BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11839
         (774 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP002900_1823726 Oryza sativa (japonica cultivar-group) genom...   331   8e-90   
gb:AY566698_1178626 Xerophyta humilis clone HC62 unknown mRNA.        328   7e-89   
gb:AY057697_1564109 Arabidopsis thaliana AT4g13250/F17N18_140 mR...   323   3e-87   
pir|T07705|T07705 hypothetical protein F17N18.140 - Arabidopsis ...   323   3e-87   Arabidopsis thaliana [mouse-ear cress]
gb:AY085229_1570302 Arabidopsis thaliana clone 14018 mRNA, compl...    87   4e-16   
gb:AB005245_1509569 Arabidopsis thaliana genomic DNA, chromosome...    87   4e-16   
gb:AC120535_1739897 Oryza sativa (japonica cultivar-group) chrom...    83   6e-15   
gb:AE012875_286618 Chlorobium tepidum TLS section 96 of 194 of t...    80   5e-14   
gb:AX154967_1462722 Sequence 13 from Patent WO0138484.                 48   2e-04   
gb:CP000029_82633 Staphylococcus epidermidis RP62A, complete gen...    44   0.003   
gb:AY223302_1176763 Schistosoma japonicum clone ZZD563 mRNA sequ...    44   0.003   
gb:AE012930_287234 Chlorobium tepidum TLS section 151 of 194 of ...    43   0.006   
gb:BX572599_801773 Rhodopseudomonas palustris CGA009 complete ge...    42   0.013   
gb:AE006130_215804 Pasteurella multocida subsp. multocida str. P...    41   0.028   
pir|C95901|C95901 probable short chain dehydrogenasereductase pr...    40   0.048   Sinorhizobium meliloti
pir|F87126|F87126 probable short chain reductase [imported] - My...    39   0.081   Mycobacterium leprae
gb:AE017238_413812 Mycobacterium avium subsp. paratuberculosis s...    39   0.11    
gb:AE010598_264796 Fusobacterium nucleatum subsp. nucleatum ATCC...    39   0.11    
gb:AY316747_608970 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...    39   0.14    
pir|B70649|B70649 hypothetical protein Rv3057c - Mycobacterium t...    38   0.24    Mycobacterium tuberculosis
gb:AB026544_1516998 Hyoscyamus niger tr1 gene for tropinone redu...    37   0.31    
gb:BA000040_736140 Bradyrhizobium japonicum USDA 110 DNA, comple...    37   0.31    
sp|P50164|TRN2_HYONI|TRN2_HYONI Tropinone reductase-II (EC 1.1.1.236) (TR-I...    37   0.31    Hyoscyamus niger [black henbane]
gb:AY305858_2082143 Rattus norvegicus carbonyl reductase 4 (Cbr4...    37   0.40    
gb:AE017235_413023 Mycobacterium avium subsp. paratuberculosis s...    37   0.40    
sp|Q45219|YL46_BRAJA|YL46_BRAJA Probable short-chain type dehydrogenase/red...    37   0.40    Bradyrhizobium japonicum
sp|P50162|TRN1_DATST|TRN1_DATST Tropinone reductase-I (EC 1.1.1.206) (TR-I)...    37   0.40    Datura stramonium [common thornapple]
gb:AP006618_560720 Nocardia farcinica IFM 10152 DNA, complete ge...    37   0.53    
pir|F69868|F69868 glucose 1-dehydrogenase homolog ykvO - Bacillu...    37   0.53    Bacillus subtilis
gb:BC009118_2090805 Mus musculus cDNA sequence BC009118, mRNA (c...    36   0.69    
gb:STU292343_1723031 Solanum tuberosum mRNA for tropinone reduct...    36   0.69    
gb:STU245634_1723003 Solanum tuberosum mRNA for tropinone reduct...    36   0.69    
gb:AK043313_1166565 Mus musculus 7 days neonate cerebellum cDNA,...    36   0.69    
gb:BA000043_738906 Geobacillus kaustophilus HTA426 DNA, complete...    36   0.69    
gb:BA000030_704090 Streptomyces avermitilis MA-4680 genomic DNA,...    36   0.69    
gb:CR555306_105567 Azoarcus sp. EbN1 complete genome.                  36   0.69    
pir|AD1635|AD1635 ketoacyl reductases homolog lin1621 [imported]...    36   0.69    Listeria innocua
pir|I40211|I40211 probable sterol dehydrogenase (EC 1.1.1.-) - B...    36   0.69    Bradyrhizobium japonicum
sp|P50163|TRN2_DATST|TRN2_DATST Tropinone reductase-II (EC 1.1.1.236) (TR-I...    36   0.69    Datura stramonium [common thornapple]
gb:BX640438_813236 Bordetella bronchiseptica strain RB50, comple...    36   0.90    
gb:AE017333_449289 Bacillus licheniformis DSM 13, complete genom...    36   0.90    
gb:AE017333_448383 Bacillus licheniformis DSM 13, complete genom...    36   0.90    
gb:CP000033_88954 Lactobacillus acidophilus NCFM, complete genome.     36   0.90    
gb:BC080139_2561570 Xenopus tropicalis MGC89688 protein, mRNA (c...    35   1.2     
gb:BC033650_1980975 Homo sapiens carbonic reductase 4, mRNA (cDN...    35   1.2     
gb:CR382123_1656028 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   1.2     
gb:AX269024_1465070 Sequence 1 from Patent WO0175119.                  35   1.2     
gb:HSM804706_1187255 Homo sapiens mRNA; cDNA DKFZp762K109 (from ...    35   1.2     
gb:BX571966_793857 Burkholderia pseudomallei strain K96243, chro...    35   1.2     
gb:BA000021_686837 Wigglesworthia glossinidia endosymbiont of Gl...    35   1.2     
gb:AP006618_559091 Nocardia farcinica IFM 10152 DNA, complete ge...    35   1.2     
gb:BC068653_2555157 Xenopus laevis hypothetical protein MGC80021...    35   1.5     
gb:BA000045_741189 Gloeobacter violaceus PCC 7421 DNA, complete ...    35   1.5     
pir|G70515|G70515 probable dehydrogenase - Mycobacterium tubercu...    35   1.5     Mycobacterium tuberculosis
gb:AF340008_1264052 Encephalitozoon cuniculi isolate CDC:V446 sp...    24   1.6     
gb:AP003272_1826927 Oryza sativa (japonica cultivar-group) genom...    35   2.0     
gb:AP003272_1826926 Oryza sativa (japonica cultivar-group) genom...    35   2.0     
gb:CP000009_864016 Gluconobacter oxydans 621H, complete genome.        35   2.0     
gb:BX950851_843213 Erwinia carotovora subsp. atroseptica SCRI104...    35   2.0     
gb:BX908798_830822 Parachlamydia-related symbiont UWE25, complet...    35   2.0     
gb:AF509565_517744 Streptomyces sp. JP95 griseorhodin biosynthes...    35   2.0     
gb:TACID1_196026 Thermoplasma acidophilum complete genome; segme...    35   2.0     
gb:AC006677_1203677 Caenorhabditis elegans cosmid R05D8, complet...    34   2.6     
gb:AE014298_1124706 Drosophila melanogaster chromosome X, comple...    34   2.6     
gb:AL935258_551801 Lactobacillus plantarum strain WCFS1 complete...    34   2.6     
gb:AE017328_444420 Listeria monocytogenes str. 4b F2365, section...    34   2.6     
gb:AE016935_361748 Bacteroides thetaiotaomicron VPI-5482, sectio...    34   2.6     
pir|AI1692|AI1692 oxidoreductase homolog lin2083 [imported] - Li...    34   2.6     Listeria innocua
sp|P19992|2BHD_STREX|2BHD_STREX 20-beta-hydroxysteroid dehydrogenase (EC 1....    34   2.6     Streptomyces exfoliatus
gb:BC065615_2554063 Danio rerio zgc:77144, mRNA (cDNA clone MGC:...    34   3.4     
gb:CP000003_860480 Streptococcus pyogenes MGAS10394, complete ge...    34   3.4     
gb:BX640424_808831 Bordetella parapertussis strain 12822, comple...    34   3.4     
gb:AE016933_361279 Bacteroides thetaiotaomicron VPI-5482, sectio...    34   3.4     
gb:AE010004_258266 Streptococcus pyogenes strain MGAS8232, secti...    34   3.4     
gb:SCO939119_177841 Streptomyces coelicolor A3(2) complete genom...    34   3.4     
gb:SAG766846_170096 Streptococcus agalactiae NEM316 complete gen...    34   3.4     
gb:CR380959_1654135 Candida glabrata strain CBS138 chromosome M ...    33   4.5     
gb:AY596297_633313 Haloarcula marismortui ATCC 43049 chromosome ...    33   4.5     
gb:AP006841_574031 Bacteroides fragilis YCH46 DNA, complete genome.    33   4.5     
gb:AL646062_545980 Ralstonia solanacearum GMI1000 chromosome, co...    33   4.5     
gb:AF173833_485505 Bacteroides fragilis 7-alpha-hydroxysteroid d...    33   4.5     
gb:AE015774_317719 Shewanella oneidensis MR-1 section 323 of 457...    33   4.5     
pir|AH1321|AH1321 oxidoreductase homolog lmo1976 [imported] - Li...    33   4.5     Listeria monocytogenes
gb:AE017347_1757808 Cryptococcus neoformans var. neoformans JEC2...    33   5.8     
gb:EMEVERA1AA_1676657 Emericella nidulans (verA) gene, complete ...    33   5.8     
gb:BX321861_773976 Nitrosomonas europaea ATCC 19718, complete ge...    33   5.8     
gb:BA000040_732251 Bradyrhizobium japonicum USDA 110 DNA, comple...    33   5.8     
gb:AF241171_491713 Pseudomonas aeruginosa pathogenicity island P...    33   5.8     
gb:AE017263_420725 Mesoplasma florum L1 complete genome.               33   5.8     
gb:AE017233_412421 Mycobacterium avium subsp. paratuberculosis s...    33   5.8     
gb:AE014145_303935 Streptococcus pyogenes MGAS315, section 10 of...    33   5.8     
pir|D90399|D90399 hypothetical protein fabG-6 [imported] - Sulfo...    33   5.8     Saccharolobus solfataricus
sp|Q49117|YMEC_METEX|YMEC_METEX Hypothetical oxidoreductase in MEAA 3'regio...    33   5.8     Methylorubrum extorquens
sp|Q00791|STCU_EMENI|STCU_EMENI Versicolorin reductase (EC 1.1.-.-).>gb:ENU...    33   5.8     
gb:AB112925_2048460 Mus musculus noc2 mRNA for Noc2, complete cd...    33   7.6     
gb:CP000002_857721 Bacillus licheniformis ATCC 14580, complete g...    33   7.6     
gb:CP000001_854489 Bacillus cereus ZK, complete genome.                33   7.6     
gb:BA000035_716395 Corynebacterium efficiens YS-314 DNA, complet...    33   7.6     
gb:BA000012_668277 Mesorhizobium loti MAFF303099 DNA, complete g...    33   7.6     
gb:AL646081_549314 Ralstonia solanacearum GMI1000 megaplasmid, c...    33   7.6     
gb:AL646081_549305 Ralstonia solanacearum GMI1000 megaplasmid, c...    33   7.6     
gb:AE017333_447918 Bacillus licheniformis DSM 13, complete genome.     33   7.6     
gb:AE017235_413053 Mycobacterium avium subsp. paratuberculosis s...    33   7.6     
gb:AE017037_384317 Bacillus anthracis str. Ames section 14 of 18...    33   7.6     
gb:SCO939121_178353 Streptomyces coelicolor A3(2) complete genom...    33   7.6     
gb:CR555306_106484 Azoarcus sp. EbN1 complete genome.                  33   7.6     
pir|T36060|T36060 probable oxidoreductase - Streptomyces coelico...    33   7.6     Streptomyces coelicolor
sp|P54554|YQJQ_BACSU|YQJQ_BACSU Hypothetical oxidoreductase yqjQ (EC 1.-.-....    33   7.6     Bacillus subtilis
sp|Q9XZV1|SWP1_ENCCU|SWP1_ENCCU Spore wall protein 1 precursor.>gb:CNS07EGG...    24   8.0     Encephalitozoon cuniculi
gb:CP000024_876547 Streptococcus thermophilus CNRZ1066, complete...    32   10.0    
gb:CP000023_874645 Streptococcus thermophilus LMG 18311, complet...    32   10.0    
gb:CP000011_868182 Burkholderia mallei ATCC 23344 chromosome 2, ...    32   10.0    
gb:BX897700_828787 Bartonella quintana str. Toulouse, complete g...    32   10.0    
gb:BX571966_793590 Burkholderia pseudomallei strain K96243, chro...    32   10.0    
gb:BX571966_793248 Burkholderia pseudomallei strain K96243, chro...    32   10.0    
gb:AF288038_495927 Streptococcus thermophilus putative oxidoredu...    32   10.0    
gb:AE017277_425405 Bacillus cereus ATCC 10987, section 14 of 18 ...    32   10.0    
gb:AE017261_420341 Picrophilus torridus DSM 9790, complete genome.     32   10.0    
gb:AE016784_332216 Pseudomonas putida KT2440 section 11 of 21 of...    32   10.0    
gb:AE011877_277324 Xanthomonas axonopodis pv. citri str. 306, se...    32   10.0    
pir|C98087|C98087 oxidoreductase (EC 1.-.-.-) [imported] - Strep...    32   10.0    Streptococcus pneumoniae R6
pir|A95223|A95223 hypothetical protein SP1909 [imported] - Strep...    32   10.0    Streptococcus pneumoniae
sp|P35731|YKF5_YEAST|YKF5_YEAST Hypothetical oxidoreductase in NUP120-CSE4 ...    32   10.0    Saccharomyces cerevisiae [brewer's yeast]


>gb:AP002900_1823726 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0443E07.>gb:AP003434_1829306 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0452F10.
          Length = 504

 Score =  331 bits (849), Expect = 8e-90
 Identities = 160/178 (89%), Positives = 172/178 (96%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQ Q+SL KE +RSKVGVHTASPGMVLTDL
Sbjct: 317 GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDL 376

Query: 181 LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR 360
           LLSGSS++NKQMFN+ICELPETVARTLVPRMR+VKGSGKAINYLTPPRIL+ALV+AW+RR
Sbjct: 377 LLSGSSLRNKQMFNLICELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRR 436

Query: 361 GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL 534
           GRWFD++GRAVYAAEADR+RNWAESR R SFTDAME YTENTWVSVFSLSVVCAFIIL
Sbjct: 437 GRWFDEEGRAVYAAEADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIIL 494



>gb:AY566698_1178626 Xerophyta humilis clone HC62 unknown mRNA.
          Length = 258

 Score =  328 bits (841), Expect = 7e-89
 Identities = 158/178 (88%), Positives = 171/178 (96%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+FNMDGAGSGGSSTPLTAVYGSTKCGL+QLQ SL  ECK SKVG+HTASPGMVLTDL
Sbjct: 71  GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLKQLQGSLVTECKGSKVGIHTASPGMVLTDL 130

Query: 181 LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR 360
           LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSG+AI+YLTPPRIL+ALV+AWLRR
Sbjct: 131 LLSGSSLRNKQMFNIICELPETVARTLVPRMRVVKGSGRAIDYLTPPRILLALVTAWLRR 190

Query: 361 GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL 534
           GRWFDDQGRA+YAAEADRLRNWAESR R SFTDAME YT++TWVSVFSLSVVCAFIIL
Sbjct: 191 GRWFDDQGRALYAAEADRLRNWAESRARFSFTDAMEMYTDSTWVSVFSLSVVCAFIIL 248



>gb:AY057697_1564109 Arabidopsis thaliana AT4g13250/F17N18_140 mRNA,
           complete cds.
          Length = 496

 Score =  323 bits (827), Expect = 3e-87
 Identities = 153/178 (85%), Positives = 170/178 (95%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++ VG+HTASPGMVLT+L
Sbjct: 308 GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTEL 367

Query: 181 LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR 360
           LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct: 368 LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR 427

Query: 361 GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL 534
           GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct: 428 GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL 485



>pir|T07705|T07705 hypothetical protein F17N18.140 - Arabidopsis
           thaliana>gb:ATCHRIV35_1545089 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           35.>gb:ATF17N18_1549045 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F17N18 (ESSA project).
          Length = 447

 Score =  323 bits (827), Expect = 3e-87
 Identities = 153/178 (85%), Positives = 170/178 (95%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+FNMDGAGSGGSSTPLTAVYGSTKCGLRQ   S+ KE +++ VG+HTASPGMVLT+L
Sbjct: 259 GGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTEL 318

Query: 181 LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR 360
           LLSGSS++NKQMFNIICELPETVARTLVPRMR+VKGSGKA+NYLTPPRIL+A+V++WLRR
Sbjct: 319 LLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRR 378

Query: 361 GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTENTWVSVFSLSVVCAFIIL 534
           GRWFDDQGRA+YAAEADRLRNWAE+RTRLS TDAME YTENTWVSVFSLSVVCAFIIL
Sbjct: 379 GRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIIL 436



>gb:AY085229_1570302 Arabidopsis thaliana clone 14018 mRNA, complete
           sequence.
          Length = 348

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 48/102 (47%), Positives = 62/102 (60%), Gaps = 4/102 (3%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKR---SKVGVHTASPGMVL 171
           GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +      V VH  SPGMV 
Sbjct: 211 GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT 270

Query: 172 TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG 294
           TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct: 271 TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG 312



>gb:AB005245_1509569 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MUG13.
          Length = 341

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 48/102 (47%), Positives = 62/102 (60%), Gaps = 4/102 (3%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKR---SKVGVHTASPGMVL 171
           GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E +      V VH  SPGMV 
Sbjct: 211 GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVT 270

Query: 172 TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIVKGSG 294
           TDLL+SG++ +  + F N++ E  E VA  LVP +R +  SG
Sbjct: 271 TDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG 312



>gb:AC120535_1739897 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0092N01 map MAP_LOC, complete
           sequence.>gb:AC138004_1743971 Oryza sativa chromosome 3
           BAC OSJNBb0023J24 genomic sequence, complete sequence.
          Length = 343

 Score = 82.8 bits (203), Expect = 6e-15
 Identities = 46/98 (46%), Positives = 61/98 (62%), Gaps = 4/98 (4%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVG---VHTASPGMVL 171
           GGH+FN+DGAGS G  TP  A YG+TK  +  L  SL  E + ++V    VH  SPGMV 
Sbjct: 206 GGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMNEVNNVMVHNLSPGMVT 265

Query: 172 TDLLLSGSSVQNKQMF-NIICELPETVARTLVPRMRIV 282
           TDLL+SG++ +  + F NI+ E    VA  LVP +R +
Sbjct: 266 TDLLMSGATTKQAKFFINILAEPANVVADYLVPNIRAI 303



>gb:AE012875_286618 Chlorobium tepidum TLS section 96 of 194 of the
           complete genome.>gb:AE006470_933786 Chlorobium tepidum
           TLS complete genome.
          Length = 278

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 47/133 (35%), Positives = 76/133 (57%), Gaps = 6/133 (4%)
 Frame = +1

Query: 7   HVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRS---KVGVHTASPGMVLTD 177
           H+FNM  + +G  S+P +  + ++K  +  +   L +E + +    VG+H  SPG+VLTD
Sbjct: 144 HLFNMGFSSAGLRSSPTSVPHRASKRAVAIMSKLLRQELEAAGIRSVGIHELSPGLVLTD 203

Query: 178 LLLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSA--- 348
           LLL  ++   K+ FN + E  ETVA TLVP +R + G G  + Y  P   + A ++A   
Sbjct: 204 LLLRDATPAQKRFFNAMAETSETVAATLVPAIRAITGRGSTLRY-QPVLFMFAKLAASAF 262

Query: 349 WLRRGRWFDDQGR 387
             R+ R+FD +G+
Sbjct: 263 GYRKERFFDSEGK 275



>gb:AX154967_1462722 Sequence 13 from Patent WO0138484.
          Length = 199

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 21/36 (58%), Positives = 25/36 (69%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSS 108
           GGH+FNMDGAG+ G+ TP  A YG+TK  L Q   S
Sbjct: 164 GGHIFNMDGAGADGNPTPRFAAYGATKRSLAQFTKS 199



>gb:CP000029_82633 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AE016750_323686 Staphylococcus epidermidis
           ATCC 12228, section 7 of 9 of the complete
           genome.>gb:AE015929_1148355 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 230

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 25/59 (42%), Positives = 33/59 (55%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GH+ N+    SG   T   AVYG+TK  +  +  SL KE  R+ V V + SPGMV T +
Sbjct: 132 GHIINLASV-SGFEPTKTNAVYGATKAAIHAITQSLEKELARTGVKVTSISPGMVDTPM 189



>gb:AY223302_1176763 Schistosoma japonicum clone ZZD563 mRNA
           sequence.
          Length = 326

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 40/127 (31%), Positives = 56/127 (44%), Gaps = 8/127 (6%)
 Frame = +1

Query: 37  GGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTA--SPGMVLTDLLLSGSSVQNK 210
           GG        YGS K  L ++   +  E KR  + +     SPG+V T+ LL+ +S    
Sbjct: 173 GGKVYLFNVAYGSGKAALDRITHDMALELKRENINISIVGLSPGLVRTEHLLNAASKSPG 232

Query: 211 QMFNIICELPETVARTLV------PRMRIVKGSGKAINYLTPPRILIALVSAWLRRGRWF 372
           +    +CE PE V R +V      PR  + K SG+           I LVS   +R    
Sbjct: 233 KFNMELCESPELVGRVIVGLITESPRQLLSK-SGQ-----------IFLVSDLAKRYCID 280

Query: 373 DDQGRAV 393
           +D GRAV
Sbjct: 281 EDYGRAV 287



>gb:AE012930_287234 Chlorobium tepidum TLS section 151 of 194 of the
           complete genome.>gb:AE006470_934402 Chlorobium tepidum
           TLS complete genome.
          Length = 274

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 9/113 (7%)
 Frame = +1

Query: 4   GHVFNMDGAGSG-GSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           G + NM G+G+  GS+TP  + YGSTK  + +   ++ +E + + + +    PG+V T++
Sbjct: 135 GKIINMAGSGTDKGSNTPFISAYGSTKAAIARFTFAMAEEYRNAGLSIMLLHPGLVRTEI 194

Query: 181 LLSGSSVQNKQ----MFNIICEL----PETVARTLVPRMRIVKGSGKAINYLT 315
                +    Q     FNII ++    P+   R  V +M      GK   YL+
Sbjct: 195 NHPERTTPELQKQLKTFNIILDIFAQSPDLAVRYAV-KMASSWSDGKTGLYLS 246



>gb:BX572599_801773 Rhodopseudomonas palustris CGA009 complete
           genome; segment 7/16.
          Length = 249

 Score = 42.0 bits (97), Expect = 0.013
 Identities = 23/59 (38%), Positives = 35/59 (59%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GG V N+  +G    + P TAVYG+TK  +  + + L KE    K+ V+  +PGMV+T+
Sbjct: 134 GGSVVNIS-SGVSTIAMPNTAVYGATKASVDLITAVLAKELAPRKIRVNAVNPGMVVTE 191



>gb:AE006130_215804 Pasteurella multocida subsp. multocida str. Pm70
           section 97 of 204 of the complete
           genome.>gb:AE004439_1118534 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 265

 Score = 40.8 bits (94), Expect = 0.028
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 9/123 (7%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+          P  +VY +TK  +      L  E + + + V   +PG  LT+ +
Sbjct: 134 GHILNVSSVAGEMPGGPQMSVYYATKAFVTSFSQGLSYELRHTGIKVSILAPGPTLTNFV 193

Query: 184 LSGSSVQNKQMFNII-CELPETVAR----TLVPRMRIVKGSGKAI----NYLTPPRILIA 336
            + +  +N  +F+++  +  ETVAR     L  +  I+ G    +    +   P   +IA
Sbjct: 194 KTATRTENATLFDMLKFQTAETVARYTEKHLAHKKLIIPGVWNKLMVYSHRFLPRTFVIA 253

Query: 337 LVS 345
           LVS
Sbjct: 254 LVS 256



>pir|C95901|C95901 probable short chain dehydrogenasereductase
           protein [imported] - Sinorhizobium meliloti (strain
           1021) magaplasmid pSymB>gb:RME591985_165123
           Sinorhizobium meliloti 1021 complete pSymB.
          Length = 244

 Score = 40.0 bits (92), Expect = 0.048
 Identities = 22/73 (30%), Positives = 33/73 (45%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + NM      G   P   +Y + K G+  +   L KE +   + V+  +PG   TDL
Sbjct: 131 GGRIINMS-TSQVGLLHPSYGIYAAAKAGVEAMTHVLSKELRGRDITVNAVAPGPTATDL 189

Query: 181 LLSGSSVQNKQMF 219
            L G S + +  F
Sbjct: 190 FLEGKSDEVRDRF 202



>pir|F87126|F87126 probable short chain reductase [imported] -
           Mycobacterium leprae>gb:MLEPRTN7_147542 Mycobacterium
           leprae strain TN complete genome; segment 7/10.
          Length = 312

 Score = 39.3 bits (90), Expect = 0.081
 Identities = 23/61 (37%), Positives = 33/61 (54%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+ N+  A +G  + P  A Y ++K GLR L   L  +  R ++GV    PG V T L
Sbjct: 140 GGHLVNVSSA-AGLVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPL 198

Query: 181 L 183
           +
Sbjct: 199 V 199



>gb:AE017238_413812 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 12 of 16 of the complete
           genome.>gb:AE016958_1057216 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 310

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 23/61 (37%), Positives = 33/61 (54%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+ N+  A +G  + P  A Y ++K GLR L   L  +  R ++GV    PG V T L
Sbjct: 142 GGHLANVSSA-AGLVALPWHAAYSASKYGLRGLSEVLRFDLARHRIGVSVVVPGAVNTPL 200

Query: 181 L 183
           +
Sbjct: 201 V 201



>gb:AE010598_264796 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 140 of 197 of the complete
           genome.>gb:AE009951_911964 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 238

 Score = 38.9 bits (89), Expect = 0.11
 Identities = 20/58 (34%), Positives = 31/58 (53%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           G + N+    +    +PL +VY +TK GL Q    LF+E +++ V V T  P M  T+
Sbjct: 124 GIIINISSV-TANKESPLASVYSATKAGLSQFSKCLFEEVRKNDVKVITIYPDMTKTN 180



>gb:AY316747_608970 Rhizobium sp. NGR234 megaplasmid 2 contig 1,
           complete sequence.
          Length = 282

 Score = 38.5 bits (88), Expect = 0.14
 Identities = 25/64 (39%), Positives = 27/64 (42%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GHV N    G G    P   VYGSTK  +  L  SL  E K   + V    PG   TD L
Sbjct: 126 GHVLNFSSVG-GYFGYPGWGVYGSTKFAVEGLSESLAAELKPFGIKVTIVEPGFFRTDFL 184

Query: 184 LSGS 195
              S
Sbjct: 185 ADNS 188



>pir|B70649|B70649 hypothetical protein Rv3057c - Mycobacterium
           tuberculosis  (strain H37RV)>gb:AE000516_23244
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248344_760440 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           11/14.>gb:BX842581_821154 Mycobacterium tuberculosis
           H37Rv complete genome; segment 10/13.
          Length = 287

 Score = 37.7 bits (86), Expect = 0.24
 Identities = 23/61 (37%), Positives = 31/61 (50%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+ N+  A +G    P  A Y ++K GLR L   L  +  R  +GV    PG V T L
Sbjct: 142 GGHLVNVSSA-AGLVGLPWHAAYSASKYGLRGLSEVLRFDLARHGIGVSVVVPGAVKTPL 200

Query: 181 L 183
           +
Sbjct: 201 V 201



>gb:AB026544_1516998 Hyoscyamus niger tr1 gene for tropinone
           reductase-I, complete cds.>gb:D88156_1675093 Hyoscyamus
           niger mRNA for tropinone reductase-I, complete cds.
          Length = 274

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 18/72 (25%), Positives = 41/72 (56%), Gaps = 3/72 (4%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL---LSGSSVQ 204
           +G S+ P  ++Y ++K  + Q+  +L  E  +  + V++ +PG++LT L+   +  +  Q
Sbjct: 161 AGFSALPSVSLYSASKAAINQITKNLACEWAKDNIRVNSVAPGVILTPLIETAIKKNPHQ 220

Query: 205 NKQMFNIICELP 240
            +++ N I + P
Sbjct: 221 KEEIDNFIVKTP 232



>gb:BA000040_736140 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 250

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 21/63 (33%), Positives = 35/63 (55%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+  +G    +   TAVY +TK  +  + S L KE    K+ V+  +PGM+ T+ 
Sbjct: 135 GGSIINIS-SGVSTIAPANTAVYTATKASVDAISSVLSKELAPRKIRVNAVNPGMIATEG 193

Query: 181 LLS 189
           ++S
Sbjct: 194 VVS 196



>sp|P50164|TRN2_HYONI Tropinone reductase-II (EC 1.1.1.236)
           (TR-II).>gb:AB026545_1516999 Hyoscyamus niger tr2 gene
           for tropinone reductase-II, complete
           cds.>gb:HYSTR2A_1682922 Hyoscyamus niger tropinone
           reductase-II mRNA, complete cds.
          Length = 260

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 18/50 (36%), Positives = 28/50 (56%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           SG S+ P  AVYG+TK  + QL   L  E  +  + V+   PG++ T ++
Sbjct: 148 SGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSMV 197



>gb:AY305858_2082143 Rattus norvegicus carbonyl reductase 4 (Cbr4)
           mRNA, complete cds.>gb:BC086378_2109568 Rattus
           norvegicus carbonyl reductase 4, mRNA (cDNA clone
           MGC:105271 IMAGE:7302014), complete cds.
          Length = 236

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 22/60 (36%), Positives = 31/60 (51%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       A Y +TK GL     SL KE  R K+ V+  +PG + TD+
Sbjct: 126 GGSIVNV-GSIIGLKGNVGQAAYSATKGGLIGFSRSLAKEVARKKIRVNVVAPGFIHTDM 184



>gb:AE017235_413023 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 9 of 16 of the complete
           genome.>gb:AE016958_1056427 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 268

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 9/115 (7%)
 Frame = +1

Query: 19  MDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSG-S 195
           + G+ +G S  P  A Y +TK  +     SL  E + S V V   +PG V TDL     +
Sbjct: 141 ISGSAAGNSPIPYNATYAATKAFVNTFSESLRGELRGSGVHVTLLAPGPVRTDLPDDAEA 200

Query: 196 SVQNKQMFNIICELPETVARTLVP-----RMRIVKG-SGKAINYLT--PPRILIA 336
           S+  + + + +    E  AR  +      +MR+V G + KA++  +   PR ++A
Sbjct: 201 SIVERLVPDFLWISTEHTARVSLDALGRNKMRVVPGLTSKAMSVASGYAPRAIVA 255



>sp|Q45219|YL46_BRAJA Probable short-chain type
           dehydrogenase/reductase blr2146 (EC
           1.-.-.-).>gb:BA000040_730406 Bradyrhizobium japonicum
           USDA 110 DNA, complete genome.
          Length = 281

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 18/63 (28%), Positives = 34/63 (53%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + NM         T LT+ Y ++K  +  L SSL  +   +++  +  +PG+++T+ 
Sbjct: 138 GGAIVNMSSCQGLSGDTALTS-YAASKAAMNMLSSSLATQYGHAQIRCNAVAPGLIMTER 196

Query: 181 LLS 189
           LL+
Sbjct: 197 LLA 199



>sp|P50162|TRN1_DATST Tropinone reductase-I (EC 1.1.1.206) (TR-I)
           (Tropine dehydrogenase).>pir|A48674|A48674 tropinone
           reductase (EC 1.1.1.236) I -
           jimsonweed>gb:DURTROPRI_1676203 Datura stramonium
           tropinone reductase-I mRNA, complete cds.
          Length = 273

 Score = 37.0 bits (84), Expect = 0.40
 Identities = 19/72 (26%), Positives = 41/72 (56%), Gaps = 3/72 (4%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL---LSGSSVQ 204
           +G S+ P  ++Y ++K  + Q+  SL  E  +  + V++ +PG++LT L+   +  +  Q
Sbjct: 160 AGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVILTPLVETAIKKNPHQ 219

Query: 205 NKQMFNIICELP 240
            +++ N I + P
Sbjct: 220 KEEIDNFIVKTP 231



>gb:AP006618_560720 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 249

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 20/68 (29%), Positives = 29/68 (42%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+  +    +        A Y ++K GL  L  +L  E  RS + V T  PG + TD+
Sbjct: 133 GGHLVLVSSMSAVRGLPGKKAAYSASKAGLAALGEALATEFARSPIAVTTLLPGFIATDM 192

Query: 181 LLSGSSVQ 204
                  Q
Sbjct: 193 AAKAGDAQ 200



>pir|F69868|F69868 glucose 1-dehydrogenase homolog ykvO - Bacillus
           subtilis>gb:BSUB0008_753342 Bacillus subtilis complete
           genome (section 8 of 21): from 1410943 to 1602922.
          Length = 248

 Score = 36.6 bits (83), Expect = 0.53
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +1

Query: 25  GAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLT 174
           G+ +G    P  +VYG++K  LR L  +   + K +++ V+  SPG +LT
Sbjct: 137 GSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVNVVSPGGILT 186



>gb:BC009118_2090805 Mus musculus cDNA sequence BC009118, mRNA (cDNA
           clone MGC:6971 IMAGE:3154595), complete cds.
          Length = 236

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 21/60 (35%), Positives = 31/60 (51%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       + Y +TK GL     SL KE  R K+ V+  +PG + TD+
Sbjct: 126 GGSIVNV-GSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDM 184



>gb:STU292343_1723031 Solanum tuberosum mRNA for tropinone reductase
           II (trII gene).
          Length = 261

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           SG S+ P  AVYG+TK  + QL   L  E  +  + V+  +PG++ + ++
Sbjct: 149 SGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVAPGVIASSMV 198



>gb:STU245634_1723003 Solanum tuberosum mRNA for tropinone reductase
           II (TRII gene).
          Length = 261

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           SG S+ P  AVYG+TK  + QL   L  E  +  + V+  +PG++ + ++
Sbjct: 149 SGASALPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVAPGVIASSMV 198



>gb:AK043313_1166565 Mus musculus 7 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:A730083J17
           product:similar to CDNA FLJ14431 FIS, CLONE
           HEMBA1006521, WEAKLY SIMILAR TO 3-OXOACYL-[ACYL-CARRIER
           PROTEIN] REDUCTASE (EC 1.1.1.100) [Homo sapiens], full
           insert sequence.
          Length = 216

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 21/60 (35%), Positives = 31/60 (51%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       + Y +TK GL     SL KE  R K+ V+  +PG + TD+
Sbjct: 106 GGSIVNV-GSIIGLKGNVGQSAYSATKGGLVGFSRSLAKEVARKKIRVNVVAPGFIRTDM 164



>gb:BA000043_738906 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 262

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 29/94 (30%), Positives = 46/94 (48%), Gaps = 4/94 (4%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+  + +G  +TP ++VY +TK  +     SL  E  R  + V   +PG V T+  
Sbjct: 135 GHILNI-ASQAGKIATPKSSVYSATKHAVVGFTDSLRLEAGRFGIFVTAVNPGPVETNFF 193

Query: 184 L----SGSSVQNKQMFNIICELPETVARTLVPRM 273
                SG  V+N   + +    PE VA+ +V  M
Sbjct: 194 SAADESGEYVRNVSRWML---RPEAVAKRVVAAM 224



>gb:BA000030_704090 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 276

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 25/60 (41%), Positives = 34/60 (56%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG V  M G+ SGG  +P +A YG+ K GL  L  S+  E    ++ V+T   GMV T+L
Sbjct: 119 GGAVV-MVGSVSGGRPSPGSAAYGAAKAGLESLARSMAVEW-APEIRVNTLVLGMVRTEL 176



>gb:CR555306_105567 Azoarcus sp. EbN1 complete genome.
          Length = 267

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 22/62 (35%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTAS--PGMVLT 174
           GG + N+    +G   TP   VY +TK  +R L  +   EC R   G+   S  PG+V T
Sbjct: 139 GGSIINLSSV-AGLIGTPALGVYSATKGAVRLLSKAAAVECGRLGYGIRVNSIHPGLVDT 197

Query: 175 DL 180
           D+
Sbjct: 198 DM 199



>pir|AD1635|AD1635 ketoacyl reductases homolog lin1621 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596169_538966
           Listeria innocua Clip11262 complete genome, segment
           7/12.
          Length = 253

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 24/83 (28%), Positives = 39/83 (46%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+   GS   + P  AVY ++K  +  L  ++  E K + V V T  PG   T+  
Sbjct: 130 GHILNVGSTGSY-IACPKDAVYAASKAYILHLSKAVHAELKGTGVTVTTLCPGSTRTE-F 187

Query: 184 LSGSSVQNKQMFNIICELPETVA 252
              + +++  +F I    P  VA
Sbjct: 188 AHKAKIEHTLLFKIFVMSPHKVA 210



>pir|I40211|I40211 probable sterol dehydrogenase (EC 1.1.1.-) -
           Bradyrhizobium japonicum>gb:BJU12678_748888
           Bradyrhizobium japonicum USDA 110 cytochrome P-450 BJ-2
           (CYP115P) pseudogene, cytochrome P-450 BJ-1 (CYP112)
           gene, cytochrome P-450 BJ-3 (CYP114) gene, putative
           ferredoxin gene, putative sterol dehydrogenase-like
           enzyme gene, cytochrome P-450 BJ-4 (CYP117) gene, and
           putative dimethylallyltranstransferase gene, complete
           cds.
          Length = 275

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 18/72 (25%), Positives = 37/72 (51%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + NM         T LT+ Y ++K  +  L SSL  +   +++  +  +PG+++T+ 
Sbjct: 138 GGAIVNMSSCQGLSGDTALTS-YAASKAAMNMLSSSLATQYGHAQIRCNAVAPGLIMTER 196

Query: 181 LLSGSSVQNKQM 216
           L   + ++  Q+
Sbjct: 197 LRMQTHLRRHQL 208



>sp|P50163|TRN2_DATST Tropinone reductase-II (EC 1.1.1.236)
           (TR-II).>pir|B48674|B48674 tropinone reductase (EC
           1.1.1.236) II - jimsonweed>gb:DURTROPRII_1676204 Datura
           stramonium tropinone reductase-II mRNA, complete cds.
          Length = 260

 Score = 36.2 bits (82), Expect = 0.69
 Identities = 18/50 (36%), Positives = 27/50 (54%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           SG  + P  AVYG+TK  + QL   L  E  +  + V+   PG++ T L+
Sbjct: 148 SGALAVPYEAVYGATKGAMDQLTRCLAFEWAKDNIRVNGVGPGVIATSLV 197



>gb:BX640438_813236 Bordetella bronchiseptica strain RB50, complete
           genome; segment 2/16.
          Length = 250

 Score = 35.8 bits (81), Expect = 0.90
 Identities = 21/43 (48%), Positives = 24/43 (55%)
 Frame = +1

Query: 52  PLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           P  +VY  TK GL QL  SL  E  R KV V+   PG + TDL
Sbjct: 150 PDNSVYCLTKGGLLQLTKSLAMEWARHKVRVNAICPGWIETDL 192



>gb:AE017333_449289 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_859080 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 248

 Score = 35.8 bits (81), Expect = 0.90
 Identities = 18/60 (30%), Positives = 28/60 (46%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + NM    S       +  YG++K G+  L   L KE    ++ V+   PG + TD+
Sbjct: 133 GGKIVNMSSTTSKTPHHNASPAYGASKAGINYLTMHLAKELAEHRIHVNGVCPGPIETDM 192



>gb:AE017333_448383 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858188 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 260

 Score = 35.8 bits (81), Expect = 0.90
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GH+ N+  + +G  +TP +++Y +TK  +    +SL  E   + V V T +PG + TD
Sbjct: 133 GHIINI-ASQAGKIATPKSSLYAATKHAVLGYSNSLRMELAETGVNVTTVNPGPIQTD 189



>gb:CP000033_88954 Lactobacillus acidophilus NCFM, complete genome.
          Length = 242

 Score = 35.8 bits (81), Expect = 0.90
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +1

Query: 25  GAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLT--DLLLSGSS 198
           G+  GGS + L AVY +TK GL +   +  +E   + + V+  +PG V T  + + S  +
Sbjct: 136 GSVYGGSGSALEAVYSATKGGLTRFAQAYAREVASNDLTVNVIAPGAVKTRMNAIFSEDT 195

Query: 199 VQNKQ 213
           +Q  Q
Sbjct: 196 IQEVQ 200



>gb:BC080139_2561570 Xenopus tropicalis MGC89688 protein, mRNA (cDNA
           clone MGC:89688 IMAGE:7026410), complete cds.
          Length = 236

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 20/62 (32%), Positives = 33/62 (53%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       ++YG++K GL     SL KE  +  + V+  +PG + TD+
Sbjct: 126 GGAIVNI-GSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIHTDM 184

Query: 181 LL 186
            L
Sbjct: 185 TL 186



>gb:BC033650_1980975 Homo sapiens carbonic reductase 4, mRNA (cDNA
           clone MGC:44889 IMAGE:5574637), complete cds.
          Length = 237

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       +VY ++K GL     +L KE  R K+ V+  +PG V TD+
Sbjct: 127 GGSIVNV-GSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDM 185



>gb:CR382123_1656028 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 259

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
 Frame = +1

Query: 25  GAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMV-LTDLL 183
           G  S     P TA+Y ++K  + Q    L +E KR  + V T SPG+V  TD++
Sbjct: 170 GDSSSNIIVPGTAMYSASKAAMIQYNRVLSEELKRLSIDVQTISPGLVESTDMI 223



>gb:AX269024_1465070 Sequence 1 from Patent WO0175119.
          Length = 237

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       +VY ++K GL     +L KE  R K+ V+  +PG V TD+
Sbjct: 127 GGSIVNV-GSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDM 185



>gb:HSM804706_1187255 Homo sapiens mRNA; cDNA DKFZp762K109 (from
           clone DKFZp762K109).>gb:BC021973_1977624 Homo sapiens
           carbonic reductase 4, mRNA (cDNA clone MGC:16116
           IMAGE:3625459), complete cds.
          Length = 237

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       +VY ++K GL     +L KE  R K+ V+  +PG V TD+
Sbjct: 127 GGSIVNV-GSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDM 185



>gb:BX571966_793857 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 596

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 27/101 (26%), Positives = 41/101 (40%), Gaps = 13/101 (12%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+ N   A + G S  L A Y +TK  +  L   +  E     +GV    PG   T +
Sbjct: 456 GGHIVNTASAAAFGPSRDLPA-YATTKAAVLMLSECMRAELADHGIGVTAVCPGFAETGI 514

Query: 181 LLSGSSVQNK-------------QMFNIICELPETVARTLV 264
           + S      K             +++ +    PETVA+ +V
Sbjct: 515 MASTQYASAKSDQDEARLRKRATKLYQMRGLKPETVAKAMV 555



>gb:BA000021_686837 Wigglesworthia glossinidia endosymbiont of
           Glossina brevipalpis DNA, complete genome.
          Length = 244

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 24/79 (30%), Positives = 38/79 (48%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G + N+ G+ SG +       Y ++K GL     SL +E  +  + V+  SPG + TD+ 
Sbjct: 131 GRIINI-GSVSGFTGNIGQTNYSASKSGLTGFTKSLAREVAKKGITVNMVSPGFIKTDMT 189

Query: 184 LSGSSVQNKQMFNIICELP 240
            S S    K   NI+  +P
Sbjct: 190 KSLSENNKK---NILSNIP 205



>gb:AP006618_559091 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 295

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 36/155 (23%), Positives = 62/155 (40%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+ N+  A +G    P  A Y + K GLR +   L  + +R ++GV    PG + T +
Sbjct: 136 GGHLVNVASA-AGLFGLPWHAPYSAGKFGLRGVSEVLRFDLRRHRIGVSLVCPGAMRTPM 194

Query: 181 LLSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRR 360
                 V   ++  +  E              + KG    + +   P    A +   + R
Sbjct: 195 ------VNRVEIAGVDREAE-----------AVQKGMKLFLRHAVTPEAAAASIVRGVER 237

Query: 361 GRWFDDQGRAVYAAEADRLRNWAESRTRLSFTDAM 465
            R+       VY +   R+ +WA+     ++T AM
Sbjct: 238 NRYL------VYTSHDIRVGHWAQRYFPPAYTLAM 266



>gb:BC068653_2555157 Xenopus laevis hypothetical protein MGC80021,
           mRNA (cDNA clone MGC:80021 IMAGE:3401329), complete cds.
          Length = 236

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 19/60 (31%), Positives = 32/60 (53%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G       ++YG++K GL     SL KE  +  + V+  +PG + TD+
Sbjct: 126 GGSIVNI-GSIVGHKGNIGQSIYGASKEGLIGFSKSLAKEVAKRNIRVNVVAPGFIRTDM 184



>gb:BA000045_741189 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 270

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 4/119 (3%)
 Frame = +1

Query: 67  YGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQMFNIICELPET 246
           Y ++K G+ QL  S+ +E   SK+ V++ +PG + TD+        N++ +    E PE 
Sbjct: 168 YAASKGGIEQLMKSIAQELAPSKIRVNSIAPGAIKTDI--------NRESW----EKPEA 215

Query: 247 VARTL--VPRMRIVKGS--GKAINYLTPPRILIALVSAWLRRGRWFDDQGRAVYAAEAD 411
            A  L  +P  R+ +    GKA  +L          S ++     F D G  +Y   AD
Sbjct: 216 EAELLKRIPAGRVGESDDIGKAAVWLASDE------SDYVNGTTLFIDGGMTLYPEFAD 268



>pir|G70515|G70515 probable dehydrogenase - Mycobacterium
           tuberculosis (strain H37RV)>gb:AE000516_21976
           Mycobacterium tuberculosis CDC1551, complete
           genome.>gb:BX248340_759271 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           7/14.>gb:BX842578_819954 Mycobacterium tuberculosis
           H37Rv complete genome; segment 7/13.
          Length = 277

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 5/124 (4%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G +     + SG    P  AVY +TK  ++ L  +L  E +R  V V    PG++ T +L
Sbjct: 129 GSLMFSTSSSSGTYGMPRIAVYSATKHAVKGLTEALSVEWQRHGVRVADVLPGLIDTAIL 188

Query: 184 LSGSSVQNKQMFNIICE-----LPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSA 348
            S     ++  + I  E      P+     L+P   + + + +A  + T     +     
Sbjct: 189 TSTRQHSDEGPYTISAEQIRAAAPKKGMFRLMPSSSVAEAAWRAYQHPTRLHWYVPRSIR 248

Query: 349 WLRR 360
           W+ R
Sbjct: 249 WIDR 252



>gb:AF340008_1264052 Encephalitozoon cuniculi isolate CDC:V446
          spore wall protein-1 gene, partial cds.
          Length = 138

 Score = 24.3 bits (51), Expect(5) = 1.6
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = +1

Query: 4  GHVFNMDGAGSGGSS 48
          G +F   G+GSGGSS
Sbjct: 22 GRIFGSSGSGSGGSS 36



 Score = 21.2 bits (43), Expect(5) = 1.6
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 22  DGAGSGGSS 48
           DG+GSGGSS
Sbjct: 113 DGSGSGGSS 121



 Score = 21.2 bits (43), Expect(5) = 1.6
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 22  DGAGSGGSS 48
           DG+GSGGSS
Sbjct: 96  DGSGSGGSS 104



 Score = 21.2 bits (43), Expect(5) = 1.6
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 22  DGAGSGGSS 48
           DG+GSGGSS
Sbjct: 79  DGSGSGGSS 87



 Score = 21.2 bits (43), Expect(5) = 1.6
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 22 DGAGSGGSS 48
          DG+GSGGSS
Sbjct: 45 DGSGSGGSS 53



>gb:AP003272_1826927 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0506E04.>gb:AP004330_1840290 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0052O12.
          Length = 277

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +1

Query: 46  STPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           + P  AVY +TK G+ QL   L  E  R  V V+  +PG   TD+
Sbjct: 168 AAPHLAVYSATKGGMNQLTRCLAAEWARDGVRVNAVAPGATRTDI 212



>gb:AP003272_1826926 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0506E04.>gb:AP004330_1840289 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0052O12.
          Length = 281

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSS 198
           +G  + P  +VY +TK  + QL  SL  E  R  + V+  +PG V TD  ++GSS
Sbjct: 168 AGFIAYPALSVYSATKGAMNQLTRSLAAEWARDGIRVNCVAPGGVRTD--IAGSS 220



>gb:CP000009_864016 Gluconobacter oxydans 621H, complete genome.
          Length = 259

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           +G    PL   Y +TK  +R L  S  KE   S + V++  PG+V TD+
Sbjct: 144 AGHEGYPLLGAYSATKFAVRALTQSAAKELASSGITVNSYCPGIVGTDM 192



>gb:BX950851_843213 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 250

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 6/86 (6%)
 Frame = +1

Query: 4   GHVFNMDGAGS----GGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVL 171
           GHV N+    +     G+S     VY +TK G+  L   L  +C   +V V    PG V 
Sbjct: 125 GHVINITSIAAIYNFNGNS-----VYHATKAGVHALSRQLRVDCYGKRVRVTEICPGRVA 179

Query: 172 TDLL--LSGSSVQNKQMFNIICELPE 243
           TD+   +SG   + ++ F    ELP+
Sbjct: 180 TDIFGNVSGDYEEARKRFIEGFELPQ 205



>gb:BX908798_830822 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 277

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 9/106 (8%)
 Frame = +1

Query: 52  PLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQMFNIIC 231
           P  AVY +TK  + Q   SL +E K   + V  A PGMV T+   +    + ++   ++ 
Sbjct: 152 PNMAVYAATKAFINQFSQSLDEELKPLGIRVLVACPGMVKTEFSQNAGMTRTRKFTAVMS 211

Query: 232 ELPETVARTL------VPRMRIVKGSGKA---INYLTPPRILIALV 342
              + VAR +      +  + I+    +    ++YL P +I+ A++
Sbjct: 212 S--KFVARAIWKQIESLTPLTIIDWKYRLLTWLSYLIPKKIVTAII 255



>gb:AF509565_517744 Streptomyces sp. JP95 griseorhodin biosynthesis
           gene cluster, complete sequence.
          Length = 257

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 5/85 (5%)
 Frame = +1

Query: 25  GAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSS-- 198
           GAG   +  P  + YG+ K  L  L  SL  E   + + V+   PG  LT+ +L+ +S  
Sbjct: 152 GAGLAETGLPGASAYGAAKAALHGLVRSLAWEVGPAGILVNEVVPGQTLTENVLAHASPA 211

Query: 199 -VQNK--QMFNIICELPETVARTLV 264
            ++NK   + +     PE VAR +V
Sbjct: 212 FLENKAASLPSGRMNTPEDVARAIV 236



>gb:TACID1_196026 Thermoplasma acidophilum complete genome; segment
           1/5.
          Length = 255

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 19/65 (29%), Positives = 29/65 (44%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G + NM      G++   T  Y  TK G+  L   L  +     + V+  +PG + TDL 
Sbjct: 131 GVIINMASNAGIGTAARNTTFYSITKAGIIMLTKRLAFDLSEYGIRVNAIAPGWIETDLT 190

Query: 184 LSGSS 198
           + G S
Sbjct: 191 IGGKS 195



>gb:AC006677_1203677 Caenorhabditis elegans cosmid R05D8, complete
           sequence.
          Length = 278

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 20/60 (33%), Positives = 28/60 (46%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G + N+    +G         YG  K GL QL  SL  E     V V++ SPG++ T+ L
Sbjct: 141 GEIVNVSSIAAGPQPYIYYTYYGICKAGLDQLTRSLALELIPFDVRVNSVSPGLISTNFL 200



>gb:AE014298_1124706 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003442_1209888 Drosophila melanogaster
           chromosome X, section 26 of 74 of the complete
           sequence.>gb:AY121708_1301370 Drosophila melanogaster
           RH59310 full insert cDNA.
          Length = 321

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 30/113 (26%), Positives = 50/113 (44%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G + N+    +G    PL +VY STK  + +    L  E K   + + +  PG V T++ 
Sbjct: 186 GVIINVSST-AGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATNM- 243

Query: 184 LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALV 342
              S ++   +F      PET  R+ +  + I   + +   YL  P  L+ LV
Sbjct: 244 ---SKIRKASVF---APSPETYVRSALSTLGI---ATQTAGYL--PHALLQLV 285



>gb:AL935258_551801 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 7/11.
          Length = 263

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 19/58 (32%), Positives = 33/58 (56%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           G + N+  + +G  +TP +AVY ++K  +    ++L  E K + V V T +PG + TD
Sbjct: 136 GEIVNI-ASMAGKIATPKSAVYAASKAAIIAYDNALRLELKDAHVNVLTVNPGPIKTD 192



>gb:AE017328_444420 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076776
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 263

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+  + +   +TP + VY +TK  +    ++L  E    K+ V T +PG + T+  
Sbjct: 136 GHIINI-ASQAAKIATPKSTVYSATKYAVLGFSNALRLELMPDKIHVTTINPGPIATNFF 194

Query: 184 -LSGSSVQNKQMFNIICELPETVARTLVPRM 273
            ++  S    +    +   PE VAR  V  M
Sbjct: 195 DVADKSGNYLETVGKLVLKPEKVARKTVQIM 225



>gb:AE016935_361748 Bacteroides thetaiotaomicron VPI-5482, section
           10 of 21 of the complete genome.>gb:AE015928_988236
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 240

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = +1

Query: 4   GHVFNMD------GAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGM 165
           G++FN+       G   GG       +YGSTK  L  L  SL++E     + V T  PG 
Sbjct: 136 GYIFNVASRAAKYGFADGG-------IYGSTKFALLGLAESLYRELAPLGIRVTTLCPGW 188

Query: 166 VLTDLL-LSGSSVQNKQM 216
           V TD+   +G+  ++++M
Sbjct: 189 VNTDMAKKAGTPFKDEEM 206



>pir|AI1692|AI1692 oxidoreductase homolog lin2083 [imported] -
           Listeria innocua (strain Clip11262)>gb:AL596170_539427
           Listeria innocua Clip11262 complete genome, segment
           8/12.
          Length = 263

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 1/91 (1%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+  + +   +TP + VY +TK  +    ++L  E    K+ V T +PG + T+  
Sbjct: 136 GHIINI-ASQAAKIATPKSTVYSATKYAVLGFSNALRLELMPDKIHVTTINPGPIATNFF 194

Query: 184 -LSGSSVQNKQMFNIICELPETVARTLVPRM 273
            ++  S    +    +   PE VAR  V  M
Sbjct: 195 DVADKSGNYLETVGKLVLQPEKVARKTVQIM 225



>sp|P19992|2BHD_STREX 20-beta-hydroxysteroid dehydrogenase (EC
           1.1.1.53).>pir|S10707|S10707 20beta-hydroxysteroid
           dehydrogenase (EC 1.1.1.-) - Streptomyces exfoliatus
          Length = 255

 Score = 34.3 bits (77), Expect = 2.6
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+  A +G     LT+ YG++K G+R L      E    ++ V++  PGM  T +
Sbjct: 131 GGSIVNISSA-AGLMGLALTSSYGASKWGVRGLSKLAAVELGTDRIRVNSVHPGMTYTPM 189



>gb:BC065615_2554063 Danio rerio zgc:77144, mRNA (cDNA clone
           MGC:77144 IMAGE:6961206), complete cds.
          Length = 237

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+ G+  G        VY ++K GL     SL KE     + V+  +PG++ TD+
Sbjct: 127 GGAIVNI-GSVVGVKGNAGQCVYSASKAGLEGFTRSLAKEVASRNIRVNLVAPGLIHTDM 185



>gb:CP000003_860480 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 263

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N     +G    P   VYG TK  +R +  +L K+     + V+  +PG+V T +
Sbjct: 138 GGKIINATSQ-AGCEGNPNLTVYGGTKFAVRGITQTLAKDLASEGITVNAYAPGIVKTPM 196

Query: 181 L 183
           +
Sbjct: 197 M 197



>gb:BX640424_808831 Bordetella parapertussis strain 12822, complete
           genome; segment 2/14.
          Length = 250

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 20/43 (46%), Positives = 23/43 (53%)
 Frame = +1

Query: 52  PLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           P  + Y  TK GL QL  SL  E  R KV V+   PG + TDL
Sbjct: 150 PDNSFYCLTKGGLLQLTKSLAMEWARHKVRVNAICPGWIETDL 192



>gb:AE016933_361279 Bacteroides thetaiotaomicron VPI-5482, section 8
           of 21 of the complete genome.>gb:AE015928_987767
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 259

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 5/92 (5%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG++ N+    SG ++     +YG++K G+  L   +  +  +  +  +  +PG+VLT  
Sbjct: 137 GGNIVNVASI-SGLTADANGTLYGASKAGVINLTKYIATQMGKKNIRCNAVAPGLVLTPA 195

Query: 181 LLSGSSVQNKQMFNIICEL-----PETVARTL 261
            L   + + + +F   C       PE VA T+
Sbjct: 196 ALDNLNEEVRNIFLGQCATPYLGEPEDVAATI 227



>gb:AE010004_258266 Streptococcus pyogenes strain MGAS8232, section
           52 of 173 of the complete genome.>gb:AE009949_904648
           Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 254

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N     +G    P   VYG TK  +R +  +L K+     + V+  +PG+V T +
Sbjct: 129 GGKIINATSQ-AGCEGNPNLTVYGGTKFAVRGITQTLAKDLASEGITVNAYAPGIVKTPM 187

Query: 181 L 183
           +
Sbjct: 188 M 188



>gb:SCO939119_177841 Streptomyces coelicolor A3(2) complete genome;
           segment 16/29.
          Length = 254

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 21/60 (35%), Positives = 32/60 (53%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+  A +G     LTA YG++K G+R L      E   ++V V++  PGM  T +
Sbjct: 131 GGSIVNISSA-AGLMGLALTAGYGASKWGVRGLTKIGAVEWGTARVRVNSVHPGMTYTPM 189



>gb:SAG766846_170096 Streptococcus agalactiae NEM316 complete
           genome, segment 4.>gb:AE014215_305858 Streptococcus
           agalactiae 2603V/R section 25 of 100 of the complete
           genome.>gb:AE009948_935971 Streptococcus agalactiae
           2603V/R complete genome.
          Length = 254

 Score = 33.9 bits (76), Expect = 3.4
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N     +G    P   VYG TK  +R +  +L K+     + V+  +PG+V T +
Sbjct: 129 GGKIINATSQ-AGCEGNPNLTVYGGTKFAVRGITQTLAKDLASEGITVNAYAPGIVKTPM 187

Query: 181 L 183
           +
Sbjct: 188 M 188



>gb:CR380959_1654135 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 268

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 20/58 (34%), Positives = 32/58 (55%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           G + N+ G+ +G  + P  A+Y +TK  +R    SL KE   + + V   +PGMV T+
Sbjct: 148 GDIVNL-GSIAGRDAYPTGAIYCATKHAVRAFTQSLRKELINTDIRVIEIAPGMVETE 204



>gb:AY596297_633313 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 269

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 18/58 (31%), Positives = 28/58 (48%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLT 174
           GG V N+    +G    P  + YG+ K G+  L S+L  E     + ++  +PG V T
Sbjct: 150 GGTVINLSSV-AGEQGAPYMSHYGAAKAGVSNLTSTLSAEWADRDIRINCIAPGFVAT 206



>gb:AP006841_574031 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 259

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 18/80 (22%), Positives = 41/80 (51%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG++ N+    SG ++     +YG++K G+  L   +  +  +  +  +  +PG++LT  
Sbjct: 137 GGNIVNVASI-SGITADSNGTLYGASKAGVINLTKYIATQTGKKNIRCNAVAPGLILTPA 195

Query: 181 LLSGSSVQNKQMFNIICELP 240
            L+  + + +++F   C  P
Sbjct: 196 ALNNLNEEVRKIFLGQCATP 215



>gb:AL646062_545980 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 6/19.
          Length = 249

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 23/109 (21%), Positives = 46/109 (42%), Gaps = 2/109 (1%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N+     G +  P  A Y + K G+  +  ++ KE     + V++ +PG + TD 
Sbjct: 135 GGRIINITSV-VGSAGNPGQANYAAAKAGVEGMARAMAKEIGSRNITVNSVAPGFIDTD- 192

Query: 181 LLSGSSVQNKQMFNIICELPETVARTLVP--RMRIVKGSGKAINYLTPP 321
                      M  ++ +   T  +  +P  R+ + +    A+ +L  P
Sbjct: 193 -----------MTKVLSDEQHTALKAQIPLGRLGMPEDIANAVAFLASP 230



>gb:AF173833_485505 Bacteroides fragilis 7-alpha-hydroxysteroid
           dehydrogenase (hdhA) gene, complete cds.
          Length = 259

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 18/80 (22%), Positives = 41/80 (51%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG++ N+    SG ++     +YG++K G+  L   +  +  +  +  +  +PG++LT  
Sbjct: 137 GGNIVNVASI-SGITADSNGTLYGASKAGVINLTKYIATQTGKKNIRCNAVAPGLILTPA 195

Query: 181 LLSGSSVQNKQMFNIICELP 240
            L+  + + +++F   C  P
Sbjct: 196 ALNNLNEEVRKIFLGQCATP 215



>gb:AE015774_317719 Shewanella oneidensis MR-1 section 323 of 457 of
           the complete genome.>gb:AE014299_953316 Shewanella
           oneidensis MR-1 complete genome.
          Length = 266

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +1

Query: 52  PLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           P    YG++K G++ L +SL  +  +  +GV    PG V T L
Sbjct: 153 PRAEAYGASKAGVKYLAASLSLDLAQDNIGVSVICPGFVATPL 195



>pir|AH1321|AH1321 oxidoreductase homolog lmo1976 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591981_536467
           Listeria monocytogenes strain EGD, complete genome,
           segment 9/12.
          Length = 263

 Score = 33.5 bits (75), Expect = 4.5
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 1/91 (1%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+  + +   +TP + VY +TK  +    ++L  E    K+ V T +PG + T+  
Sbjct: 136 GHIINI-ASQAAKIATPKSTVYSATKYAVLGFSNALRLELMPDKINVTTINPGPIATNFF 194

Query: 184 -LSGSSVQNKQMFNIICELPETVARTLVPRM 273
            ++  S    +    +   PE VA   V  M
Sbjct: 195 DVADKSSNYLETVGKLVLKPEKVAHKTVQIM 225



>gb:AE017347_1757808 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 261

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = +1

Query: 34  SGGSSTPLTA--VYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           SG SST   A  +Y   K G+  L  ++  E K + V + +  PGMV TD+
Sbjct: 144 SGASSTGYQAWGLYSMAKAGMNSLARTVASEEKENGVAIWSVRPGMVNTDM 194



>gb:EMEVERA1AA_1676657 Emericella nidulans (verA) gene, complete
           cds, ORF 1 gene, complete cds, and ORF 2 gene, 5' end.
          Length = 264

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG +       +     P  AVY  +K  +      L  +C   K+ V+  +PG + TD+
Sbjct: 138 GGRIILTSSNTASVKGVPRHAVYSGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAIKTDM 197

Query: 181 LLSGS 195
            LS S
Sbjct: 198 FLSVS 202



>gb:BX321861_773976 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 6/10.
          Length = 247

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 4/91 (4%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G + N+     G +  P    Y + K G+     SL KE     + V+  +PG + TD+ 
Sbjct: 134 GRIINISSV-VGATGNPGQTNYAAAKAGMIGFSKSLAKEIGSRNITVNCVAPGFIDTDMT 192

Query: 184 LSGSSVQNKQMFNII----CELPETVARTLV 264
            S S  Q + +   I       PE VA  +V
Sbjct: 193 RSLSPDQQQSLIQHIPLGRFGRPEDVAAAVV 223



>gb:BA000040_732251 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 244

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 21/73 (28%), Positives = 33/73 (45%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG +F M G+ +     P   VY ++K  LR    +   E K   + V+  SPG + T +
Sbjct: 129 GGSIF-MTGSVASVKGFPGYGVYAASKAALRSFARTWLNELKGRNIRVNVLSPGPIATPM 187

Query: 181 LLSGSSVQNKQMF 219
                +   K+MF
Sbjct: 188 QDQVLTEDAKRMF 200



>gb:AF241171_491713 Pseudomonas aeruginosa pathogenicity island
           PAGI-1 gene, complete sequence.
          Length = 255

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 11/65 (16%)
 Frame = +1

Query: 19  MDGAGSGGSSTPLTAV-----------YGSTKCGLRQLQSSLFKECKRSKVGVHTASPGM 165
           M  AG GGS   +T++           Y + K GL  L  ++  E  R  + V+  +PG 
Sbjct: 132 MVAAGKGGSLINVTSILASRVAGAVGPYLAAKAGLAHLTRAMALELARHGIRVNALAPGY 191

Query: 166 VLTDL 180
           V+TDL
Sbjct: 192 VMTDL 196



>gb:AE017263_420725 Mesoplasma florum L1 complete genome.
          Length = 279

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 20/64 (31%), Positives = 29/64 (45%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH++    A   G+  P  +VY   K GL     S+  E K   + + +  PG V T+ L
Sbjct: 128 GHIYITSSAWGYGT-VPYNSVYAVVKFGLDGFAESISHELKTVGISISSIKPGGVRTNFL 186

Query: 184 LSGS 195
            S S
Sbjct: 187 TSDS 190



>gb:AE017233_412421 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 7 of 16 of the complete
           genome.>gb:AE016958_1055825 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 279

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 39/152 (25%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+    +G +  P  A Y  TK  +     SL +E +  +VGV    PG++ T+ L
Sbjct: 133 GHIVNIASL-AGVTGEPGMATYCGTKHFVVGFTESLHRELRPHRVGVSLVLPGIINTE-L 190

Query: 184 LSGSSVQNKQMFNIICELPETVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRG 363
            +G+ V          E PE VA  +V           A++   P + + A + A L+  
Sbjct: 191 SAGTKVPGWARPLATAE-PEDVAAGIV----------AAVSKDKPRKTVPATLGALLKSV 239

Query: 364 RWFDDQGR--AVYAAEADRLRNWAESRTRLSF 453
               D  R    +A   D+L + A+   R ++
Sbjct: 240 SLLPDTPRFAVAHAVRFDQLVSGADPNARAAY 271



>gb:AE014145_303935 Streptococcus pyogenes MGAS315, section 10 of 37
           of the complete genome.>gb:BA000034_714321 Streptococcus
           pyogenes SSI-1 DNA, complete genome.>gb:AE014074_927114
           Streptococcus pyogenes MGAS315, complete genome.
          Length = 254

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N     +G    P   VYG TK  +R +  +L K+     + V+  +PG+V T +
Sbjct: 129 GGKIINATSQ-AGCEGNPNLTVYGGTKFTVRGITQTLAKDLASEGITVNAYAPGIVKTPM 187

Query: 181 L 183
           +
Sbjct: 188 M 188



>pir|D90399|D90399 hypothetical protein fabG-6 [imported] -
           Sulfolobus solfataricus>gb:AE006832_223065 Sulfolobus
           solfataricus P2 section 191 of 272 of the complete
           genome.>gb:AE006641_1108913 Sulfolobus solfataricus P2,
           complete genome.
          Length = 259

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 20/65 (30%), Positives = 30/65 (46%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G + N+      G++   T  Y  TK  +  L   L  E  +  + V+  +PG V TD+ 
Sbjct: 135 GAIVNIASNAGIGTAAEGTTFYAITKASIIILTKRLAFELGKYGIRVNAVAPGWVETDMT 194

Query: 184 LSGSS 198
           LSG S
Sbjct: 195 LSGKS 199



>sp|Q49117|YMEC_METEX Hypothetical oxidoreductase in MEAA 3'region
           (EC 1.-.-.-) (ORFC) (Fragment).>gb:MEU28335_143327
           Methylobacterium extorquens methylmalonylCoA mutase
           (meaA) and ORFB genes, complete cds, and 3-oxoacyl-(acyl
           carrier protein) reductase homolog gene, partial cds.
          Length = 153

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 19/59 (32%), Positives = 28/59 (47%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GG + N+    +     P +AVY  TK  L  +   L  E    K+ V+  SPG V+T+
Sbjct: 38  GGSIINISSVVTD-VLMPTSAVYSGTKGALNAISGVLANELAPRKIRVNVVSPGYVVTE 95



>sp|Q00791|STCU_EMENI Versicolorin reductase (EC
           1.1.-.-).>gb:ENU34740_1676782 Emericella nidulans
           sterigmatocystin biosynthetic gene cluster: (stcA),
           (stcB), (stcC), (stcE), (aflR), (stcF), (stcI), (stcJ),
           (stcK), (stcL), (stcO), (stcQ), (stcS), (stcT), (stcU),
           (stcV) and (stcW) genes, complete cds.
          Length = 264

 Score = 33.1 bits (74), Expect = 5.8
 Identities = 18/65 (27%), Positives = 28/65 (43%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG +       +     P  AVY  +K  +      L  +C   K+ V+  +PG + TD+
Sbjct: 138 GGRIILTSSNTASVKGVPRHAVYSGSKGAIDTFVRCLAIDCGDKKITVNAVAPGAIKTDM 197

Query: 181 LLSGS 195
            LS S
Sbjct: 198 FLSVS 202



>gb:AB112925_2048460 Mus musculus noc2 mRNA for Noc2, complete
           cds.>gb:AB158403_2048972 Mus musculus Noc2 mRNA,
           complete cds.>gb:AL669897_2072554 Mouse DNA sequence
           from clone RP23-78H4 on chromosome 11 Contains the Ywhae
           gene for tyrosine 3-monooxygenase/tryptophan
           5-monooxygenase activation protein epsilon polypeptide,
           the Doc2b gene for double C2 beta, a novl gene, the 3'
           end of the gene for a novel protein similar to rat
           rabphilin-3a related protein and two CpG islands,
           complete sequence.>gb:AL731710_2072921 Mouse DNA
           sequence from clone RP23-236D18 on chromosome 11
           Contains part of the gene for a novel protein similar to
           rat rabphilin-3a related protein, complete sequence.
          Length = 302

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -1

Query: 426 PVSKPIRLCSIHSSSLVIEPTASSQPSANQSD*YPW-RGQIINS 298
           P+  P R    H   L +EPT +  PSA  S  Y W RG++++S
Sbjct: 165 PLKTPGRADDPHFRPLPVEPTETQPPSAETSRVYTWARGRVVSS 208



>gb:CP000002_857721 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 260

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 18/62 (29%), Positives = 30/62 (48%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N     +G    P  AVYG TK  +R +  +  K+     + V+   PG+V T +
Sbjct: 135 GGKIINASSQ-AGQVGNPGLAVYGGTKFAVRGITQTAAKDLAELGITVNAFCPGIVKTPM 193

Query: 181 LL 186
           ++
Sbjct: 194 MM 195



>gb:CP000001_854489 Bacillus cereus ZK, complete genome.
          Length = 264

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 4/98 (4%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+    +G  +TP ++ Y +TK  +    +SL  E   + V V   +PG + T+  
Sbjct: 137 GHIINIASL-AGKIATPKSSAYAATKHAVLGFTNSLRMELSSTNVFVTAINPGPIDTNFF 195

Query: 184 ----LSGSSVQNKQMFNIICELPETVARTLVPRMRIVK 285
                SG+ V+N   + +    P  VA  +V  M+  K
Sbjct: 196 EIADQSGTYVKNMGRYML---KPTYVAEQIVKSMQTKK 230



>gb:BA000035_716395 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 246

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 31/102 (30%), Positives = 43/102 (42%)
 Frame = +1

Query: 64  VYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQMFNIICELPE 243
           VYGSTK GL      L      S V + TA PG V+   + +G S     ++      P 
Sbjct: 149 VYGSTKAGLDAFCQGLSDALHGSAVSLITARPGFVIGS-MTTGMSPAPMSVY------PG 201

Query: 244 TVARTLVPRMRIVKGSGKAINYLTPPRILIALVSAWLRRGRW 369
            VA  +V   RI  G G A  ++     L+A +   + R  W
Sbjct: 202 DVADAVVD--RITTGRGSATLWIPGRLRLLAWIMRTVPRPLW 241



>gb:BA000012_668277 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 251

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQ 213
           +G S +P    YGS+K  L  +  +  +E     + V+ A+PG   TDL     +   +Q
Sbjct: 163 AGNSQSPNVMGYGSSKTALNAITVAFARELSPRGMMVNAAAPGYTATDLNAHRGTRTVQQ 222

Query: 214 MFNIICEL 237
              II +L
Sbjct: 223 AAEIIVQL 230



>gb:AL646081_549314 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 6/11.
          Length = 224

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 17/36 (47%), Positives = 21/36 (58%)
 Frame = +1

Query: 376 DQGRAVYAAEADRLRNWAESRTRLSFTDAMETYTEN 483
           D+ RAV AAEA+ +R   E R   SF DA+E    N
Sbjct: 189 DKARAVLAAEAETMRAMQEDRWDRSFIDALEARCNN 224



>gb:AL646081_549305 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 6/11.
          Length = 250

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 6/86 (6%)
 Frame = +1

Query: 4   GHVFNMDG-AGS---GGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVL 171
           GHV N+   AG+   GG+ST     Y +TK  +  L   L  +    +V V    PG V 
Sbjct: 125 GHVVNISSIAGAYNFGGNST-----YHATKAAIHMLSRQLRIDAYGKRVRVTEICPGRVA 179

Query: 172 TDLL--LSGSSVQNKQMFNIICELPE 243
           TD+   + G S +  + F    ELP+
Sbjct: 180 TDIFAHVHGDSAETYERFVKGFELPQ 205



>gb:AE017333_447918 Bacillus licheniformis DSM 13, complete genome.
          Length = 260

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 18/62 (29%), Positives = 30/62 (48%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG + N     +G    P  AVYG TK  +R +  +  K+     + V+   PG+V T +
Sbjct: 135 GGKIINASSQ-AGQVGNPGLAVYGGTKFAVRGITQTAAKDLAELGITVNAFCPGIVKTPM 193

Query: 181 LL 186
           ++
Sbjct: 194 MM 195



>gb:AE017235_413053 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 9 of 16 of the complete
           genome.>gb:AE016958_1056457 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 238

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +1

Query: 52  PLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           P    Y ++K G+     +L  E  R  + VH  +PG V T++L
Sbjct: 134 PARTAYSASKAGMNAFARALALEVDRDGISVHLVTPGPVATEML 177



>gb:AE017037_384317 Bacillus anthracis str. Ames section 14 of 18 of
           the complete genome.>gb:AE017225_409419 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_454164 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1014022 Bacillus
           anthracis str. Ames complete genome.
          Length = 264

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 27/98 (27%), Positives = 46/98 (46%), Gaps = 4/98 (4%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+    +G  +TP ++ Y +TK  +    +SL  E   + V V   +PG + T+  
Sbjct: 137 GHIINIASL-AGKIATPKSSAYAATKHAVLGFTNSLRMELSSTNVFVTAINPGPIDTNFF 195

Query: 184 ----LSGSSVQNKQMFNIICELPETVARTLVPRMRIVK 285
                SG+ V+N   + +    P  VA  +V  M+  K
Sbjct: 196 EIADQSGTYVKNMGRYML---KPTYVAEQIVKSMQTKK 230



>gb:SCO939121_178353 Streptomyces coelicolor A3(2) complete genome;
           segment 18/29.
          Length = 269

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 16/53 (30%), Positives = 26/53 (49%)
 Frame = +1

Query: 40  GSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSS 198
           G+  P    Y ++K  +  +   L +E +   V V+T +PG   TDL L G +
Sbjct: 168 GTQFPTYGAYAASKGAVEAMTMILARELRGRDVTVNTVAPGPTATDLFLDGKT 220



>gb:CR555306_106484 Azoarcus sp. EbN1 complete genome.
          Length = 255

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
 Frame = +1

Query: 4   GHVFNM-DGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           G + N+   AG GGSS    AVY   K GL     ++ +E  R ++ V+   PG   T L
Sbjct: 135 GRIVNIASDAGRGGSSGE--AVYSFCKGGLIAFSKTMARELARQQISVNVVCPGPTDTPL 192

Query: 181 L 183
           L
Sbjct: 193 L 193



>pir|T36060|T36060 probable oxidoreductase - Streptomyces
           coelicolor>gb:SCO939118_177626 Streptomyces coelicolor
           A3(2) complete genome; segment 15/29.
          Length = 585

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 20/60 (33%), Positives = 29/60 (48%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GGH+ N   A +   S  L A YG++K  +  L   L  E     +GV    PG+V T++
Sbjct: 447 GGHIVNTASAAAFQPSRVLPA-YGTSKAAVLMLSECLRAELADRGIGVTAICPGLVNTNI 505



>sp|P54554|YQJQ_BACSU Hypothetical oxidoreductase yqjQ (EC
           1.-.-.-).>pir|A69965|A69965 ketoacyl reductase homolog
           yqjQ - Bacillus subtilis>gb:BACJH642_745809 Bacillus
           subtilis DNA, 283 Kb region containing skin
           element.>gb:BSUB0013_754343 Bacillus subtilis complete
           genome (section 13 of 21): from 2409151 to 2613687.
          Length = 259

 Score = 32.7 bits (73), Expect = 7.6
 Identities = 17/58 (29%), Positives = 33/58 (56%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GH+ N+  + +G  +TP +++Y +TK  +    ++L  E   + + V T +PG + TD
Sbjct: 132 GHIINI-ASQAGKIATPKSSLYSATKHAVLGYSNALRMELSGTGIYVTTVNPGPIQTD 188



>sp|Q9XZV1|SWP1_ENCCU Spore wall protein 1
           precursor.>gb:CNS07EGG_1374153 chromosome X of strain
           GB-M1 of Encephalitozoon cuniculi
           (Microspora).>gb:ECU133745_1384220 Encephalitozoon
           cuniculi mRNA for spore wall protein 1.
          Length = 450

 Score = 24.3 bits (51), Expect(4) = 8.0
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSS 48
           G +F   G+GSGGSS
Sbjct: 351 GRIFGSSGSGSGGSS 365



 Score = 21.2 bits (43), Expect(4) = 8.0
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 22  DGAGSGGSS 48
           DG+GSGGSS
Sbjct: 425 DGSGSGGSS 433



 Score = 21.2 bits (43), Expect(4) = 8.0
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 22  DGAGSGGSS 48
           DG+GSGGSS
Sbjct: 408 DGSGSGGSS 416



 Score = 21.2 bits (43), Expect(4) = 8.0
 Identities = 8/9 (88%), Positives = 9/9 (100%)
 Frame = +1

Query: 22  DGAGSGGSS 48
           DG+GSGGSS
Sbjct: 391 DGSGSGGSS 399



>gb:CP000024_876547 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 256

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GH+ NM G+ +G  +    AVY +TK  ++     L  +   + + V T  PG+V TD
Sbjct: 138 GHIINM-GSKAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTTIQPGIVETD 194



>gb:CP000023_874645 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 259

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GH+ NM G+ +G  +    AVY +TK  ++     L  +   + + V T  PG+V TD
Sbjct: 138 GHIINM-GSKAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTTIQPGIVETD 194



>gb:CP000011_868182 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 267

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 24/72 (33%), Positives = 33/72 (45%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG V  M G+     ++PL + Y + K GL  L   L KE  +  V  H   PG V T L
Sbjct: 141 GGVVIYM-GSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPL 199

Query: 181 LLSGSSVQNKQM 216
           +      Q K++
Sbjct: 200 VDKQIPEQAKEL 211



>gb:BX897700_828787 Bartonella quintana str. Toulouse, complete
           genome.
          Length = 117

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +2

Query: 461 PWRRTP-KILGFLCSRFLWFALSSFYRAQVAH 553
           PWR+TP ++LG L  RF    LSSF   Q  H
Sbjct: 19  PWRKTPGRLLGLLLIRFYQITLSSFIGNQCRH 50



>gb:BX571966_793590 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 262

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 24/72 (33%), Positives = 33/72 (45%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG V  M G+     ++PL + Y + K GL  L   L KE  +  V  H   PG V T L
Sbjct: 136 GGVVIYM-GSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPL 194

Query: 181 LLSGSSVQNKQM 216
           +      Q K++
Sbjct: 195 VDKQIPEQAKEL 206



>gb:BX571966_793248 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.>gb:CP000011_867488
           Burkholderia mallei ATCC 23344 chromosome 2, complete
           sequence.
          Length = 261

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 24/72 (33%), Positives = 33/72 (45%)
 Frame = +1

Query: 1   GGHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDL 180
           GG V  M G+     ++PL + Y + K GL  L   L KE  +  V  H   PG V T L
Sbjct: 135 GGVVIYM-GSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNVRSHVVCPGFVRTPL 193

Query: 181 LLSGSSVQNKQM 216
           +      Q K++
Sbjct: 194 VDKQIPEQAKEL 205



>gb:AF288038_495927 Streptococcus thermophilus putative
           oxidoreductase gene, complete cds; and putative HsdR
           gene, partial cds.
          Length = 260

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GH+ NM G+ +G  +    AVY +TK  ++     L  +   + + V T  PG+V TD
Sbjct: 139 GHIINM-GSKAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTTIQPGIVETD 195



>gb:AE017277_425405 Bacillus cereus ATCC 10987, section 14 of 18 of
           the complete genome.>gb:AE017194_1063824 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 264

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 26/98 (26%), Positives = 46/98 (46%), Gaps = 4/98 (4%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           GH+ N+    +G  +TP ++ Y +TK  +    +SL  E   + + V   +PG + T+  
Sbjct: 137 GHIINVASL-AGKIATPKSSAYAATKHAVLGFTNSLRMELSSTNIFVTAINPGPIDTNFF 195

Query: 184 ----LSGSSVQNKQMFNIICELPETVARTLVPRMRIVK 285
                SG+ V+N   + +    P  VA  +V  M+  K
Sbjct: 196 EIADQSGTYVKNMGRYML---KPTYVAEQIVKAMQTKK 230



>gb:AE017261_420341 Picrophilus torridus DSM 9790, complete genome.
          Length = 256

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLL 183
           G + NM      G++   T  Y  TK G+  L   L  +    K+ V+  +PG + TD+ 
Sbjct: 132 GIIINMASNAGIGTAAKNTTFYSITKAGVIMLTKRLAFDLMDYKIRVNAIAPGWIETDMT 191

Query: 184 LSG-SSVQNKQMFN 222
           +   +S + K++ N
Sbjct: 192 IGNKTSEEIKELEN 205



>gb:AE016784_332216 Pseudomonas putida KT2440 section 11 of 21 of
           the complete genome.>gb:AE015451_947293 Pseudomonas
           putida KT2440 complete genome.
          Length = 255

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 11/62 (17%)
 Frame = +1

Query: 28  AGSGGSSTPLTAV-----------YGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLT 174
           AG GGS   +T++           Y + K GL  L  ++  E  R  + V+  +PG V+T
Sbjct: 135 AGKGGSLINVTSILASRVAGAVGPYLAAKAGLAHLTRAMALELARHGIRVNALAPGYVMT 194

Query: 175 DL 180
           DL
Sbjct: 195 DL 196



>gb:AE011877_277324 Xanthomonas axonopodis pv. citri str. 306,
           section 255 of 469 of the complete
           genome.>gb:AE008923_919099 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 246

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 19/60 (31%), Positives = 31/60 (51%)
 Frame = +1

Query: 61  AVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQMFNIICELP 240
           A Y + K G+     SL +E     V V+T SPG V TD+++   +V  +    I+ ++P
Sbjct: 150 ANYAAAKAGMHGFTISLARENAAFGVTVNTVSPGYVATDMVM---AVPEEVRAKIVADIP 206



>pir|C98087|C98087 oxidoreductase (EC 1.-.-.-) [imported] -
           Streptococcus pneumoniae (strain R6)>gb:AE008538_238044
           Streptococcus pneumoniae R6 section 154 of 184 of the
           complete genome.>gb:AE007317_944202 Streptococcus
           pneumoniae R6, complete genome.
          Length = 253

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GH+ NM G+ +G  +    AVY +TK  ++     L  +   + + V T  PG+V TD
Sbjct: 134 GHIINM-GSTAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTTIQPGIVETD 190



>pir|A95223|A95223 hypothetical protein SP1909 [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007482_227039 Streptococcus pneumoniae TIGR4
           section 165 of 194 of the complete
           genome.>gb:AE005672_1104807 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 253

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = +1

Query: 4   GHVFNMDGAGSGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTD 177
           GH+ NM G+ +G  +    AVY +TK  ++     L  +   + + V T  PG+V TD
Sbjct: 134 GHIINM-GSTAGIYAYAGAAVYSATKAAVKTFSDGLRIDTIATDIKVTTIQPGIVETD 190



>sp|P35731|YKF5_YEAST Hypothetical oxidoreductase in NUP120-CSE4
           intergenic region (EC 1.-.-.-).>pir|S37877|S37877
           hypothetical protein YKL055c - yeast (Saccharomyces
           cerevisiae)>gb:SCXI286K_1710882 S.cerevisiae chromosome
           XI (28.6 kb) DNA for F206, B969, F167, human
           transcription factor homologue (C630), B113,
           fructose-bisphate-aldolase FBA1 (D359), D441, TFIIA
           small subunit (B112), E541, F445, human tumor protein
           homologue (E167), 3-oxoacyl-[acyl-carrier-protein]
           reductase homologue (E278), glutenin high molecular
           weight chain homologue (D738), B124, E292, B353,
           D513.>gb:SCYKL055C_1713028 S.cerevisiae chromosome XI
           reading frame ORF YKL055c.
          Length = 278

 Score = 32.3 bits (72), Expect = 10.0
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = +1

Query: 34  SGGSSTPLTAVYGSTKCGLRQLQSSLFKECKRSKVGVHTASPGMVLTDLLLSGSSVQNKQ 213
           SG    P T+VY ++K  L +    L  E +   +   T SPG+V    ++    V+ K+
Sbjct: 187 SGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDMIQNLPVEAKE 246

Query: 214 M 216
           M
Sbjct: 247 M 247


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 901,644,478
Number of Sequences: 1806583
Number of extensions: 19664246
Number of successful extensions: 46538
Number of sequences better than 10.0: 123
Number of HSP's better than 10.0 without gapping: 44858
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46525
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 48804504615
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)