PG+ VGIGKDH++
Sbjct: 26  RNATKRAAGSRTSMKDSAGRRLGPKKYEGQDVSTGEIIMRQRGTKFYPGENVGIGKDHSI 85

Query: 352 YALKEGCVKF 323
           +AL+ G V++
Sbjct: 86  FALEPGVVRY 95



>pir|AE3277|AE3277 LSU ribosomal protein L27P [imported] - Brucella
           melitensis  (strain 16M)>gb:AE009463_252121 Brucella
           melitensis 16M chromosome I, section 20 of 195 of the
           complete sequence.>gb:AE008917_978033 Brucella
           melitensis 16M chromosome I, complete sequence.
          Length = 67

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 38/62 (61%), Positives = 46/62 (74%)
 Frame = -3

Query: 463 VKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVKFERNKLTGRKWVHV 284
           +KKFGGE V+ GNIIVRQRGT++HPG  VG+GKDHT++A   G V F R K  GR +V V
Sbjct: 1   MKKFGGEAVLAGNIIVRQRGTKWHPGANVGLGKDHTIFATVNGSVSF-RTKANGRTYVSV 59

Query: 283 EP 278
            P
Sbjct: 60  NP 61



>sp|Q9Z807|RL27_CHLPN 50S ribosomal protein L27.>pir|B72065|B72065
           ribosomal protein L27 [imported] - Chlamydophila
           pneumoniae  (strains CWL029 and AR39)>pir|E86558|E86558
           L27 ribosomal protein [imported] - Chlamydophila
           pneumoniae  (strain J138)>gb:AE001639_37397 Chlamydia
           pneumoniae section 55 of 103 of the complete
           genome.>gb:AE002181_43693 Chlamydophila pneumoniae AR39,
           section 17 of 94 of the complete
           genome.>gb:AE017159_393907 Chlamydophila pneumoniae
           TW-183, section 3 of 4 of the complete
           genome.>gb:BA000008_663914 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_885818
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_941954 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028169 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 84

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 42/84 (50%), Positives = 57/84 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  G+++NGRDSK K LGVK   G++V  G+I+VRQRGTR++P   VG G+D TL+A
Sbjct: 2   AHKKGQGASRNGRDSKSKRLGVKVGAGQKVSTGSILVRQRGTRWNPAQNVGRGRDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           L +G V     K T R ++ V P+
Sbjct: 62  LVDGIVVM---KKTNRTYISVVPE 82



>gb:BX908798_829774 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 83

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 40/74 (54%), Positives = 50/74 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  GST+NGRDS  K LG+K   GE V  G+I+VRQRGT++HP   VG G D TL+A
Sbjct: 2   AHKKGQGSTRNGRDSHSKRLGIKVGSGEVVRAGSILVRQRGTKWHPAKNVGRGTDDTLFA 61

Query: 346 LKEGCVKFERNKLT 305
           L +G V F ++  T
Sbjct: 62  LADGVVAFRKSNKT 75



>sp|Q8DUQ4|RL27_STRMU 50S ribosomal protein L27.>gb:AE014926_313238
           Streptococcus mutans UA159 section 74 of 185 of the
           complete genome.>gb:AE014133_940239 Streptococcus mutans
           UA159 complete genome.
          Length = 97

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 45/87 (51%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 9   LQLFAHKKGGGSTSNGRDSESKRLGAKAADGQTVTGGSILYRQRGTHIYPGANVGRGGDD 68

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 69  TLFAKVEGVVRFER-KGRDKKQVSVYP 94



>sp|O84424|RL27_CHLTR 50S ribosomal protein L27.>pir|E81673|E81673
           ribosomal protein L27 TC0700 [imported] - Chlamydia
           muridarum (strain Nigg)>pir|F71517|F71517 probable L27
           ribosomal protein - Chlamydia trachomatis  (serotype D,
           strain UW3/Cx)>gb:AE001315_34351 Chlamydia trachomatis
           D/UW-3/CX section 42 of 87 of the complete
           genome.>gb:AE002339_45284 Chlamydia muridarum Nigg
           section 67 of 85 of the complete
           genome.>gb:AE001273_1098377 Chlamydia trachomatis
           D/UW-3/CX, complete genome.>gb:AE002160_1149424
           Chlamydia muridarum Nigg, complete genome.
          Length = 83

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 43/84 (51%), Positives = 57/84 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  G+++NGRDS+ K LG+K   G+RV  G+I+VRQRGT++HP   VG GKD TL+A
Sbjct: 2   AHKKGQGASRNGRDSESKRLGLKVGAGQRVSTGSILVRQRGTKWHPAVNVGRGKDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           L +G V     K T R +V V P+
Sbjct: 62  LVDGIVVM---KKTDRTYVSVIPQ 82



>gb:AE016968_369638 Mycoplasma gallisepticum strain R section 2 of 4
           of the complete genome.>gb:AE015450_1034287 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 98

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 43/83 (51%), Positives = 53/83 (63%)
 Frame = -3

Query: 544 LVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           L L+ +A+KK  GSTKNGRDS PK LG K   G++   G II RQRG +  PG  VG GK
Sbjct: 8   LDLQFFASKKGVGSTKNGRDSNPKFLGAKLADGQQAKTGQIIYRQRGNKIWPGKNVGQGK 67

Query: 364 DHTLYALKEGCVKFERNKLTGRK 296
           D TL+AL +G V++   K  G K
Sbjct: 68  DDTLFALADGIVRY--TKFLGNK 88



>gb:AE014254_306672 Streptococcus agalactiae 2603V/R section 64 of
           100 of the complete genome.>gb:AE009948_936785
           Streptococcus agalactiae 2603V/R complete genome.
          Length = 94

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/87 (51%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 6   LQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGGSILYRQRGTHIYPGANVGRGGDD 65

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 66  TLFAKVEGVVRFER-KGRDKKQVSVYP 91



>gb:SAG766850_170966 Streptococcus agalactiae NEM316 complete
           genome, segment 8.
          Length = 97

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/87 (51%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 9   LQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGGSILYRQRGTHIYPGANVGRGGDD 68

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 69  TLFAKVEGVVRFER-KGRDKKQVSVYP 94



>sp|Q9PQT2|RL27_UREPA 50S ribosomal protein L27.>pir|D82920|D82920
           ribosomal protein L27 UU210 [imported] - Ureaplasma
           urealyticum>gb:AE002120_43081 Ureaplasma parvum serovar
           3 str. ATCC 700970 section 21 of 59 of the complete
           genome.>gb:AF222894_1114452 Ureaplasma parvum serovar 3
           str. ATCC 700970, complete genome.
          Length = 100

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 46/90 (51%), Positives = 56/90 (62%), Gaps = 1/90 (1%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A+KK  GS+KNGRDS PK LG K   G+    G II RQRG + +PG  VG GKDH
Sbjct: 10  LQLFASKKGVGSSKNGRDSNPKYLGAKLGDGQSTKAGQIIYRQRGNKIYPGLNVGQGKDH 69

Query: 358 TLYALKEGCVKFERNKLTGRKW-VHVEPKD 272
           TL+A   G VK+   K  G K  V V PK+
Sbjct: 70  TLFAKTAGVVKY--TKFMGDKTKVSVLPKE 97



>sp|Q97QU2|RL27_STRPN 50S ribosomal protein L27.>pir|A95128|A95128
           ribosomal protein L27 [imported] - Streptococcus
           pneumoniae  (strain TIGR4)>gb:AE007411_226279
           Streptococcus pneumoniae TIGR4 section 94 of 194 of the
           complete genome.>gb:AE005672_1104047 Streptococcus
           pneumoniae TIGR4, complete genome.
          Length = 94

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 45/87 (51%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 6   LQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVTGGSILYRQRGTHIYPGVNVGRGGDD 65

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 66  TLFAKVEGVVRFER-KGRDKKQVSVYP 91



>sp|P47476|RL27_MYCGE 50S ribosomal protein L27.>pir|H64225|H64225
           ribosomal protein L27 - Mycoplasma
           genitalium>gb:U39703_205647 Mycoplasma genitalium G-37
           section 25 of 51 of the complete
           genome.>gb:L43967_1100799 Mycoplasma genitalium G-37,
           complete genome.
          Length = 104

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 38/74 (51%), Positives = 51/74 (68%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A+KK  GSTKNGRDS  K LG KK  G+ +  G II RQRGT+   G  V +G D+
Sbjct: 12  LQFFASKKGVGSTKNGRDSHSKRLGAKKADGQMIRVGQIIYRQRGTKIFAGQNVAMGSDN 71

Query: 358 TLYALKEGCVKFER 317
           TL+AL +G V+F++
Sbjct: 72  TLFALSDGIVRFQK 85



>sp|Q92BH4|RL27_LISMO 50S ribosomal protein L27.>pir|AD1267|AD1267
           ribosomal protein L27 [imported] - Listeria
           monocytogenes  (strain EGD-e)>pir|AF1629|AF1629
           ribosomal protein L27 [imported] - Listeria innocua
           (strain Clip11262)>gb:AE017327_443985 Listeria
           monocytogenes str. 4b F2365, section 6 of 10 of the
           complete genome.>gb:AL591979_536031 Listeria
           monocytogenes strain EGD, complete genome, segment
           7/12.>gb:AL596169_538920 Listeria innocua Clip11262
           complete genome, segment 7/12.>gb:AE017262_1076341
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 96

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 39/78 (50%), Positives = 52/78 (66%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L   ++ +A KK  GST NGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG  VG 
Sbjct: 2   LKFDIQHFAHKKGGGSTSNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGTNVGR 61

Query: 370 GKDHTLYALKEGCVKFER 317
           G D TL+A  +G V+FER
Sbjct: 62  GGDDTLFAKTDGVVRFER 79



>sp|Q824F4|RL27_CHLCV 50S ribosomal protein L27.>gb:AE016994_374264
           Chlamydophila caviae GPIC section 1 of 4 of the complete
           genome.>gb:AE015925_993943 Chlamydophila caviae GPIC
           complete genome.
          Length = 82

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 41/84 (48%), Positives = 57/84 (67%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A KK  G+++NGRDS+ K LG+K   G+RV  G+I+VRQRGT++HP   VG G+D TL+A
Sbjct: 2   AHKKGQGASRNGRDSESKRLGMKVGAGQRVSTGSILVRQRGTKWHPSQNVGRGRDDTLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHVEPK 275
           L +G V     K T R ++ V P+
Sbjct: 62  LVDGIVV---TKKTDRTYISVLPE 82



>gb:CP000023_874380 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_876267 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 96

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 45/87 (51%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 8   LQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGGSILYRQRGTHIYPGVNVGRGGDD 67

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 68  TLFAKVEGVVRFER-KGRDKKQVSVYP 93



>gb:AE006533_219882 Streptococcus pyogenes M1 GAS, section 62 of 167
           of the complete genome.>gb:AE010018_258423 Streptococcus
           pyogenes strain MGAS8232, section 66 of 173 of the
           complete genome.>gb:AE014147_304031 Streptococcus
           pyogenes MGAS315, section 12 of 37 of the complete
           genome.>gb:BA000034_714224 Streptococcus pyogenes SSI-1
           DNA, complete genome.>gb:CP000003_860578 Streptococcus
           pyogenes MGAS10394, complete genome.>gb:AE009949_904805
           Streptococcus pyogenes strain MGAS8232, complete
           genome.>gb:AE014074_927210 Streptococcus pyogenes
           MGAS315, complete genome.>gb:AE004092_1105728
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 97

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 45/87 (51%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 9   LQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGGSILYRQRGTHIYPGVNVGRGGDD 68

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 69  TLFAKVEGVVRFER-KGRDKKQVSVYP 94



>sp|Q9A0D4|RL27_STRPY 50S ribosomal protein L27.
          Length = 94

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 45/87 (51%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 6   LQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVSGGSILYRQRGTHIYPGVNVGRGGDD 65

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 66  TLFAKVEGVVRFER-KGRDKKQVSVYP 91



>gb:AE017332_445509 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 84

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 42/81 (51%), Positives = 53/81 (65%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A  K  GSTKNGRDS  + LG K   G+  + G+II RQRGTR +PG  VGIG D +L+A
Sbjct: 2   AKTKAGGSTKNGRDSAGRRLGQKIGDGQFALTGSIIYRQRGTRIYPGKNVGIGNDDSLFA 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L +G VKF+  K+  RK+  V
Sbjct: 62  LVDGIVKFQ--KIRKRKYATV 80



>pir|F97998|F97998 50S ribosomal protein L27 [imported] -
           Streptococcus pneumoniae (strain R6)>gb:AE008474_237335
           Streptococcus pneumoniae R6 section 90 of 184 of the
           complete genome.>gb:AE007317_943493 Streptococcus
           pneumoniae R6, complete genome.
          Length = 89

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/87 (50%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           ++ +A KK  GST NGRDS+ K LG K   G+ V  G+I+ RQRGT  +PG  VG G D 
Sbjct: 1   MQLFAHKKGGGSTSNGRDSQAKRLGAKAADGQTVTGGSILYRQRGTHIYPGVNVGRGGDD 60

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A  EG V+FER K   +K V V P
Sbjct: 61  TLFAKVEGVVRFER-KGRDKKQVSVYP 86



>sp|P07844|RL27_BACST 50S ribosomal protein L27
           (BL30).>pir|S08563|R5BS27 ribosomal protein L27 -
           Bacillus stearothermophilus
          Length = 87

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 40/70 (57%), Positives = 49/70 (70%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A+KK  GSTK+GRDS  K LG K+  G+ V  G+I+ RQRGT+ HPG  VG G D TLYA
Sbjct: 1   ASKKGVGSTKDGRDSIAKRLGAKRADGQFVTGGSILYRQRGTKVHPGLNVGRGGDDTLYA 60

Query: 346 LKEGCVKFER 317
             +G V+FER
Sbjct: 61  KIDGIVRFER 70



>sp|P41549|RK27_CHRAL Chloroplast 50S ribosomal protein L27
           (Fragment).>gb:CA3CPRP27A_1644701 Chrysochromulina
           alifera chloroplast rpl27 gene for ribosomal protein
           L27, partial cds.
          Length = 73

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 36/65 (55%), Positives = 46/65 (70%)
 Frame = -3

Query: 505 STKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVK 326
           STKNGRDS  K LGVK +G +    G+IIVRQRG  F PG  V +GKD+T++A + G V+
Sbjct: 1   STKNGRDSNSKRLGVKVYGNQPAKAGSIIVRQRGLTFKPGKGVSVGKDYTIFATQNGIVQ 60

Query: 325 FERNK 311
           FE +K
Sbjct: 61  FESDK 65



>gb:CP000033_89579 Lactobacillus acidophilus NCFM, complete genome.
          Length = 96

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 39/76 (51%), Positives = 49/76 (64%)
 Frame = -3

Query: 544 LVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           L ++ +A  K  GST NGR+S  + LG K   G+ +  G+II RQRGT+ HPG  VG G 
Sbjct: 4   LGMKLFAHHKGGGSTANGRNSAGRRLGAKAGDGQEIHAGSIIYRQRGTKIHPGKNVGQGG 63

Query: 364 DHTLYALKEGCVKFER 317
           D TL+AL  G VKFER
Sbjct: 64  DDTLFALVNGVVKFER 79



>sp|Q98QN2|RL27_MYCPU 50S ribosomal protein L27.>pir|A99553|A99553
           50S ribosomal protein L27 [imported] - Mycoplasma
           pulmonis  (strain UAB CTIP)>gb:MPULM02_149842 Mycoplasma
           pulmonis (strain UAB CTIP) complete genome; segment 2/3.
          Length = 85

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 39/81 (48%), Positives = 51/81 (62%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYA 347
           A  K  GST+NGRDSK + LG K   G+  + G+II RQRGT+  PG  VG G D TL+ 
Sbjct: 2   AKTKAGGSTRNGRDSKGRRLGAKLGDGQFALAGSIIYRQRGTKIFPGQNVGRGNDDTLFM 61

Query: 346 LKEGCVKFERNKLTGRKWVHV 284
           L +G VK+E+ +   RK+  V
Sbjct: 62  LVDGYVKYEKRR--NRKYASV 80



>sp|P41548|RK27_CALSH Chloroplast 50S ribosomal protein L27
           (Fragment).>gb:CSXCPRP27B_1674161 Calyptrosphaera
           sphaeroidea chloroplast rpl27 gene for ribosomal protein
           L27, partial cds.
          Length = 74

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 38/74 (51%), Positives = 50/74 (67%)
 Frame = -3

Query: 505 STKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYALKEGCVK 326
           STKNGRDS  K LGVK +G + V  G I++RQRG  F PG  V +GKD+TL+A + G V+
Sbjct: 1   STKNGRDSNSKRLGVKVYGNQPVKAGGIMIRQRGLTFKPGISVSVGKDYTLFATQNGYVQ 60

Query: 325 FERNKLTGRKWVHV 284
           FE   +  +K+V V
Sbjct: 61  FE--TINDKKFVSV 72



>gb:CR382130_1662817 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 374

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 38/76 (50%), Positives = 50/76 (65%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L+L L R ATK+  G   N +DS  + LGVK   G  V P +II RQRGT+F+PG+   I
Sbjct: 34  LALPLVRHATKRAGGGKTNLKDSIGRRLGVKATEGTYVQPSDIIYRQRGTKFYPGENTWI 93

Query: 370 GKDHTLYALKEGCVKF 323
           G+DHT+YA + G V+F
Sbjct: 94  GRDHTIYAKEPGYVRF 109



>sp|Q88WN3|RL27_LACPL 50S ribosomal protein L27.>gb:AL935256_551381
           Lactobacillus plantarum strain WCFS1 complete genome;
           segment 5/11.
          Length = 92

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 41/87 (47%), Positives = 55/87 (63%)
 Frame = -3

Query: 538 LRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDH 359
           L+ ++  K  GST NGRDS  + LG K+  G+ V  GNI+ RQRGT  +PG  VG G D 
Sbjct: 5   LQFFSHHKGGGSTANGRDSAGRRLGAKRADGQTVKNGNILYRQRGTHIYPGVNVGRGGDD 64

Query: 358 TLYALKEGCVKFERNKLTGRKWVHVEP 278
           TL+A+ +G V+FER K   ++ V V P
Sbjct: 65  TLFAMADGVVRFER-KGRDKRQVSVYP 90



>gb:AF349567_503855 Staphylococcus aureus putative 50S ribosomal
           protein L21 gene, complete cds; and putative 50S
           ribosomal protein L27 gene, partial cds.
          Length = 74

 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 37/72 (51%), Positives = 50/72 (69%)
 Frame = -3

Query: 550 LSLVLRRWATKKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGI 371
           L L L+ +A+KK   STKNGRDS+ K LG K+  G+ V  G+I+ RQRGT+ +PG+ VG 
Sbjct: 2   LKLNLQFFASKKGVSSTKNGRDSESKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVGR 61

Query: 370 GKDHTLYALKEG 335
           G D TL+A  +G
Sbjct: 62  GGDDTLFAKIDG 73



>sp|P41553|RK27_PORCR Chloroplast 50S ribosomal protein L27
           (Fragment).>gb:PPUCPRP27F_1701749 Porphyridium cruentum
           chloroplast rpl27 homolog gene for ribosomal protein
           L27, partial cds.
          Length = 47

 Score = 72.0 bits (175), Expect = 1e-11
 Identities = 32/47 (68%), Positives = 39/47 (82%)
 Frame = -3

Query: 505 STKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           STKNGRDS  + LGVKK+GGE V PGNI++RQRGT+ +PG  VG+GK
Sbjct: 1   STKNGRDSNAQRLGVKKYGGETVKPGNILIRQRGTKIYPGHNVGMGK 47



>gb:NC5E6_1688574 Neurospora crassa DNA linkage group V Cosmid
           contig 5E6.
          Length = 447

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 45/130 (34%), Positives = 72/130 (55%), Gaps = 5/130 (3%)
 Frame = -3

Query: 688 QPYSSASTVATPGVMNFTTLFRRLNIRELVS----NAPVYSSGSDASGEGLSLVLRRWAT 521
           QP + A+  +   V    T    ++   ++S    +  +  S S+ + EG     RR+A+
Sbjct: 8   QPLTRAAANSCHSVCRLPTTHSSVSATAILSEQFAHLRIGPSSSNVAVEG-----RRYAS 62

Query: 520 KKTAGSTK-NGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLYAL 344
            K  G+ +   + + PK LG KK G + VIPGNII +QRGT +HPG+   +G+DHT++A 
Sbjct: 63  VKAQGAYRLKPKRTIPKKLGAKKTGDQYVIPGNIIYKQRGTLWHPGENTIMGRDHTIHAA 122

Query: 343 KEGCVKFERN 314
             G VK+ R+
Sbjct: 123 VAGYVKYYRD 132



>sp|Q9P0M9|RM27_HUMAN Mitochondrial 60S ribosomal protein L27
           (L27mt) (HSPC250).>gb:AF151084_1150261 Homo sapiens
           HSPC250 mRNA, complete cds.>gb:AB049647_1867743 Homo
           sapiens MRPL27 mRNA for mitochondrial ribosomal protein
           L27 (L27mt), complete cds.>gb:BC001066_1967259 Homo
           sapiens mitochondrial ribosomal protein L27, transcript
           variant 1, mRNA (cDNA clone MGC:2528 IMAGE:2822502),
           complete cds.>gb:BC021986_1977634 Homo sapiens
           mitochondrial ribosomal protein L27, transcript variant
           1, mRNA (cDNA clone MGC:23716 IMAGE:4095663), complete
           cds.
          Length = 148

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = -3

Query: 532 RWATKKTAGSTKN-GRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHT 356
           R+A+KK+ GS+KN G  S  +  G+KK  G  V  GNII  QR  R+HPG +VG+GK+  
Sbjct: 29  RYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKC 88

Query: 355 LYALKEGCVKFER 317
           LYAL+EG V++ +
Sbjct: 89  LYALEEGIVRYTK 101



>sp|Q99N92|RM27_MOUSE Mitochondrial 60S ribosomal protein L27
           (L27mt).>gb:AB049648_2046192 Mus musculus MRPL27 mRNA
           for mitochondrial ribosomal protein L27 (L27mt),
           complete cds.>gb:AL645764_2071880 Mouse DNA sequence
           from clone RP23-290B5 on chromosome 11 Contains the 5'
           end of the gene for a novel protein (9330163N21Rik), a
           ribosomal protein S2 (Rps2) pseudogene, the gene for a
           novel protein (E130018012Rik), the gene for a novel
           protein (6820428D13Rik), the Mrpl27 gene for
           mitochondrial ribosomal protein L27, the Xylt2 gene for
           xylosyltransferase II, a novel gene (5330426M11Rik), the
           gene for a novel protein (C230057C09Rik), the gene for a
           novel protein similar to Cdc34 and two pseudogenes
           similar to hypothetical protein Tr:Q8C517, complete
           sequence.>gb:BC030074_2096699 Mus musculus mitochondrial
           ribosomal protein L27, mRNA (cDNA clone MGC:41411
           IMAGE:1514322), complete cds.
          Length = 148

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 36/74 (48%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = -3

Query: 532 RWATKKTAGSTKN-GRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHT 356
           R A+KKT GS+KN G  S+ K+ G+KK  G  V  GNI+  QR  R+HPG +VG+G++  
Sbjct: 29  RHASKKTGGSSKNLGGKSRGKHYGIKKMEGHYVHAGNILGTQRQFRWHPGAHVGLGRNKC 88

Query: 355 LYALKEGCVKFERN 314
           LYAL+EG V++ ++
Sbjct: 89  LYALEEGIVRYTKD 102



>gb:AF195213_1775831 Pyrus pyrifolia strain Whangkeumbae ribosomal
           protein L27 precursor (L27P) mRNA, complete cds.
          Length = 129

 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 48/113 (42%), Positives = 59/113 (52%), Gaps = 15/113 (13%)
 Frame = -3

Query: 643 NFTTLFRRLNIRELVSNAPVYSS------GSDASGEGLSLVLR---------RWATKKTA 509
           N    FR L++R   +++   SS      GS   G  LSLV           + A KK A
Sbjct: 9   NIVGAFRGLSLRPTSTSSSSSSSFFRGDLGSLQLGPKLSLVSSGPQRLPLTIQNAHKKGA 68

Query: 508 GSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHTLY 350
           GSTKNGRDSK + LGVK +G +    G+IIVRQRGT+FH G   G     T Y
Sbjct: 69  GSTKNGRDSKGQRLGVKIYGDQVTKAGSIIVRQRGTKFHAGKECGASARTTPY 121



>pir|T14374|T14374 ribosomal protein L27 - red alga (Cyanidium
           caldarium) chloroplast (fragment)
          Length = 47

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 28/47 (59%), Positives = 34/47 (72%)
 Frame = -3

Query: 505 STKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           STKNGRDS PK LGVK    + V  G+I+VRQRG++FH G  VG+ K
Sbjct: 1   STKNGRDSNPKYLGVKTCHAQFVTAGSILVRQRGSKFHHGQNVGVAK 47



>sp|P41551|RK2X_CYACA Chloroplast 50S ribosomal protein L27
           (Fragment).>gb:CYNCPRP27C_1674448 Cyanidium caldarium
           chloroplast rpl27 homolog gene for ribosomal protein
           L27, partial cds.
          Length = 47

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 28/47 (59%), Positives = 34/47 (72%)
 Frame = -3

Query: 505 STKNGRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGK 365
           STKNGRDS PK LGVK    + V  G+I+VRQRG++FH G  VG+ K
Sbjct: 1   STKNGRDSNPKYLGVKTCHAQFVTAGSILVRQRGSKFHHGQNVGVAK 47



>gb:AE014134_1127495 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003576_1216145 Drosophila melanogaster
           chromosome 2L, section 15 of 83 of the complete
           sequence.
          Length = 138

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 1/69 (1%)
 Frame = -3

Query: 532 RWATKKTAGSTKNGRD-SKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHT 356
           R A+KKT GST+N +  ++PK+ G +   G  V  G I+  Q  TRFHPG  VG G++ T
Sbjct: 20  RNASKKTGGSTRNKKGHARPKHRGWRVQDGHHVSEGTILATQLTTRFHPGLNVGFGRNGT 79

Query: 355 LYALKEGCV 329
           L+A++ G V
Sbjct: 80  LFAMEHGKV 88



>gb:AX970856_1486165 Sequence 1659 from Patent EP1104808.
          Length = 95

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 28/67 (41%), Positives = 38/67 (56%), Gaps = 1/67 (1%)
 Frame = -3

Query: 532 RWATKKTAGSTKN-GRDSKPKNLGVKKFGGERVIPGNIIVRQRGTRFHPGDYVGIGKDHT 356
           R+A+KK+ GS+KN G  S  +  G+KK  G  V  GNII  QR  R+HPG    +G+ + 
Sbjct: 29  RYASKKSGGSSKNLGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAMWVLGRINV 88

Query: 355 LYALKEG 335
               K G
Sbjct: 89  CMPWKRG 95



>gb:PFMAL3P6_1394534 Plasmodium falciparum MAL3P6, complete
           sequence.
          Length = 298

 Score = 45.8 bits (107), Expect = 8e-04
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 14/97 (14%)
 Frame = -3

Query: 520 KKTAGSTKNGRDSKPKNLGVKKFGGERVIPGNIIVRQR--------------GTRFHPGD 383
           K+ A S+ NG+  K K +G+K+  GE V  G ++V+QR                +++PG+
Sbjct: 126 KRKARSSPNGQGQKAK-IGIKRLSGEYVRTGQMLVKQRKIICFNYENKTRRRNFKYYPGE 184

Query: 382 YVGIGKDHTLYALKEGCVKFERNKLTGRKWVHVEPKD 272
            V + K+ +L AL  G VKF  + +     V++ P++
Sbjct: 185 NVKVAKNTSLIALTNGRVKFTFHVIQNVFLVNILPEE 221



>gb:BA000036_720088 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.
          Length = 132

 Score = 38.5 bits (88), Expect = 0.13
 Identities = 21/64 (32%), Positives = 40/64 (62%)
 Frame = +2

Query: 323 KLDTPFF*SIKGVIFTNSNVIPGMKSGSSLANNDISRDHPLSTEFLYSKILGL*VTSIFC 502
           KLD+      + V+ T +N++  ++ G++L N D++  + L+TE L +K L L +T++  
Sbjct: 58  KLDSASLQCEESVVATATNILTWVELGAALTNKDLACGNLLTTETLDAKALSLGITTV-A 116

Query: 503 GSRC 514
           G+RC
Sbjct: 117 GARC 120



>gb:BA000037_721359 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 796

 Score = 35.8 bits (81), Expect = 0.86
 Identities = 25/91 (27%), Positives = 40/91 (43%), Gaps = 1/91 (1%)
 Frame = +1

Query: 307 SACYAQT*HTLLLKHKGCDLYQFQRNPRDEIGFLFGEQ*YFQGSPSLHRISLLQDSWALS 486
           +AC+ Q      LKH   D YQ+   P      +  E      +PS+H +S  ++  A+ 
Sbjct: 647 NACFTQA----ELKHDSSDQYQYVLFPNSTKSVVDREAI----APSIHVLSNSENVHAVE 698

Query: 487 HVHFLWIPLSFWSP-SAGVLSSIPPQMHRYQ 576
           H     + L+FW P  AG + +  P    Y+
Sbjct: 699 HTQLKLVGLNFWQPGQAGAVEAFSPMSMLYR 729



>sp|P60493|RL27_THETH 50S ribosomal protein L27 (Fragment).
          Length = 25

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 16/24 (66%), Positives = 20/24 (83%)
 Frame = -3

Query: 526 ATKKTAGSTKNGRDSKPKNLGVKK 455
           A KK  GST+NGRDS+ K+LGVK+
Sbjct: 1   AHKKGLGSTRNGRDSQAKDLGVKR 24



>pir|T14124|T14124 neural zinc finger factor 3 -
           rat>gb:AF031942_2051617 Rattus norvegicus neural zinc
           finger factor 3 mRNA, complete cds.
          Length = 1032

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 28/93 (30%), Positives = 40/93 (43%), Gaps = 4/93 (4%)
 Frame = -3

Query: 697 RSFQPYSSASTVATPGVMNFTTLFRRLNIRELVSNAPVYSSGSDASGEGLSLVLRRWATK 518
           +S  P SS +T+ATP    F           L+ NA  Y +  D  G  + +        
Sbjct: 611 KSIPPTSSHTTIATPSSSPF-------KASSLLVNAAFYQALCDQEGWNVPI-----NYS 658

Query: 517 KTAGSTKNGRDSKP----KNLGVKKFGGERVIP 431
           K+ G T+  ++  P    +NL  KKF GE  IP
Sbjct: 659 KSHGKTEEEKEKDPVNSLENLEEKKFAGEASIP 691



>gb:AC137610_1743506 Oryza sativa (japonica cultivar-group)
           chromosome 5 BAC clone OSJNBa0018H09, complete sequence.
          Length = 793

 Score = 33.9 bits (76), Expect = 3.3
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 4/82 (4%)
 Frame = -3

Query: 742 RPPDTTRPHQSPTSSRSFQPYSSASTVATPGVMNFTTLFRRLNIRE---LVSNAPVYSSG 572
           +PP T RPH +PT   SF   ++ S VA        +L   L+ R    L S+ P     
Sbjct: 60  QPPATRRPHPTPTPPHSFLSPAAQSLVAAISSQPLPSLPAFLSSRRDELLRSDLPSLLKA 119

Query: 571 SDASGE-GLSLVLRRWATKKTA 509
            + SG    +L L RWA+ + A
Sbjct: 120 LELSGHWEWALALLRWASDEGA 141



>sp|O88987|AKA3_MOUSE A-kinase anchor protein 3 (Protein kinase A
           anchoring protein 3) (PRKA3) (A-kinase anchor protein
           110 kDa) (AKAP 110).>gb:AF093406_2054192 Mus musculus
           protein kinase A binding protein AKAP110 mRNA, complete
           cds.
          Length = 864

 Score = 33.5 bits (75), Expect = 4.3
 Identities = 42/116 (36%), Positives = 50/116 (43%), Gaps = 4/116 (3%)
 Frame = -3

Query: 718 HQSPTSSRSFQPYSSASTVATPGVMNFTTLFRRLNIRELVSNAPVYSSGSDASGEGLSLV 539
           HQS        P+ S STVA+  ++N T      NI      AP   SG  ASG   +  
Sbjct: 157 HQSLYMGDEPTPHKSLSTVASE-LVNETVTACSKNISS--DKAP--GSGDRASGSSQAPG 211

Query: 538 LRRWATKKTAGSTKNGR--DSKPKNLGVKK--FGGERVIPGNIIVRQRGTRFHPGD 383
           LR  +T K   STK G+  D KP   G KK  F  E     N    + G R  PGD
Sbjct: 212 LRYMSTLKIKESTKEGKCPDDKP---GTKKSFFYKEVFESRNAGDAKEGGRSLPGD 264



>pir|T21027|T21027 hypothetical protein F16H6.9 - Caenorhabditis
           elegans>gb:CEF16H6_1362582 Caenorhabditis elegans cosmid
           F16H6, complete sequence.
          Length = 676

 Score = 32.3 bits (72), Expect = 9.5
 Identities = 18/44 (40%), Positives = 23/44 (52%)
 Frame = -3

Query: 196 PILNHLSRTME*PSISFEFLFPFIQGARYTFCTSLGLFMTDIFV 65
           P +  LS   E   +  EFL  F+   R+ F  SLG  +TDIFV
Sbjct: 553 PFIEPLSHFDEKKDVITEFLDNFLIAVRHRFARSLGNIITDIFV 596


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 874,037,940
Number of Sequences: 1806583
Number of extensions: 19340393
Number of successful extensions: 49532
Number of sequences better than 10.0: 221
Number of HSP's better than 10.0 without gapping: 47465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 49511
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 46505143296
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)