BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11826
         (939 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF360339_1791285 Arabidopsis thaliana unknown protein (At1g15...   147   6e-42   
gb:AY142631_1583047 Arabidopsis thaliana unknown protein (At1g15...   147   6e-42   
pir|F86291|F86291 hypothetical protein F7H2.8 [imported] - Arabi...   147   6e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AY081507_1568767 Arabidopsis thaliana unknown protein (At1g15...   147   6e-42   
gb:OSJN00038_1693705 Oryza sativa genomic DNA, chromosome 4, BAC...   132   5e-35   
gb:AP005286_1849872 Oryza sativa (japonica cultivar-group) genom...   128   1e-33   
gb:AF506028_1806837 Poncirus trifoliata citrus tristeza virus re...   123   5e-28   
gb:BX908798_831388 Parachlamydia-related symbiont UWE25, complet...    37   0.73    
gb:BX294155_771841 Pirellula sp. strain 1 complete genome; segme...    35   1.6     
gb:AE017180_401277 Geobacter sulfurreducens PCA, complete genome.      35   2.8     
gb:BX908798_830548 Parachlamydia-related symbiont UWE25, complet...    34   3.6     
gb:BX908798_830299 Parachlamydia-related symbiont UWE25, complet...    34   3.6     
gb:BX908798_830588 Parachlamydia-related symbiont UWE25, complet...    34   4.7     


>gb:AF360339_1791285 Arabidopsis thaliana unknown protein
           (At1g15740) mRNA, complete cds.
          Length = 585

 Score =  147 bits (371), Expect(2) = 6e-42
 Identities = 79/148 (53%), Positives = 93/148 (62%)
 Frame = -2

Query: 830 DARQITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKN 651
           DAR +TD           L HLDLFGARITDSGTN+L++ K L+SLEICGGGLTD GVKN
Sbjct: 438 DARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQSLEICGGGLTDTGVKN 497

Query: 650 IKDXXXXXXXXXXXXXXXTDKSLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXX 471
           IKD               TDK+LE ISGLT         SR++S+G              
Sbjct: 498 IKDLSSLTLLNLSQNSNLTDKTLELISGLTGLVSLNVSNSRVSSSGLRHLKPLKNLRSLT 557

Query: 470 LESCKVTANDIKKLQSTDLPNLVNYRPE 387
           LESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct: 558 LESCKLSANDIRKLQATDLPNLVNFRPE 585



 Score = 47.0 bits (110), Expect(2) = 6e-42
 Identities = 21/28 (75%), Positives = 27/28 (96%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGV 856
           L+GLS+LES+NLSFTV+TD+GLRKL G+
Sbjct: 402 LSGLSNLESINLSFTVVTDSGLRKLSGL 429



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 29/124 (23%), Positives = 46/124 (37%), Gaps = 6/124 (4%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDK 588
           L+L   RI D G  +L     L+SLE+    +   G++++                 TD 
Sbjct: 363 LNLDSCRIGDEGLVHLSGMLELKSLELSDTEVGSNGLRHL-SGLSNLESINLSFTVVTDS 421

Query: 587 SLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXXLESCKVT------ANDIKKLQ 426
            L  +SGLT           +T AG              L   ++T        ++KKLQ
Sbjct: 422 GLRKLSGLTSLRTLNLDARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQ 481

Query: 425 STDL 414
           S ++
Sbjct: 482 SLEI 485



>gb:AY142631_1583047 Arabidopsis thaliana unknown protein
           (At1g15740) mRNA, complete cds.
          Length = 585

 Score =  147 bits (371), Expect(2) = 6e-42
 Identities = 79/148 (53%), Positives = 93/148 (62%)
 Frame = -2

Query: 830 DARQITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKN 651
           DAR +TD           L HLDLFGARITDSGTN+L++ K L+SLEICGGGLTD GVKN
Sbjct: 438 DARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQSLEICGGGLTDTGVKN 497

Query: 650 IKDXXXXXXXXXXXXXXXTDKSLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXX 471
           IKD               TDK+LE ISGLT         SR++S+G              
Sbjct: 498 IKDLSSLTLLNLSQNSNLTDKTLELISGLTGLVSLNVSNSRVSSSGLRHLKPLKNLRSLT 557

Query: 470 LESCKVTANDIKKLQSTDLPNLVNYRPE 387
           LESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct: 558 LESCKLSANDIRKLQATDLPNLVNFRPE 585



 Score = 47.0 bits (110), Expect(2) = 6e-42
 Identities = 21/28 (75%), Positives = 27/28 (96%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGV 856
           L+GLS+LES+NLSFTV+TD+GLRKL G+
Sbjct: 402 LSGLSNLESINLSFTVVTDSGLRKLSGL 429



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 29/124 (23%), Positives = 46/124 (37%), Gaps = 6/124 (4%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDK 588
           L+L   RI D G  +L     L+SLE+    +   G++++                 TD 
Sbjct: 363 LNLDSCRIGDEGLVHLSGMLELKSLELSDTEVGSNGLRHL-SGLSNLESINLSFTVVTDS 421

Query: 587 SLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXXLESCKVT------ANDIKKLQ 426
            L  +SGLT           +T AG              L   ++T        ++KKLQ
Sbjct: 422 GLRKLSGLTSLRTLNLDARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQ 481

Query: 425 STDL 414
           S ++
Sbjct: 482 SLEI 485



>pir|F86291|F86291 hypothetical protein F7H2.8 [imported] -
           Arabidopsis thaliana>gb:AE005172_890562 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F7H2_1678572 Sequence of BAC F7H2 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 568

 Score =  147 bits (371), Expect(2) = 6e-42
 Identities = 79/148 (53%), Positives = 93/148 (62%)
 Frame = -2

Query: 830 DARQITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKN 651
           DAR +TD           L HLDLFGARITDSGTN+L++ K L+SLEICGGGLTD GVKN
Sbjct: 421 DARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQSLEICGGGLTDTGVKN 480

Query: 650 IKDXXXXXXXXXXXXXXXTDKSLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXX 471
           IKD               TDK+LE ISGLT         SR++S+G              
Sbjct: 481 IKDLSSLTLLNLSQNSNLTDKTLELISGLTGLVSLNVSNSRVSSSGLRHLKPLKNLRSLT 540

Query: 470 LESCKVTANDIKKLQSTDLPNLVNYRPE 387
           LESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct: 541 LESCKLSANDIRKLQATDLPNLVNFRPE 568



 Score = 47.0 bits (110), Expect(2) = 6e-42
 Identities = 21/28 (75%), Positives = 27/28 (96%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGV 856
           L+GLS+LES+NLSFTV+TD+GLRKL G+
Sbjct: 385 LSGLSNLESINLSFTVVTDSGLRKLSGL 412



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 29/124 (23%), Positives = 46/124 (37%), Gaps = 6/124 (4%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDK 588
           L+L   RI D G  +L     L+SLE+    +   G++++                 TD 
Sbjct: 346 LNLDSCRIGDEGLVHLSGMLELKSLELSDTEVGSNGLRHL-SGLSNLESINLSFTVVTDS 404

Query: 587 SLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXXLESCKVT------ANDIKKLQ 426
            L  +SGLT           +T AG              L   ++T        ++KKLQ
Sbjct: 405 GLRKLSGLTSLRTLNLDARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQ 464

Query: 425 STDL 414
           S ++
Sbjct: 465 SLEI 468



>gb:AY081507_1568767 Arabidopsis thaliana unknown protein
           (At1g15740) mRNA, complete cds.>gb:AF386991_1794796
           Arabidopsis thaliana Unknown protein (F7H2.8) mRNA,
           complete cds.
          Length = 332

 Score =  147 bits (371), Expect(2) = 6e-42
 Identities = 79/148 (53%), Positives = 93/148 (62%)
 Frame = -2

Query: 830 DARQITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKN 651
           DAR +TD           L HLDLFGARITDSGTN+L++ K L+SLEICGGGLTD GVKN
Sbjct: 185 DARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQSLEICGGGLTDTGVKN 244

Query: 650 IKDXXXXXXXXXXXXXXXTDKSLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXX 471
           IKD               TDK+LE ISGLT         SR++S+G              
Sbjct: 245 IKDLSSLTLLNLSQNSNLTDKTLELISGLTGLVSLNVSNSRVSSSGLRHLKPLKNLRSLT 304

Query: 470 LESCKVTANDIKKLQSTDLPNLVNYRPE 387
           LESCK++ANDI+KLQ+TDLPNLVN+RPE
Sbjct: 305 LESCKLSANDIRKLQATDLPNLVNFRPE 332



 Score = 47.0 bits (110), Expect(2) = 6e-42
 Identities = 21/28 (75%), Positives = 27/28 (96%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGV 856
           L+GLS+LES+NLSFTV+TD+GLRKL G+
Sbjct: 149 LSGLSNLESINLSFTVVTDSGLRKLSGL 176



 Score = 33.1 bits (74), Expect = 8.0
 Identities = 29/124 (23%), Positives = 46/124 (37%), Gaps = 6/124 (4%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDK 588
           L+L   RI D G  +L     L+SLE+    +   G++++                 TD 
Sbjct: 110 LNLDSCRIGDEGLVHLSGMLELKSLELSDTEVGSNGLRHL-SGLSNLESINLSFTVVTDS 168

Query: 587 SLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXXLESCKVT------ANDIKKLQ 426
            L  +SGLT           +T AG              L   ++T        ++KKLQ
Sbjct: 169 GLRKLSGLTSLRTLNLDARHVTDAGLSALTSLTGLTHLDLFGARITDSGTNHLRNLKKLQ 228

Query: 425 STDL 414
           S ++
Sbjct: 229 SLEI 232



>gb:OSJN00038_1693705 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0014K14, complete sequence.
          Length = 581

 Score =  132 bits (331), Expect(2) = 5e-35
 Identities = 77/148 (52%), Positives = 88/148 (59%)
 Frame = -2

Query: 830 DARQITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKN 651
           D RQITD           L HLDLFGARITD+GTN LK+FKNL+SLE+CGG +TDAGVKN
Sbjct: 434 DNRQITDNGLAALTCLTGLTHLDLFGARITDAGTNCLKYFKNLQSLEVCGGLITDAGVKN 493

Query: 650 IKDXXXXXXXXXXXXXXXTDKSLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXX 471
           IKD               TDKSLE IS LT         SR++++G              
Sbjct: 494 IKDLKALTLLNLSQNGNLTDKSLELISRLTALVSLNVSNSRVSNSGLHHLKPLQNLRSLS 553

Query: 470 LESCKVTANDIKKLQSTDLPNLVNYRPE 387
           LESCKVTA +IKKLQ   LPNLV+ RPE
Sbjct: 554 LESCKVTAIEIKKLQLAALPNLVSVRPE 581



 Score = 39.3 bits (90), Expect(2) = 5e-35
 Identities = 16/28 (57%), Positives = 25/28 (89%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGV 856
           L+GL +L+S+NLSFT++TD GL+K+ G+
Sbjct: 398 LSGLRNLQSINLSFTLVTDIGLKKISGL 425



 Score = 31.2 bits (69), Expect(2) = 1.6
 Identities = 23/85 (27%), Positives = 36/85 (42%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDK 588
           L+L    +  +G  +L   +NL+S+ +    +TD G+K I                 TD 
Sbjct: 383 LELSDTEVGSNGLRHLSGLRNLQSINLSFTLVTDIGLKKI-SGLNSLRSLNLDNRQITDN 441

Query: 587 SLEAISGLTXXXXXXXXXSRITSAG 513
            L A++ LT         +RIT AG
Sbjct: 442 GLAALTCLTGLTHLDLFGARITDAG 466



 Score = 27.7 bits (60), Expect(2) = 9.4
 Identities = 23/85 (27%), Positives = 34/85 (40%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDK 588
           L+L   +I D G  +LK    LRSLE+    +   G++++                 TD 
Sbjct: 359 LNLDSCKIGDEGLAHLKGLLKLRSLELSDTEVGSNGLRHL-SGLRNLQSINLSFTLVTDI 417

Query: 587 SLEAISGLTXXXXXXXXXSRITSAG 513
            L+ ISGL           +IT  G
Sbjct: 418 GLKKISGLNSLRSLNLDNRQITDNG 442



 Score = 23.9 bits (50), Expect(2) = 9.4
 Identities = 13/37 (35%), Positives = 20/37 (54%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGVVITEIT*FG 829
           ++GL+ L  LNLS   + D G   L G+V  ++   G
Sbjct: 302 ISGLASLVLLNLSRCGVYDEGCEHLEGLVKLKVLNLG 338



 Score = 23.1 bits (48), Expect(2) = 1.6
 Identities = 13/29 (44%), Positives = 16/29 (55%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGVV 853
           L  L +LE LNL    I D GL  L G++
Sbjct: 350 LKELINLECLNLDSCKIGDEGLAHLKGLL 378



>gb:AP005286_1849872 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1004_A05.
          Length = 582

 Score =  128 bits (321), Expect(2) = 1e-33
 Identities = 70/148 (47%), Positives = 87/148 (58%)
 Frame = -2

Query: 830 DARQITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKN 651
           D RQITD           L HLDLFGARITD GT+  + FKNL SLE+CGG +TDAGVKN
Sbjct: 435 DNRQITDVGLAALTSLTGLTHLDLFGARITDYGTSCFRFFKNLESLEVCGGLITDAGVKN 494

Query: 650 IKDXXXXXXXXXXXXXXXTDKSLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXX 471
           IKD               TDK+LE ISGLT         +R+++AG              
Sbjct: 495 IKDLKALKQLNLSQNVNLTDKTLELISGLTALVSLNVSNTRVSNAGLRHLKDLQNLRSLS 554

Query: 470 LESCKVTANDIKKLQSTDLPNLVNYRPE 387
           L+SC+VT +++KKLQ+T LPNL++ RPE
Sbjct: 555 LDSCRVTTSEVKKLQATVLPNLISVRPE 582



 Score = 38.5 bits (88), Expect(2) = 1e-33
 Identities = 15/28 (53%), Positives = 24/28 (85%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGV 856
           L+GL +LES+NLSFT++TD G++K+  +
Sbjct: 399 LSGLRNLESINLSFTLVTDTGMKKISAL 426



 Score = 30.8 bits (68), Expect(2) = 0.58
 Identities = 23/85 (27%), Positives = 34/85 (40%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDK 588
           L+L    +  SG  +L   +NL S+ +    +TD G+K I                 TD 
Sbjct: 384 LELSDTEVGSSGLQHLSGLRNLESINLSFTLVTDTGMKKI-SALNSLKSVNLDNRQITDV 442

Query: 587 SLEAISGLTXXXXXXXXXSRITSAG 513
            L A++ LT         +RIT  G
Sbjct: 443 GLAALTSLTGLTHLDLFGARITDYG 467



 Score = 25.0 bits (53), Expect(2) = 0.58
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 939 LAGLSHLESLNLSFTVITDNGLRKLXGVVI 850
           L  L +LESLNL    + D GL  L G+++
Sbjct: 351 LKELINLESLNLDSCKVGDEGLLHLRGLML 380



>gb:AF506028_1806837 Poncirus trifoliata citrus tristeza virus
           resistance gene locus, complete sequence.
          Length = 205

 Score =  123 bits (308), Expect(2) = 5e-28
 Identities = 78/142 (54%), Positives = 84/142 (59%)
 Frame = -2

Query: 830 DARQITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKN 651
           DARQITD             HLDLFGARITDSG  YL++FKNLRSLEICGGGLTDAGVK+
Sbjct: 78  DARQITDTGLAALTSA----HLDLFGARITDSGAAYLRNFKNLRSLEICGGGLTDAGVKH 133

Query: 650 IKDXXXXXXXXXXXXXXXTDKSLEAISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXX 471
           IKD               TDK+LE +S            SRITSAG              
Sbjct: 134 IKDLSSLALLNLSQNCNLTDKTLEYVSN-----------SRITSAG----------LRHP 172

Query: 470 LESCKVTANDIKKLQSTDLPNL 405
           LESCKVTANDIK+LQS DLPNL
Sbjct: 173 LESCKVTANDIKRLQSRDLPNL 194



 Score = 24.6 bits (52), Expect(2) = 5e-28
 Identities = 11/17 (64%), Positives = 13/17 (76%)
 Frame = -1

Query: 906 LSFTVITDNGLRKLXGV 856
           LSFT I+D  LRKL G+
Sbjct: 53  LSFTGISDGSLRKLAGL 69



>gb:BX908798_831388 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 456

 Score = 36.6 bits (83), Expect = 0.73
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = -2

Query: 815 TDXXXXXXXXXXXLMHLDLFGA-RITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIK 645
           TD           L HLDL G  R+TD+G  +L     L+ L + G  LTDAG+ ++K
Sbjct: 262 TDAGLAHLTPLTALQHLDLTGCFRVTDTGLAHLSPLVALQHLNLIGCDLTDAGLVHLK 319



>gb:BX294155_771841 Pirellula sp. strain 1 complete genome; segment
           23/24.
          Length = 513

 Score = 35.4 bits (80), Expect = 1.6
 Identities = 29/117 (24%), Positives = 44/117 (37%)
 Frame = -2

Query: 755 GARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIKDXXXXXXXXXXXXXXXTDKSLEA 576
           G  I D+G   LK   NL+ L +    +TD  +K + +               TD+ LE 
Sbjct: 175 GPGIDDAGMENLKSLANLKRLTLADTAITDQTLKTVGE-MTSLDALFLRRTGVTDEGLEL 233

Query: 575 ISGLTXXXXXXXXXSRITSAGXXXXXXXXXXXXXXLESCKVTANDIKKLQSTDLPNL 405
           ++GL+         + I  AG              LE  KVT   + KL    L ++
Sbjct: 234 LTGLSKLRAIDLRNTNIGDAGMDSLAKIKTLIDVKLEKSKVTDEGLVKLAPLPLKSI 290



>gb:AE017180_401277 Geobacter sulfurreducens PCA, complete genome.
          Length = 456

 Score = 34.7 bits (78), Expect = 2.8
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = -2

Query: 767 LDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIK 645
           L L+   +TD+G   L+H   LRS+ +C   +T+ G+  +K
Sbjct: 399 LYLYDTSVTDAGLMALRHLPRLRSVTLCNAPVTEHGIDRLK 439



>gb:BX908798_830548 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 583

 Score = 34.3 bits (77), Expect = 3.6
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = -2

Query: 815 TDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICG-GGLTDAGVKNIK 645
           TD           L HLDL G  +TD+G  +L     L+ L++ G   LTDAG+ +++
Sbjct: 339 TDAGLAHLTPLTALQHLDLRGCYLTDAGLAHLTPLTGLQHLDLIGCKDLTDAGLAHLR 396



>gb:BX908798_830299 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 765

 Score = 34.3 bits (77), Expect = 3.6
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
 Frame = -2

Query: 815 TDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEIC-GGGLTDAGVKNIK 645
           TD           L HLDL G  +TD G  +LK    L+ L +   G LTD G+ ++K
Sbjct: 496 TDAGLAHLTSLAALKHLDLIGCELTDDGLAHLKLLVALQHLNLSYCGKLTDDGLAHLK 553



>gb:BX908798_830588 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 734

 Score = 33.9 bits (76), Expect = 4.7
 Identities = 18/59 (30%), Positives = 30/59 (50%)
 Frame = -2

Query: 821 QITDXXXXXXXXXXXLMHLDLFGARITDSGTNYLKHFKNLRSLEICGGGLTDAGVKNIK 645
           ++TD           L +LDL    ITD+G  +L H   L+ L++ G  +TD G++  +
Sbjct: 660 KLTDDGLAHLKPLAALQYLDLSYCEITDAGLAHLTHLMALQRLDLYGREITDDGLERFE 718


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 939,225,593
Number of Sequences: 1806583
Number of extensions: 18448007
Number of successful extensions: 41075
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 39837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41030
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 67285516404
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)