BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11816
         (1743 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:ATAC002343_1542784 Arabidopsis thaliana chromosome IV BAC T19...   142   3e-32   
sp|Q9XED8|ARFI_ARATH|ARFI_ARATH Auxin response factor 9.>pir|T08917|T08917 ...   142   3e-32   Arabidopsis thaliana [mouse-ear cress]
pir|A84904|A84904 hypothetical protein At2g46530 [imported] - Ar...   139   2e-31   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZPY6|ARFK_ARATH|ARFK_ARATH Auxin response factor 11.                        139   2e-31   Arabidopsis thaliana [mouse-ear cress]
pir|T47975|T47975 auxin response factor-like protein - Arabidops...   135   3e-30   Arabidopsis thaliana [mouse-ear cress]
sp|Q9C5W9|ARFR_ARATH|ARFR_ARATH Auxin response factor 18.>gb:AY059746_15646...   135   3e-30   Arabidopsis thaliana [mouse-ear cress]
sp|O49347|PSBY_ARATH|PSBY_ARATH Photosystem II core complex proteins psbY, ...   132   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AY087742_1572770 Arabidopsis thaliana clone 3813 mRNA, comple...   130   9e-29   
gb:AP004332_1840350 Oryza sativa (japonica cultivar-group) genom...   129   2e-28   
gb:AB071293_1522751 Oryza sativa OsARF2 mRNA for auxin response ...   129   2e-28   
gb:AP005808_1858215 Oryza sativa (japonica cultivar-group) genom...   127   6e-28   
gb:OSJN00175_1696211 Oryza sativa genomic DNA, chromosome 4, BAC...   127   7e-28   
gb:AY133723_1581543 Arabidopsis thaliana auxin response factor 1...   125   3e-27   
sp|Q8L7G0|ARFA_ARATH|ARFA_ARATH Auxin response factor 1.>pir|D96621|D96621 ...   125   3e-27   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LQE8|ARFN_ARATH|ARFN_ARATH Putative auxin response factor 14.               121   5e-26   Arabidopsis thaliana [mouse-ear cress]
gb:AY255705_1593126 Mangifera indica auxin response factor-like ...   120   9e-26   
gb:AC023913_1539252 Arabidopsis thaliana chromosome 1 BAC F7P12 ...   120   1e-25   
sp|Q9C8N9|ARFU_ARATH|ARFU_ARATH Putative auxin response factor 21.               120   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AY669795_1620760 Arabidopsis thaliana clone C00610 ARF20 (At1...   119   2e-25   
pir|D86473|D86473 69.8K hypothetical protein - Arabidopsis thali...   119   2e-25   Arabidopsis thaliana [mouse-ear cress]
sp|Q9C7I9|ARFT_ARATH|ARFT_ARATH Putative auxin response factor 20.               119   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AJ716227_1813767 Brassica napus mRNA for putative auxin respo...   119   3e-25   
pir|H86465|H86465 F12G12.1 protein - Arabidopsis thaliana>gb:AE0...   117   1e-24   Arabidopsis thaliana [mouse-ear cress]
sp|Q9FX25|ARFM_ARATH|ARFM_ARATH Putative auxin response factor 13.               117   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AF336918_1787610 Arabidopsis thaliana ARF2 (MTG10.3) mRNA, pa...   115   2e-24   
gb:ATH441313_1552603 Arabidopsis thaliana mRNA for putative auxi...   115   2e-24   
sp|Q94JM3|ARFB_ARATH|ARFB_ARATH Auxin response factor 2 (ARF1-binding prote...   115   2e-24   Arabidopsis thaliana [mouse-ear cress]
pir|C86467|C86467 hypothetical protein F23M19.4 - Arabidopsis th...   114   6e-24   Arabidopsis thaliana [mouse-ear cress]
sp|Q9XID4|ARFL_ARATH|ARFL_ARATH Putative auxin response factor 12.>gb:AY669...   114   6e-24   Arabidopsis thaliana [mouse-ear cress]
sp|P80470|PSBY_SPIOL|PSBY_SPIOL Photosystem II core complex proteins psbY, ...   110   7e-23   Spinacia oleracea
sp|Q9LQE3|ARFO_ARATH|ARFO_ARATH Putative auxin response factor 15.               110   9e-23   Arabidopsis thaliana [mouse-ear cress]
pir|C86468|C86468 probable auxin response factor, 53188-50111 [i...   109   2e-22   Arabidopsis thaliana [mouse-ear cress]
sp|Q9C8N7|ARFV_ARATH|ARFV_ARATH Putative auxin response factor 22.>gb:AY669...   109   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AF140228_1771529 Oryza sativa (indica cultivar-group) putativ...   108   3e-22   
pir|E86468|E86468 protein F12K21.26 [imported] - Arabidopsis tha...   107   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb:OSA306306_1692454 Oryza sativa subsp. japonica mRNA for auxin...   106   1e-21   
gb:AP003925_1835364 Oryza sativa (japonica cultivar-group) genom...   104   5e-21   
pir|G86476|G86476 protein F15O4.37 [imported] - Arabidopsis thal...   104   7e-21   Arabidopsis thaliana [mouse-ear cress]
sp|Q9ZTX9|ARFD_ARATH|ARFD_ARATH Auxin response factor 4.>gb:AB011483_151149...   103   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP001539_1821284 Oryza sativa (japonica cultivar-group) genom...   100   1e-19   
gb:AB071300_1522758 Oryza sativa OsARF16 mRNA for auxin response...   100   1e-19   
gb:OSJN00292_1698072 Oryza sativa genomic DNA, chromosome 4, BAC...    97   1e-18   
gb:AB112675_1527193 Cucumis sativus CsARF5 mRNA for auxin respon...    96   2e-18   
gb:AB112671_1527189 Cucumis sativus CsARF1 mRNA for auxin respon...    84   7e-15   
gb:U79557_1726470 Arabidopsis thaliana IAA24 (IAA24) mRNA, parti...    82   4e-14   
sp|P93024|ARFE_ARATH|ARFE_ARATH Auxin response factor 5 (Transcription fact...    82   4e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AF467900_1802448 Prunus persica clone pPn31C7 hypothetical pr...    82   5e-14   
gb:ATH441312_1552602 Arabidopsis thaliana mRNA for early auxin-i...    81   6e-14   
pir|G86325|G86325 hypothetical protein T29M8.9 - Arabidopsis tha...    81   6e-14   Arabidopsis thaliana [mouse-ear cress]
sp|Q8RYC8|ARFS_ARATH|ARFS_ARATH Auxin response factor 19 (Auxin-responsive ...    81   6e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AF186466_1775147 Arabidopsis thaliana non-phototropic hypocot...    80   1e-13   
gb:AF042195_1763624 Arabidopsis thaliana auxin response factor 7...    80   1e-13   
gb:AF022368_1761985 Arabidopsis thaliana BIPOSTO (BIP) mRNA, com...    80   1e-13   
gb:OSJN00127_1695343 Oryza sativa genomic DNA, chromosome 4, BAC...    80   1e-13   
gb:AY080595_1568339 Arabidopsis thaliana unknown protein (At5g20...    80   1e-13   
gb:ATU49077_1557048 Arabidopsis thaliana early auxin-induced (IA...    80   1e-13   
gb:AB071292_1522750 Oryza sativa OsMP mRNA for Arabidopsis Monop...    80   1e-13   
gb:AE005172_892318 Arabidopsis thaliana chromosome 1, top arm co...    80   1e-13   
sp|P93022|ARFG_ARATH|ARFG_ARATH Auxin response factor 7 (Non-phototropic hy...    80   1e-13   Arabidopsis thaliana [mouse-ear cress]
pir|T51807|T51807 transcription factor monopteros [validated] - ...    80   2e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AB112672_1527190 Cucumis sativus CsARF2 mRNA for auxin respon...    78   7e-13   
gb:AY669788_1620753 Arabidopsis thaliana clone C105343 ARF6 (At1...    76   3e-12   
sp|Q9ZTX8|ARFF_ARATH|ARFF_ARATH Auxin response factor 6.>pir|F86427|F86427 ...    76   3e-12   Arabidopsis thaliana [mouse-ear cress]
gb:U79555_1726468 Arabidopsis thaliana IAA23 (IAA23) mRNA, parti...    75   3e-12   
gb:AP003726_1832517 Oryza sativa (japonica cultivar-group) genom...    75   6e-12   
gb:OSJN00095_1694821 Oryza sativa genomic DNA, chromosome 4, BAC...    75   6e-12   
gb:AB071298_1522756 Oryza sativa OsARF8 mRNA for auxin response ...    75   6e-12   
gb:AB071296_1522754 Oryza sativa OsARF7a mRNA for auxin response...    75   6e-12   
gb:AP005294_1850038 Oryza sativa (japonica cultivar-group) genom...    74   1e-11   
gb:AB112673_1527191 Cucumis sativus CsARF3 mRNA for auxin respon...    73   2e-11   
gb:AP004622_1842250 Oryza sativa (japonica cultivar-group) genom...    72   3e-11   
gb:AB071297_1522755 Oryza sativa OsARF7b mRNA for auxin response...    72   3e-11   
gb:AB071295_1522753 Oryza sativa OsARF6b mRNA for auxin response...    72   4e-11   
gb:AY137966_1582218 Mirabilis jalapa clone SM-01 auxin-responsiv...    72   5e-11   
gb:AP003728_1832561 Oryza sativa (japonica cultivar-group) genom...    71   6e-11   
gb:AB112674_1527192 Cucumis sativus CsARF4 mRNA for auxin respon...    70   1e-10   
pir|G86331|G86331 IAA24 [imported] - Arabidopsis thaliana>gb:AE0...    68   5e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AP004093_1837597 Oryza sativa (japonica cultivar-group) genom...    68   7e-10   
gb:U79556_1726469 Arabidopsis thaliana IAA25 (IAA25) mRNA, parti...    66   2e-09   
sp|P49678|IAA2_ARATH|IAA2_ARATH Auxin-responsive protein IAA2 (Indoleacetic...    65   6e-09   Arabidopsis thaliana [mouse-ear cress]
gb:PTR306831_1702725 Populus tremula x Populus tremuloides mRNA ...    63   2e-08   
gb:AB061223_1521995 Physcomitrella patens PpIAA1b mRNA for IAA/A...    63   2e-08   
gb:AB061222_1521994 Physcomitrella patens PpIAA1a mRNA for IAA/A...    63   2e-08   
sp|Q9FGV1|ARFH_ARATH|ARFH_ARATH Auxin response factor 8.>gb:AY669790_162075...    63   2e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AF027157_1762245 Arabidopsis thaliana auxin-responsive protei...    62   3e-08   
sp|Q9M1R4|IAAU_ARATH|IAAU_ARATH Putative auxin-responsive protein IAA30 (Pu...    62   3e-08   Arabidopsis thaliana [mouse-ear cress]
sp|Q9XFM0|IAAS_ARATH|IAAS_ARATH Auxin-responsive protein IAA28 (Indoleaceti...    62   4e-08   Arabidopsis thaliana [mouse-ear cress]
gb:ATU49076_1557047 Arabidopsis thaliana early auxin-induced (IA...    61   6e-08   
gb:AB026823_1517414 Cucumis sativus CsIAA3 mRNA for Aux/IAA prot...    61   6e-08   
sp|O24410|IAAK_ARATH|IAAK_ARATH Auxin-responsive protein IAA20 (Indoleaceti...    61   6e-08   Arabidopsis thaliana [mouse-ear cress]
sp|P33077|IAA4_ARATH|IAA4_ARATH Auxin-responsive protein IAA4 (Indoleacetic...    59   2e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AF123505_1769920 Nicotiana tabacum Nt-iaa2.5 deduced protein ...    59   3e-07   
gb:AF123504_1769919 Nicotiana tabacum Nt-iaa2.3 deduced protein ...    59   4e-07   
gb:OSA437536_1692579 Oryza sativa mRNA for manganese-binding Psb...    59   4e-07   
pir|S12243|S12243 auxin-induced protein AUX2-11 - Arabidopsis th...    57   9e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AY137962_1582214 Mirabilis jalapa clone RS-31 Aux/IAA2 mRNA, ...    57   1e-06   
sp|Q8H174|IAAV_ARATH|IAAV_ARATH Auxin-responsive protein IAA31 (Indoleaceti...    57   1e-06   Arabidopsis thaliana [mouse-ear cress]
gb:BT000543_1634821 Arabidopsis thaliana putative auxin-induced ...    56   2e-06   
gb:AB026821_1517412 Cucumis sativus CsIAA1 mRNA for Aux/IAA prot...    56   2e-06   
gb:AB024026_1515710 Arabidopsis thaliana genomic DNA, chromosome...    56   2e-06   
sp|O24542|AX2D_PHAAU|AX2D_PHAAU Auxin-induced protein 22D (Indole-3-acetic ...    56   2e-06   Vigna radiata var. radiata [golden gram]
gb:AY062215_1565008 Antirrhinum majus auxin-induced AUX/IAA1 mRN...    56   3e-06   
gb:AB023482_1515593 Oryza sativa (japonica cultivar-group) genom...    56   3e-06   
sp|P13088|AX22_SOYBN|AX22_SOYBN Auxin-induced protein AUX22.>pir|B28993|B28...    56   3e-06   Glycine max [soybeans]
gb:AY088042_1573066 Arabidopsis thaliana clone 40608 mRNA, compl...    55   4e-06   
sp|Q38830|IAAC_ARATH|IAAC_ARATH Auxin-responsive protein IAA12 (Indoleaceti...    55   4e-06   Arabidopsis thaliana [mouse-ear cress]
sp|P49679|IAA4_PEA|IAA4_PEA Auxin-induced protein IAA4.>pir|S39075|S39075...    55   4e-06   Pisum sativum [garden pea]
gb:AP005681_1855911 Oryza sativa (japonica cultivar-group) genom...    55   5e-06   
gb:AC145396_1744454 Oryza sativa (japonica cultivar-group) chrom...    55   5e-06   
pir|S58499|S58499 auxin regulated protein (IAA13) [imported] - A...    55   5e-06   Arabidopsis thaliana [mouse-ear cress]
sp|Q38831|IAAD_ARATH|IAAD_ARATH Auxin-responsive protein IAA13 (Indoleaceti...    55   5e-06   Arabidopsis thaliana [mouse-ear cress]
sp|O24543|AX2E_PHAAU|AX2E_PHAAU Auxin-induced protein 22E (Indole-3-acetic ...    55   5e-06   Vigna radiata var. radiata [golden gram]
gb:T1N24_1723668 Arabidopsis thaliana BAC T1N24.                       55   6e-06   
sp|P32294|AX2B_PHAAU|AX2B_PHAAU Auxin-induced protein 22B (Indole-3-acetic ...    55   6e-06   Vigna radiata var. radiata [golden gram]
gb:AY099670_1576695 Arabidopsis thaliana early auxin-inducible p...    54   8e-06   
sp|Q38829|IAAB_ARATH|IAAB_ARATH Auxin-responsive protein IAA11 (Indoleaceti...    54   8e-06   Arabidopsis thaliana [mouse-ear cress]
sp|Q38822|IAA3_ARATH|IAA3_ARATH Auxin-responsive protein IAA3 (Indoleacetic...    54   8e-06   Arabidopsis thaliana [mouse-ear cress]
sp|O24541|AX2C_PHAAU|AX2C_PHAAU Auxin-induced protein 22C (Indole-3-acetic ...    54   1e-05   Vigna radiata var. radiata [golden gram]
gb:AX365265_1466305 Sequence 1 from Patent WO0206499.                  54   1e-05   
sp|Q9ZSY8|IAAR_ARATH|IAAR_ARATH Auxin-responsive protein IAA27 (Indoleaceti...    54   1e-05   Arabidopsis thaliana [mouse-ear cress]
sp|P32293|AX2A_PHAAU|AX2A_PHAAU Auxin-induced protein 22A (Indole-3-acetic ...    54   1e-05   Vigna radiata var. radiata [golden gram]
gb:AP002743_1822682 Oryza sativa (japonica cultivar-group) genom...    53   2e-05   
gb:PTR306826_1702720 Populus tremula x Populus tremuloides mRNA ...    53   2e-05   
gb:AY098938_1576502 Solanum tuberosum Aux/IAA protein mRNA, comp...    52   3e-05   
gb:ATHIAA1A_1553240 Arabidopsis thaliana auxin-responsive protei...    52   3e-05   
gb:AC069158_1540668 Genomic Sequence for Oryza sativa, Nipponbar...    52   3e-05   
sp|P49677|IAA1_ARATH|IAA1_ARATH Auxin-responsive protein IAA1 (Indoleacetic...    52   3e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP001550_1821298 Oryza sativa (japonica cultivar-group) genom...    52   4e-05   
gb:AF123507_1769922 Nicotiana tabacum Nt-iaa4.5 deduced protein ...    52   4e-05   
gb:AF088281_1767266 Arabidopsis thaliana phytochrome-associated ...    52   4e-05   
gb:AY337616_1600425 Gossypium barbadense Gbiaa-Re (iaa-re) mRNA,...    52   4e-05   
gb:AY088753_1573766 Arabidopsis thaliana clone 94231 mRNA, compl...    52   4e-05   
gb:AY087745_1572773 Arabidopsis thaliana clone 38146 mRNA, compl...    52   4e-05   
gb:AY082522_1569184 Vitis vinifera Aux/IAA protein mRNA, complet...    52   4e-05   
sp|Q8LAL2|IAAQ_ARATH|IAAQ_ARATH Auxin-responsive protein IAA26 (Indoleaceti...    52   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP003835_1833996 Oryza sativa (japonica cultivar-group) genom...    52   5e-05   
gb:AF123506_1769921 Nicotiana tabacum Nt-iaa4.3 deduced protein ...    52   5e-05   
gb:PSIAA45D_1702189 P.sativum PS-IAA4/5 gene.                          52   5e-05   
gb:PSIAA6R_1702191 P.sativum mRNA for auxin-induced protein (clo...    51   9e-05   
gb:ATU49075_1557046 Arabidopsis thaliana early auxin-induced (IA...    51   9e-05   
sp|O24409|IAAJ_ARATH|IAAJ_ARATH Auxin-responsive protein IAA19 (Indoleaceti...    51   9e-05   Arabidopsis thaliana [mouse-ear cress]
sp|P49680|IAA6_PEA|IAA6_PEA Auxin-induced protein IAA6.>pir|S39078|S39078...    51   9e-05   Pisum sativum [garden pea]
gb:PTR306827_1702721 Populus tremula x Populus tremuloides mRNA ...    50   1e-04   
gb:NTA417876_1691404 Nicotiana tabacum mRNA for IAA9 protein.          50   1e-04   
pir|S12244|S12244 auxin-induced protein AUX2-27 - Arabidopsis th...    50   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AC144740_1744194 Oryza sativa (japonica cultivar-group) chrom...    50   1e-04   
gb:AY088406_1573425 Arabidopsis thaliana clone 6493 mRNA, comple...    50   1e-04   
gb:ATU49074_1557045 Arabidopsis thaliana early auxin-induced (IA...    50   1e-04   
pir|T52144|T52144 auxin-induced protein IAA18 [imported] - Arabi...    50   1e-04   Arabidopsis thaliana [mouse-ear cress]
sp|O24408|IAAI_ARATH|IAAI_ARATH Auxin-responsive protein IAA18 (Indoleaceti...    50   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:ATU18407_1556793 Arabidopsis thaliana IAA5 (IAA5) gene, parti...    49   3e-04   
pir|G86289|G86289 auxin-induced protein AUX2-27 [imported] - Ara...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
pir|S58492|S58492 auxin-induced protein IAA5 - Arabidopsis thaliana    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
sp|Q9C966|IAAF_ARATH|IAAF_ARATH Auxin-responsive protein IAA15 (Indoleaceti...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
sp|P33078|IAA5_ARATH|IAA5_ARATH Auxin-responsive protein IAA5 (Indoleacetic...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP004732_1843950 Oryza sativa (japonica cultivar-group) genom...    49   3e-04   
gb:AF040632_1763404 Arabidopsis thaliana IAA17/AXR3-1 protein (A...    49   3e-04   
gb:GHI458442_1680050 Gossypium hirsutum mRNA for IAA16 protein.        49   3e-04   
gb:AY087284_1572317 Arabidopsis thaliana clone 33613 mRNA, compl...    49   3e-04   
sp|P93830|IAAH_ARATH|IAAH_ARATH Auxin-responsive protein IAA17 (Indoleaceti...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
sp|O24407|IAAG_ARATH|IAAG_ARATH Auxin-responsive protein IAA16 (Indoleaceti...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP004028_1836596 Oryza sativa (japonica cultivar-group) genom...    49   4e-04   
gb:AP004028_1836595 Oryza sativa (japonica cultivar-group) genom...    49   4e-04   
gb:AP003768_1833262 Oryza sativa (japonica cultivar-group) genom...    49   4e-04   
gb:OSA563599_1692714 Oryza sativa (indica cultivar-group) iaa1 g...    49   4e-04   
gb:OSA251791_1692420 Oryza sativa partial mRNA for putative IAA1...    49   4e-04   
gb:AY254569_1593096 Gossypium barbadense auxin responsive protei...    49   4e-04   
gb:PTR306825_1702719 Populus tremula x Populus tremuloides mRNA ...    48   6e-04   
sp|Q93YR9|ARFP_ARATH|ARFP_ARATH Auxin response factor 16.>gb:AY059792_15646...    48   6e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AC145379_1744347 Oryza sativa chromosome 3 BAC OSJNBa0010N03 ...    48   7e-04   
gb:AY085353_1570424 Arabidopsis thaliana clone 147711 mRNA, comp...    48   7e-04   
gb:AC144738_1744170 Oryza sativa (japonica cultivar-group) chrom...    47   0.001   
gb:AB026822_1517413 Cucumis sativus CsIAA2 mRNA for Aux/IAA prot...    47   0.001   
pir|S58493|S58493 auxin-induced protein IAA6 - Arabidopsis thali...    47   0.001   Arabidopsis thaliana [mouse-ear cress]
sp|Q38824|IAA6_ARATH|IAA6_ARATH Auxin-responsive protein IAA6 (Indoleacetic...    47   0.001   Arabidopsis thaliana [mouse-ear cress]
sp|P13089|AX28_SOYBN|AX28_SOYBN Auxin-induced protein AUX28.>pir|A28993|A28...    47   0.001   Glycine max [soybeans]
gb:AY129669_1581148 Mirabilis jalapa auxin-responsive protein IA...    47   0.001   
gb:ATU18416_1556802 Arabidopsis thaliana IAA14 (IAA14) gene, par...    47   0.001   
pir|H71407|H71407 auxin-induced protein - Arabidopsis thaliana         47   0.001   Arabidopsis thaliana [mouse-ear cress]
pir|C85159|C85159 IAA7 like protein [imported] - Arabidopsis tha...    47   0.001   Arabidopsis thaliana [mouse-ear cress]
sp|Q38832|IAAE_ARATH|IAAE_ARATH Auxin-responsive protein IAA14 (Indoleaceti...    47   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:AC093713_1736106 Oryza sativa chromosome 3 BAC OSJNBa0094F01 ...    47   0.002   
gb:PPI315675_1701380 Pinus pinaster mRNA for putative auxin indu...    47   0.002   
gb:AY087765_1572792 Arabidopsis thaliana clone 38286 mRNA, compl...    47   0.002   
sp|Q38825|IAA7_ARATH|IAA7_ARATH Auxin-responsive protein IAA7 (Indoleacetic...    47   0.002   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SKN5|ARFJ_ARATH|ARFJ_ARATH Auxin response factor 10.>pir|G84683|G84683...    47   0.002   Arabidopsis thaliana [mouse-ear cress]
sp|Q38826|IAA8_ARATH|IAA8_ARATH Auxin-responsive protein IAA8 (Indoleacetic...    46   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AP006168_1861222 Oryza sativa (japonica cultivar-group) genom...    46   0.003   
gb:TAE575098_1724464 Triticum aestivum partial mRNA for IAA1 pro...    46   0.003   
gb:AY289601_1594942 Pinus taeda auxin-induced protein 2 (IAA2) m...    46   0.003   
gb:AB029148_1518138 Cucumis sativus mRNA expressed in cucumber h...    46   0.003   
gb:AP005394_1851031 Oryza sativa (japonica cultivar-group) genom...    45   0.004   
gb:AP003766_1833221 Oryza sativa (japonica cultivar-group) genom...    45   0.004   
gb:AF016633_1761508 Glycine max GH1 protein (GH1) mRNA, partial ...    45   0.004   
gb:AY289603_1594944 Pinus taeda auxin-induced protein 4 (IAA4) m...    45   0.004   
gb:AB071299_1522757 Oryza sativa OsARF10 mRNA for auxin response...    45   0.004   
pir|T05726|T05726 GH1 protein - soybean (fragment)                     45   0.004   Glycine max [soybeans]
sp|Q38828|IAAA_ARATH|IAAA_ARATH Auxin-responsive protein IAA10 (Indoleaceti...    45   0.004   Arabidopsis thaliana [mouse-ear cress]
gb:AJ843999_1814691 Plantago major mRNA for auxin resistance pro...    45   0.005   
gb:AF373100_1792696 Populus tremula x Populus tremuloides auxin-...    45   0.005   
gb:PTR306829_1702723 Populus tremula x Populus tremuloides mRNA ...    45   0.005   
gb:PTR306828_1702722 Populus tremula x Populus tremuloides mRNA ...    45   0.005   
gb:AP004236_1839117 Oryza sativa (japonica cultivar-group) genom...    45   0.006   
gb:AP002524_1822385 Oryza sativa (japonica cultivar-group) genom...    45   0.006   
gb:AC144735_1744126 Oryza sativa (japonica cultivar-group) chrom...    45   0.006   
gb:AY289602_1594943 Pinus taeda auxin-induced protein 3 (IAA3) m...    45   0.006   
pir|S58501|S58501 auxin-induced protein IAA14 - Arabidopsis thal...    45   0.006   Arabidopsis thaliana [mouse-ear cress]
gb:AP005113_1848076 Oryza sativa (japonica cultivar-group) genom...    44   0.008   
gb:AP003374_1828707 Oryza sativa (japonica cultivar-group) genom...    44   0.008   
gb:AC145379_1744348 Oryza sativa chromosome 3 BAC OSJNBa0010N03 ...    44   0.008   
gb:AY781902_1628331 Saccharum hybrid cultivar isolate c57 auxin-...    44   0.008   
gb:AY054137_1562959 Arabidopsis thaliana AT4g32280/F10M6_80 mRNA...    44   0.011   
gb:AB010075_1510979 Arabidopsis thaliana genomic DNA, chromosome...    44   0.011   
sp|Q93WC4|IAAT_ARATH|IAAT_ARATH Auxin-responsive protein IAA29 (Indoleaceti...    44   0.011   Arabidopsis thaliana [mouse-ear cress]
gb:AC096855_1736355 Oryza sativa chromosome 3 BAC OJ1365_D05 gen...    44   0.014   
gb:AY289604_1594945 Pinus taeda auxin-induced protein 5 (IAA5) m...    44   0.014   
gb:AY090553_1574159 Zinnia elegans auxin-regulated protein (IAA8...    44   0.014   
gb:AY087089_1572125 Arabidopsis thaliana clone 31563 mRNA, compl...    44   0.014   
sp|Q38827|IAA9_ARATH|IAA9_ARATH Auxin-responsive protein IAA9 (Indoleacetic...    44   0.014   Arabidopsis thaliana [mouse-ear cress]
gb:PTR306830_1702724 Populus tremula x Populus tremuloides mRNA ...    43   0.018   
sp|Q9C5X0|IAAY_ARATH|IAAY_ARATH Auxin-responsive protein IAA34 (Indoleaceti...    43   0.018   Arabidopsis thaliana [mouse-ear cress]
gb:AF099735_1768078 Arabidopsis thaliana auxin response factor 1...    43   0.024   
gb:AY289600_1594941 Pinus taeda auxin-induced protein 1 (IAA1) m...    43   0.024   
gb:AF123509_1769924 Nicotiana tabacum Nt-iaa4.1 deduced protein ...    42   0.053   
gb:AP004784_1845015 Oryza sativa (japonica cultivar-group) genom...    41   0.090   
gb:AF123508_1769923 Nicotiana tabacum Nt-iaa28 deduced protein m...    41   0.090   
sp|Q8RYC6|IAAW_ARATH|IAAW_ARATH Auxin-responsive protein IAA32 (Indoleaceti...    40   0.15    Arabidopsis thaliana [mouse-ear cress]
gb:AF022022_1761759 Lycopersicon esculentum auxin-regulated IAA1...    39   0.44    
pir|T05712|T05712 auxin-induced protein IAA11 - tomato (fragment)      39   0.44    Solanum lycopersicum
gb:AF169830_1774231 Glycine max auxin-induced protein ali50 mRNA...    38   0.76    
pir|T05400|T05400 hypothetical protein F10M6.80 - Arabidopsis th...    37   0.99    Arabidopsis thaliana [mouse-ear cress]
sp|P40600|LIPE_AERHY|LIPE_AERHY Extracellular lipase precursor (EC 3.1.1.3)...    37   1.7     Aeromonas hydrophila
gb:AC133930_1741615 Oryza sativa chromosome 3 BAC OSJNBa0039O18 ...    36   2.2     
gb:AY137961_1582213 Mirabilis jalapa clone SM-36 Aux/IAA1 mRNA, ...    36   2.2     
gb:AF443092_2256675 HIV-1 isolate 00BW1616.2 from Botswana, comp...    36   2.9     
gb:AF391268_2246953 HIV-1 clone TV018G60 from South Africa gag p...    36   2.9     
gb:AF443099_2256738 HIV-1 isolate 00BW1859.5 from Botswana, comp...    35   3.8     
gb:HIM306159_2412019 Human immunodeficiency virus type 1 provira...    35   4.9     
gb:AF022012_1761749 Lycopersicon esculentum auxin-regulated IAA1...    35   4.9     
pir|B86284|B86284 T15D22.10 protein - Arabidopsis thaliana>gb:AE...    35   4.9     Arabidopsis thaliana [mouse-ear cress]
pir|T04345|T04345 auxin-induced protein IAA1 - tomato (fragment)       35   4.9     Solanum lycopersicum
gb:AE016815_1746261 Ashbya gossypii (= Eremothecium gossypii) AT...    35   6.4     
gb:HIM306153_2412013 Human immunodeficiency virus type 1 provira...    34   8.4     
gb:AF423760_2253866 HIV-1 isolate X558 from Spain, complete genome.    34   8.4     
gb:AF169204_1774204 Capsicum annuum differentially expressed osm...    34   8.4     
gb:AF022013_1761750 Lycopersicon esculentum auxin-regulated IAA2...    34   8.4     
gb:AB051384_1521105 Cucumis sativus mRNA, putative member of Aux...    34   8.4     
pir|T04350|T04350 auxin-induced protein IAA2 - tomato (fragment)       34   8.4     Solanum lycopersicum


>gb:ATAC002343_1542784 Arabidopsis thaliana chromosome IV BAC T19F6
           genomic sequence, complete sequence.
          Length = 497

 Score =  142 bits (357), Expect = 3e-32
 Identities = 74/139 (53%), Positives = 101/139 (72%), Gaps = 2/139 (1%)
 Frame = +1

Query: 112 KSEHLKSSREIKL--VEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDL 285
           KSE  K S E K    E S K+  SK S +T R+ TKVQM+G   GRAVDL  +K Y++L
Sbjct: 351 KSEISKVSEEKKQEPAEGSPKEVQSKQSSST-RSRTKVQMQGVPVGRAVDLNALKGYNEL 409

Query: 286 LNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
           ++++E++F++KGEL  R++WE+++ DDEGDMMLVGDDPWPEFC MV+RIFI S E+VKKM
Sbjct: 410 IDDIEKLFDIKGELRSRNQWEIVFTDDEGDMMLVGDDPWPEFCNMVKRIFIWSKEEVKKM 469

Query: 466 SSKCKLPLLSDEGEVTIVS 522
           +   +L +L  E E T+ +
Sbjct: 470 TPGNQLRMLLREVETTLTT 488



>sp|Q9XED8|ARFI_ARATH Auxin response factor 9.>pir|T08917|T08917
           auxin response factor 9 - Arabidopsis
           thaliana>gb:ATCHRIV60_1546281 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           60.>gb:ATT32A16_1555887 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T32A16 (ESSA
           project).>gb:AF082176_1766608 Arabidopsis thaliana auxin
           response factor 9 (ARF9) mRNA, complete
           cds.>gb:AF344312_1789748 Arabidopsis thaliana clone
           C00029 (e) auxin response factor 9 (At4g23980) mRNA,
           complete cds.
          Length = 638

 Score =  142 bits (357), Expect = 3e-32
 Identities = 74/139 (53%), Positives = 101/139 (72%), Gaps = 2/139 (1%)
 Frame = +1

Query: 112 KSEHLKSSREIKL--VEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDL 285
           KSE  K S E K    E S K+  SK S +T R+ TKVQM+G   GRAVDL  +K Y++L
Sbjct: 492 KSEISKVSEEKKQEPAEGSPKEVQSKQSSST-RSRTKVQMQGVPVGRAVDLNALKGYNEL 550

Query: 286 LNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
           ++++E++F++KGEL  R++WE+++ DDEGDMMLVGDDPWPEFC MV+RIFI S E+VKKM
Sbjct: 551 IDDIEKLFDIKGELRSRNQWEIVFTDDEGDMMLVGDDPWPEFCNMVKRIFIWSKEEVKKM 610

Query: 466 SSKCKLPLLSDEGEVTIVS 522
           +   +L +L  E E T+ +
Sbjct: 611 TPGNQLRMLLREVETTLTT 629



>pir|A84904|A84904 hypothetical protein At2g46530 [imported] -
           Arabidopsis thaliana>gb:AC006418_1534128 Arabidopsis
           thaliana chromosome 2 clone F13A10 map CIC06C03,
           complete sequence.>gb:AC006526_1534341 Arabidopsis
           thaliana chromosome 2 clone F11C10 map CIC02E07,
           complete sequence.>gb:AY669791_1620756 Arabidopsis
           thaliana clone C105346 ARF11 (At2g46530) mRNA, complete
           cds.
          Length = 622

 Score =  139 bits (350), Expect = 2e-31
 Identities = 75/168 (44%), Positives = 109/168 (64%), Gaps = 1/168 (0%)
 Frame = +1

Query: 43  PCSNTMPSNANAVC-DANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKV 219
           P S T+P +   +  D+N   +  K +   SS   K           +   T++R+  KV
Sbjct: 467 PASATIPHDKQLISVDSNISDSTTKCQDPNSSNSPK----------EQKQQTSTRSRIKV 516

Query: 220 QMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDP 399
           QM+G+  GRAVDLT ++ YD+L+ ELE++FE++GEL P+ KW +++ DDEGD MLVGDDP
Sbjct: 517 QMQGTAVGRAVDLTLLRSYDELIKELEKMFEIEGELSPKDKWAIVFTDDEGDRMLVGDDP 576

Query: 400 WPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSDEGEVTIVSLESELKS 543
           W EFCKM +++FI  S++VKKM SK    LL D+G  TIV+LES+ ++
Sbjct: 577 WNEFCKMAKKLFIYPSDEVKKMRSK---SLLGDKG--TIVNLESDQRT 619



>sp|Q9ZPY6|ARFK_ARATH Auxin response factor 11.
          Length = 601

 Score =  139 bits (350), Expect = 2e-31
 Identities = 75/168 (44%), Positives = 109/168 (64%), Gaps = 1/168 (0%)
 Frame = +1

Query: 43  PCSNTMPSNANAVC-DANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKV 219
           P S T+P +   +  D+N   +  K +   SS   K           +   T++R+  KV
Sbjct: 446 PASATIPHDKQLISVDSNISDSTTKCQDPNSSNSPK----------EQKQQTSTRSRIKV 495

Query: 220 QMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDP 399
           QM+G+  GRAVDLT ++ YD+L+ ELE++FE++GEL P+ KW +++ DDEGD MLVGDDP
Sbjct: 496 QMQGTAVGRAVDLTLLRSYDELIKELEKMFEIEGELSPKDKWAIVFTDDEGDRMLVGDDP 555

Query: 400 WPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSDEGEVTIVSLESELKS 543
           W EFCKM +++FI  S++VKKM SK    LL D+G  TIV+LES+ ++
Sbjct: 556 WNEFCKMAKKLFIYPSDEVKKMRSK---SLLGDKG--TIVNLESDQRT 598



>pir|T47975|T47975 auxin response factor-like protein - Arabidopsis
           thaliana>gb:ATF15G16_1548709 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F15G16.
          Length = 613

 Score =  135 bits (340), Expect = 3e-30
 Identities = 61/96 (63%), Positives = 80/96 (83%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGD 375
           TSR+ TKVQM+G   GRAVDLT +K YD+L++ELEE+FE++G+L  R KW V++ DDEGD
Sbjct: 498 TSRSRTKVQMQGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLARDKWIVVFTDDEGD 557

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
           MML GDDPW EFCKM ++IFI SS++VKKM++K K+
Sbjct: 558 MMLAGDDPWNEFCKMAKKIFIYSSDEVKKMTTKLKI 593



>sp|Q9C5W9|ARFR_ARATH Auxin response factor 18.>gb:AY059746_1564603
           Arabidopsis thaliana auxin response factor ARF18
           (At3g61830) mRNA, complete cds.>gb:AY070463_1566846
           Arabidopsis thaliana AT3g61830/F15G16_220 mRNA, complete
           cds.>gb:AY091392_1574595 Arabidopsis thaliana putative
           auxin response factor protein (At3g61830) mRNA, complete
           cds.>gb:AF334717_1787457 Arabidopsis thaliana auxin
           response factor ARF18 (At3g61830) mRNA, complete cds.
          Length = 602

 Score =  135 bits (340), Expect = 3e-30
 Identities = 61/96 (63%), Positives = 80/96 (83%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGD 375
           TSR+ TKVQM+G   GRAVDLT +K YD+L++ELEE+FE++G+L  R KW V++ DDEGD
Sbjct: 487 TSRSRTKVQMQGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLARDKWIVVFTDDEGD 546

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
           MML GDDPW EFCKM ++IFI SS++VKKM++K K+
Sbjct: 547 MMLAGDDPWNEFCKMAKKIFIYSSDEVKKMTTKLKI 582



>sp|O49347|PSBY_ARATH Photosystem II core complex proteins psbY,
            chloroplast precursor (L- arginine metabolising enzyme)
            (L-AME) [Contains: Photosystem II protein psbY-1
            (psbY-A1); Photosystem II protein psbY-2
            (psbY-A2)].>pir|T51847|T51847 manganese-binding protein
            PsbY precursor, photosystem II-associated [imported] -
            Arabidopsis thaliana>gb:AE005173_894395 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC008113_1536527 Genomic sequence for
            Arabidopsis thaliana BAC F12A21 from chromosome I,
            complete sequence.>gb:ATAJ3306_1543900 Arabidopsis
            thaliana mRNA for PSBY (Ycf32-related chloroplast
            thylakoid membrane proteins).>gb:AY050391_1562169
            Arabidopsis thaliana At1g67740/F12A21_13 mRNA, complete
            cds.>gb:AY052269_1562642 Arabidopsis thaliana
            At1g67740/F12A21_13 mRNA, complete
            cds.>gb:AY097348_1576343 Arabidopsis thaliana
            At1g67740/F12A21_13 mRNA, complete
            cds.>gb:AF079800_1766407 Arabidopsis thaliana PsbY
            precursor (psbY) mRNA, nuclear gene encoding chloroplast
            protein, complete cds.>gb:AF083728_1766958 Arabidopsis
            thaliana clone sps367 unknown mRNA.
          Length = 189

 Score =  132 bits (332), Expect = 2e-29
 Identities = 84/193 (43%), Positives = 101/193 (52%), Gaps = 4/193 (2%)
 Frame = +1

Query: 979  MLNAKSLTTPKASINPVKPKPIISLLSMKNLPKGLSACNTDKSVVSSALTGTALAGAIFS 1158
            M  A +  T   S+NP  PK    L +       +S     K  VS A+T TALAGA+FS
Sbjct: 1    MAAAMATATKCMSLNPSPPK----LQNQTKSKPFISLPTPPKPNVSLAVTSTALAGAVFS 56

Query: 1159 ALSVSEPXXXX---XXXXXXXXDGDNRGXXXXXXXXXXXXWVLFNILQPALNQINKMRST 1329
            +LS SEP                 DNRG            WVL+NILQPA+NQ+NKMR +
Sbjct: 57   SLSYSEPALAIQQIAQLAAANASSDNRGLALLLPIVPAIAWVLYNILQPAINQVNKMRES 116

Query: 1330 KGVIIXXXXXXXTAAQ-FIHPYXXXXXXXXXXXXXXXNDSRGQLLLIVVAPALLWVGYNI 1506
            KG+++        AA   + P                +DSRGQLLLIVV PALLWV YNI
Sbjct: 117  KGIVVGLGIGGGLAASGLLTP--PPEAYAAAEAAAASSDSRGQLLLIVVTPALLWVLYNI 174

Query: 1507 LQPALNQLNKMRS 1545
            LQPALNQ+NKMRS
Sbjct: 175  LQPALNQINKMRS 187



>gb:AY087742_1572770 Arabidopsis thaliana clone 3813 mRNA, complete
            sequence.
          Length = 185

 Score =  130 bits (327), Expect = 9e-29
 Identities = 81/181 (44%), Positives = 97/181 (53%), Gaps = 4/181 (2%)
 Frame = +1

Query: 1015 SINPVKPKPIISLLSMKNLPKGLSACNTDKSVVSSALTGTALAGAIFSALSVSEPXXXX- 1191
            S+NP  PK    L +       +S     K  VS A+T TALAGA+FS+LS SEP     
Sbjct: 9    SLNPSPPK----LQNQTKSKPFISLPTPPKPNVSLAVTSTALAGAVFSSLSYSEPALAIQ 64

Query: 1192 --XXXXXXXXDGDNRGXXXXXXXXXXXXWVLFNILQPALNQINKMRSTKGVIIXXXXXXX 1365
                        DNRG            WVL+NILQPA+NQ+NKMR +KG+++       
Sbjct: 65   QIAQLAAANASSDNRGLALLLPIVPAIAWVLYNILQPAINQVNKMRESKGIVVGLGIGGG 124

Query: 1366 TAAQ-FIHPYXXXXXXXXXXXXXXXNDSRGQLLLIVVAPALLWVGYNILQPALNQLNKMR 1542
             AA   + P                +DSRGQLLLIVV PALLWV YNILQPALNQ+NKMR
Sbjct: 125  LAASGLLTP--PPEAYAAAEAAAASSDSRGQLLLIVVTPALLWVLYNILQPALNQINKMR 182

Query: 1543 S 1545
            S
Sbjct: 183  S 183



>gb:AP004332_1840350 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBa0093F16.
          Length = 808

 Score =  129 bits (324), Expect = 2e-28
 Identities = 67/160 (41%), Positives = 100/160 (62%), Gaps = 3/160 (1%)
 Frame = +1

Query: 37   ETPCS--NTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTC 210
            +TP S     P   + + + +   A   +E+ KS ++    + S KD  SK  V ++R+C
Sbjct: 638  QTPSSLNQLQPVQTDCIPEVSVSTAGTATENEKSGQQ---AQQSSKDVQSKTQVASTRSC 694

Query: 211  TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK-WEVIYADDEGDMMLV 387
            TKV  +G   GR+VDL+   +YD+L  EL+++FE  GEL   +K W+++Y D+EGDMMLV
Sbjct: 695  TKVHKQGVALGRSVDLSKFSNYDELKAELDKMFEFDGELVSSNKNWQIVYTDNEGDMMLV 754

Query: 388  GDDPWPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSDEGE 507
            GDDPW EFC +VR+I+I + E+V+KM+SK   P   D  E
Sbjct: 755  GDDPWEEFCSIVRKIYIYTKEEVQKMNSKSNAPRKDDSSE 794



>gb:AB071293_1522751 Oryza sativa OsARF2 mRNA for auxin response
            factor 2, partial cds.
          Length = 791

 Score =  129 bits (324), Expect = 2e-28
 Identities = 67/160 (41%), Positives = 100/160 (62%), Gaps = 3/160 (1%)
 Frame = +1

Query: 37   ETPCS--NTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTC 210
            +TP S     P   + + + +   A   +E+ KS ++    + S KD  SK  V ++R+C
Sbjct: 621  QTPSSLNQLQPVQTDCIPEVSVSTAGTATENEKSGQQ---AQQSSKDVQSKTQVASTRSC 677

Query: 211  TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK-WEVIYADDEGDMMLV 387
            TKV  +G   GR+VDL+   +YD+L  EL+++FE  GEL   +K W+++Y D+EGDMMLV
Sbjct: 678  TKVHKQGVALGRSVDLSKFSNYDELKAELDKMFEFDGELVSSNKNWQIVYTDNEGDMMLV 737

Query: 388  GDDPWPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSDEGE 507
            GDDPW EFC +VR+I+I + E+V+KM+SK   P   D  E
Sbjct: 738  GDDPWEEFCSIVRKIYIYTKEEVQKMNSKSNAPRKDDSSE 777



>gb:AP005808_1858215 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBb0038F20.
          Length = 678

 Score =  127 bits (320), Expect = 6e-28
 Identities = 69/142 (48%), Positives = 90/142 (63%), Gaps = 1/142 (0%)
 Frame = +1

Query: 76  AVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVD 255
           A  DA      Q S   KS       E S  +T S+      R+CTKV M+G   GRAVD
Sbjct: 510 ASVDAESDQLSQPSHANKSDAPAASSEPSPHETQSRQV----RSCTKVIMQGMAVGRAVD 565

Query: 256 LTTMKDYDDLLNELEEIFELKGELCPR-SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRI 432
           LT +  YDDL  +LEE+F+++GEL     KW+V+Y DDE DMMLVGDDPWPEFC MV+RI
Sbjct: 566 LTRLHGYDDLRCKLEEMFDIQGELSASLKKWKVVYTDDEDDMMLVGDDPWPEFCSMVKRI 625

Query: 433 FICSSEKVKKMSSKCKLPLLSD 498
           +I + E+ K+++ K KLP++ D
Sbjct: 626 YIYTYEEAKQLTPKSKLPIIGD 647



>gb:OSJN00175_1696211 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064D20, complete sequence.
          Length = 669

 Score =  127 bits (319), Expect = 7e-28
 Identities = 58/100 (58%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +1

Query: 202 RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK-WEVIYADDEGDM 378
           R+CTKV M+G   GRAVDLT +  Y DL ++LEE+F+++G+LCP  K W+V+Y DDE DM
Sbjct: 543 RSCTKVIMQGMAVGRAVDLTKLNGYGDLRSKLEEMFDIQGDLCPTLKRWQVVYTDDEDDM 602

Query: 379 MLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSD 498
           MLVGDDPW EFC MV+RI+I S E+ K ++ K KLP++ D
Sbjct: 603 MLVGDDPWDEFCSMVKRIYIYSYEEAKLLAPKSKLPVIGD 642



>gb:AY133723_1581543 Arabidopsis thaliana auxin response factor 1
           (At1g59750) mRNA, complete cds.
          Length = 662

 Score =  125 bits (314), Expect = 3e-27
 Identities = 62/110 (56%), Positives = 81/110 (73%), Gaps = 4/110 (3%)
 Frame = +1

Query: 166 KDTLSKPSVTTSR---TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR 336
           K +L  P  + SR   +CTKV M+GS  GRA+DLT  + Y+DL  +LEE+F++KGEL   
Sbjct: 524 KSSLRSPQESQSRQIRSCTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLES 583

Query: 337 SK-WEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
           +K W+V+Y DDE DMM+VGDDPW EFC MVR+IFI + E+VKK+S K KL
Sbjct: 584 TKKWQVVYTDDEDDMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKL 633



>sp|Q8L7G0|ARFA_ARATH Auxin response factor 1.>pir|D96621|D96621
           auxin response factor 1 [imported] - Arabidopsis
           thaliana>gb:AE005173_893658 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC007258_1535659 Arabidopsis thaliana
           chromosome I BAC F23H11 genomic sequence, complete
           sequence.>gb:ATU83245_1557325 Arabidopsis thaliana auxin
           response factor 1 (ARF1) mRNA, complete
           cds.>gb:BT002748_1636351 Arabidopsis thaliana clone
           C105458 auxin response factor 1 (At1g59750) mRNA,
           complete cds.
          Length = 665

 Score =  125 bits (314), Expect = 3e-27
 Identities = 62/110 (56%), Positives = 81/110 (73%), Gaps = 4/110 (3%)
 Frame = +1

Query: 166 KDTLSKPSVTTSR---TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR 336
           K +L  P  + SR   +CTKV M+GS  GRA+DLT  + Y+DL  +LEE+F++KGEL   
Sbjct: 527 KSSLRSPQESQSRQIRSCTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLES 586

Query: 337 SK-WEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
           +K W+V+Y DDE DMM+VGDDPW EFC MVR+IFI + E+VKK+S K KL
Sbjct: 587 TKKWQVVYTDDEDDMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKL 636



>sp|Q9LQE8|ARFN_ARATH Putative auxin response factor 14.
          Length = 605

 Score =  121 bits (303), Expect = 5e-26
 Identities = 53/97 (54%), Positives = 76/97 (78%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEG 372
           +++RTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F+LKG+L  R++WE+ + ++E 
Sbjct: 507 SSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQARNQWEIAFTNNEE 566

Query: 373 DMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
           D MLVG+DPWPEFC MV++IFI S E+VK + S+  L
Sbjct: 567 DKMLVGEDPWPEFCNMVKKIFIYSKEEVKNLKSRKSL 603



>gb:AY255705_1593126 Mangifera indica auxin response factor-like
            protein (ARF1) mRNA, complete cds.
          Length = 840

 Score =  120 bits (301), Expect = 9e-26
 Identities = 56/102 (54%), Positives = 75/102 (73%), Gaps = 1/102 (0%)
 Frame = +1

Query: 163  LKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELC-PRS 339
            +KD  SKP   +SR+CTKV  +G   GR+VDL+   +Y++L+ EL+ +FE  GEL  P+ 
Sbjct: 701  VKDVHSKPQSGSSRSCTKVHKQGIALGRSVDLSKFNNYEELIAELDRLFEFGGELMTPKK 760

Query: 340  KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
             W +IY DDEGD+MLVGDDPW EFC MVR+IFI + E+V+KM
Sbjct: 761  NWLIIYTDDEGDIMLVGDDPWKEFCGMVRKIFIYTREEVQKM 802



>gb:AC023913_1539252 Arabidopsis thaliana chromosome 1 BAC F7P12
           genomic sequence, complete sequence.
          Length = 620

 Score =  120 bits (300), Expect = 1e-25
 Identities = 53/97 (54%), Positives = 74/97 (76%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEG 372
           ++SRTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F++KG+L  R++W++ + D +G
Sbjct: 522 SSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQLQTRNQWKIAFTDSDG 581

Query: 373 DMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
             MLVGDDPWPEFCKMV++I I S E+VK + S   L
Sbjct: 582 YEMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSL 618



>sp|Q9C8N9|ARFU_ARATH Putative auxin response factor 21.
          Length = 606

 Score =  120 bits (300), Expect = 1e-25
 Identities = 53/97 (54%), Positives = 74/97 (76%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEG 372
           ++SRTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F++KG+L  R++W++ + D +G
Sbjct: 508 SSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQLQTRNQWKIAFTDSDG 567

Query: 373 DMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
             MLVGDDPWPEFCKMV++I I S E+VK + S   L
Sbjct: 568 YEMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSL 604



>gb:AY669795_1620760 Arabidopsis thaliana clone C00610 ARF20
           (At1g35240) mRNA, complete cds.
          Length = 590

 Score =  119 bits (298), Expect = 2e-25
 Identities = 53/96 (55%), Positives = 73/96 (76%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGD 375
           ++RTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F+LKG+L  R++W++ + D +G 
Sbjct: 493 STRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIAFTDSDGY 552

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
            MLVGDDPWPEFCKMV++I I S E+VK + S   L
Sbjct: 553 EMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSL 588



>pir|D86473|D86473 69.8K hypothetical protein - Arabidopsis
           thaliana>gb:AE005172_892290 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069160_1540699 Arabidopsis thaliana
           chromosome 1 BAC T9I1 genomic sequence, complete
           sequence.
          Length = 615

 Score =  119 bits (298), Expect = 2e-25
 Identities = 53/96 (55%), Positives = 73/96 (76%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGD 375
           ++RTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F+LKG+L  R++W++ + D +G 
Sbjct: 518 STRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIAFTDSDGY 577

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
            MLVGDDPWPEFCKMV++I I S E+VK + S   L
Sbjct: 578 EMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSL 613



>sp|Q9C7I9|ARFT_ARATH Putative auxin response factor 20.
          Length = 606

 Score =  119 bits (298), Expect = 2e-25
 Identities = 53/96 (55%), Positives = 73/96 (76%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGD 375
           ++RTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F+LKG+L  R++W++ + D +G 
Sbjct: 509 STRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIAFTDSDGY 568

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
            MLVGDDPWPEFCKMV++I I S E+VK + S   L
Sbjct: 569 EMLVGDDPWPEFCKMVKKILIYSKEEVKNLKSSKSL 604



>gb:AJ716227_1813767 Brassica napus mRNA for putative auxin response
            factor (ARF2 gene).
          Length = 848

 Score =  119 bits (297), Expect = 3e-25
 Identities = 56/124 (45%), Positives = 84/124 (67%), Gaps = 1/124 (0%)
 Frame = +1

Query: 100  GAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYD 279
            G+   ++H +  R   + +   KD  +K +  + R+CTKVQ +G   GR+VDL+  ++Y+
Sbjct: 690  GSKSTNDHREQGRPFPVSKPHPKDVQTKTN--SCRSCTKVQKQGIALGRSVDLSKFQNYE 747

Query: 280  DLLNELEEIFELKGEL-CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
            +L+ EL+ +FE  GEL  P+  W ++Y DDE DMMLVGDDPW EFC MVR+IFI + E+V
Sbjct: 748  ELVTELDRLFEFNGELMAPKKDWLIVYTDDENDMMLVGDDPWQEFCCMVRKIFIYTKEEV 807

Query: 457  KKMS 468
            +KM+
Sbjct: 808  RKMN 811



>pir|H86465|H86465 F12G12.1 protein - Arabidopsis
           thaliana>gb:AE005172_892220 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC015446_1537971 Arabidopsis thaliana
           chromosome I BAC F12G12 genomic sequence, complete
           sequence.
          Length = 479

 Score =  117 bits (292), Expect = 1e-24
 Identities = 52/90 (57%), Positives = 68/90 (75%)
 Frame = +1

Query: 211 TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVG 390
           TKV M+G    RAVDLT M  Y+ L+ +LEE+F+LK EL  R++WE+++ ++EG  MLVG
Sbjct: 369 TKVHMQGVAISRAVDLTAMHGYNQLIQKLEELFDLKDELRTRNQWEIVFTNNEGAEMLVG 428

Query: 391 DDPWPEFCKMVRRIFICSSEKVKKMSSKCK 480
           DDPWPEFC M +RIFICS E++KKM  K K
Sbjct: 429 DDPWPEFCNMAKRIFICSKEEIKKMKLKNK 458



>sp|Q9FX25|ARFM_ARATH Putative auxin response factor 13.
          Length = 623

 Score =  117 bits (292), Expect = 1e-24
 Identities = 56/123 (45%), Positives = 82/123 (66%)
 Frame = +1

Query: 112 KSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLN 291
           +++ L+S +E++  E +            +R+  KV M+G    RAVDLT M  Y+ L+ 
Sbjct: 491 QTQPLRSPKEVQSTEFNF-----------TRSRIKVHMQGVAISRAVDLTAMHGYNQLIQ 539

Query: 292 ELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
           +LEE+F+LK EL  R++WE+++ ++EG  MLVGDDPWPEFC M +RIFICS E++KKM  
Sbjct: 540 KLEELFDLKDELRTRNQWEIVFTNNEGAEMLVGDDPWPEFCNMAKRIFICSKEEIKKMKL 599

Query: 472 KCK 480
           K K
Sbjct: 600 KNK 602



>gb:AF336918_1787610 Arabidopsis thaliana ARF2 (MTG10.3) mRNA,
           partial cds.
          Length = 454

 Score =  115 bits (289), Expect = 2e-24
 Identities = 55/124 (44%), Positives = 83/124 (66%), Gaps = 1/124 (0%)
 Frame = +1

Query: 100 GAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYD 279
           G+   ++H +  R  +      KD  +K +  +SR+CTKV  +G   GR+VDL+  ++Y+
Sbjct: 296 GSKSTNDHREQGRPFQTNNPHPKDAQTKTN--SSRSCTKVHKQGIALGRSVDLSKFQNYE 353

Query: 280 DLLNELEEIFELKGEL-CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           +L+ EL+ +FE  GEL  P+  W ++Y D+E DMMLVGDDPW EFC MVR+IFI + E+V
Sbjct: 354 ELVAELDRLFEFNGELMAPKKDWLIVYTDEENDMMLVGDDPWQEFCCMVRKIFIYTKEEV 413

Query: 457 KKMS 468
           +KM+
Sbjct: 414 RKMN 417



>gb:ATH441313_1552603 Arabidopsis thaliana mRNA for putative
           auxin-induced protein 26 (iaa26
           gene).>gb:ATH458328_1552608 Arabidopsis thaliana mRNA
           for putative auxin-induced protein 30 (iaa30
           gene).>gb:ATU89771_1557371 Arabidopsis thaliana
           ARF1-binding protein mRNA, complete cds.
          Length = 454

 Score =  115 bits (289), Expect = 2e-24
 Identities = 55/124 (44%), Positives = 83/124 (66%), Gaps = 1/124 (0%)
 Frame = +1

Query: 100 GAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYD 279
           G+   ++H +  R  +      KD  +K +  +SR+CTKV  +G   GR+VDL+  ++Y+
Sbjct: 296 GSKSTNDHREQGRPFQTNNPHPKDAQTKTN--SSRSCTKVHKQGIALGRSVDLSKFQNYE 353

Query: 280 DLLNELEEIFELKGEL-CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           +L+ EL+ +FE  GEL  P+  W ++Y D+E DMMLVGDDPW EFC MVR+IFI + E+V
Sbjct: 354 ELVAELDRLFEFNGELMAPKKDWLIVYTDEENDMMLVGDDPWQEFCCMVRKIFIYTKEEV 413

Query: 457 KKMS 468
           +KM+
Sbjct: 414 RKMN 417



>sp|Q94JM3|ARFB_ARATH Auxin response factor 2 (ARF1-binding protein)
            (ARF1-BP).>gb:AB016880_1513032 Arabidopsis thaliana
            genomic DNA, chromosome 5, P1
            clone:MTG10.>gb:AY669787_1620752 Arabidopsis thaliana
            clone C105342 ARF2 (At5g62000) mRNA, complete
            cds.>gb:BT000784_1635055 Arabidopsis thaliana clone
            RAFL07-10-G12 (R10939) auxin response factor (At5g62000)
            mRNA, complete cds.
          Length = 859

 Score =  115 bits (289), Expect = 2e-24
 Identities = 55/124 (44%), Positives = 83/124 (66%), Gaps = 1/124 (0%)
 Frame = +1

Query: 100  GAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYD 279
            G+   ++H +  R  +      KD  +K +  +SR+CTKV  +G   GR+VDL+  ++Y+
Sbjct: 701  GSKSTNDHREQGRPFQTNNPHPKDAQTKTN--SSRSCTKVHKQGIALGRSVDLSKFQNYE 758

Query: 280  DLLNELEEIFELKGEL-CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
            +L+ EL+ +FE  GEL  P+  W ++Y D+E DMMLVGDDPW EFC MVR+IFI + E+V
Sbjct: 759  ELVAELDRLFEFNGELMAPKKDWLIVYTDEENDMMLVGDDPWQEFCCMVRKIFIYTKEEV 818

Query: 457  KKMS 468
            +KM+
Sbjct: 819  RKMN 822



>pir|C86467|C86467 hypothetical protein F23M19.4 - Arabidopsis
           thaliana>gb:AE005172_892231 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F23M19_1677945 Arabidopsis thaliana
           chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 619

 Score =  114 bits (285), Expect = 6e-24
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 6/98 (6%)
 Frame = +1

Query: 163 LKDTLSKPS------VTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGE 324
           L  TL  P+       ++SRTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F++KG+
Sbjct: 518 LSQTLRSPTEIQNKQFSSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQ 577

Query: 325 LCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           L  R++WE+ + D + D MLVGDDPWPEFC MV++IFI
Sbjct: 578 LQTRNQWEIAFTDSDEDKMLVGDDPWPEFCNMVKKIFI 615



>sp|Q9XID4|ARFL_ARATH Putative auxin response factor
           12.>gb:AY669792_1620757 Arabidopsis thaliana clone
           C105347 ARF12 (At1g34310) mRNA, complete cds.
          Length = 593

 Score =  114 bits (285), Expect = 6e-24
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 6/98 (6%)
 Frame = +1

Query: 163 LKDTLSKPS------VTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGE 324
           L  TL  P+       ++SRTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F++KG+
Sbjct: 492 LSQTLRSPTEIQNKQFSSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQ 551

Query: 325 LCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           L  R++WE+ + D + D MLVGDDPWPEFC MV++IFI
Sbjct: 552 LQTRNQWEIAFTDSDEDKMLVGDDPWPEFCNMVKKIFI 589



>sp|P80470|PSBY_SPIOL Photosystem II core complex proteins psbY,
            chloroplast precursor (L- arginine metabolising enzyme)
            (L-AME) [Contains: Photosystem II protein psbY-1
            (psbY-A1); Photosystem II protein psbY-2
            (psbY-A2)].>pir|T08902|T08902 manganese-binding protein
            PsbY precursor, photosystem II-associated -
            spinach>gb:AF060198_1765073 Spinacia oleracea PsbY
            precursor (psbY) mRNA, nuclear gene encoding chloroplast
            protein, complete cds.
          Length = 199

 Score =  110 bits (276), Expect = 7e-23
 Identities = 74/193 (38%), Positives = 92/193 (47%), Gaps = 3/193 (1%)
 Frame = +1

Query: 979  MLNAKSLTTPKASINPVKPKPIISLLSMKNLPKGLSACNTDKSVVSSALTGTALAGAIFS 1158
            +LN K LT          PKP    +S+   P GLS       + S  +T  A+AGA+F+
Sbjct: 11   VLNTKCLTLNTNKTTSTSPKPTSKPISLS--PLGLSNSKLPMGL-SPIITAPAIAGAVFA 67

Query: 1159 ALSVSEPXXXXXXXXXXXXDG---DNRGXXXXXXXXXXXXWVLFNILQPALNQINKMRST 1329
             L   +P            +    DNRG            WVLFNILQPALNQINKMR+ 
Sbjct: 68   TLGSVDPAFAVQQLADIAAEAGTSDNRGLALLLPIIPALGWVLFNILQPALNQINKMRNE 127

Query: 1330 KGVIIXXXXXXXTAAQFIHPYXXXXXXXXXXXXXXXNDSRGQLLLIVVAPALLWVGYNIL 1509
            K   I        A   +                  +D+RG LLL+VV PA+ WV +NIL
Sbjct: 128  KKAFIVGLGLSGLATSGLL-LATPEAQAASEEIARGSDNRGTLLLLVVLPAIGWVLFNIL 186

Query: 1510 QPALNQLNKMRSE 1548
            QPALNQLNKMRS+
Sbjct: 187  QPALNQLNKMRSQ 199



>sp|Q9LQE3|ARFO_ARATH Putative auxin response factor 15.
          Length = 593

 Score =  110 bits (275), Expect = 9e-23
 Identities = 47/82 (57%), Positives = 66/82 (80%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEG 372
           +++RTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F+LKG+L  R++W++I+   + 
Sbjct: 508 SSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIIFTGSDE 567

Query: 373 DMMLVGDDPWPEFCKMVRRIFI 438
           D MLVGDDPWPEFC MV+RI+I
Sbjct: 568 DEMLVGDDPWPEFCNMVKRIYI 589



>pir|C86468|C86468 probable auxin response factor, 53188-50111
           [imported] - Arabidopsis thaliana>gb:AE005172_892239
           Arabidopsis thaliana chromosome 1, top arm complete
           sequence.>gb:AC023913_1539254 Arabidopsis thaliana
           chromosome 1 BAC F7P12 genomic sequence, complete
           sequence.
          Length = 600

 Score =  109 bits (273), Expect = 2e-22
 Identities = 47/82 (57%), Positives = 64/82 (78%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEG 372
           +++RTCTKVQM+G    RAVDL+ +  YD L+ ELEE+F+LKG+L  R++WE+ + D + 
Sbjct: 508 SSTRTCTKVQMQGVTIERAVDLSVLNGYDQLILELEELFDLKGQLQTRNQWEIAFTDSDD 567

Query: 373 DMMLVGDDPWPEFCKMVRRIFI 438
           D MLVGDDPWPEFC MV++I I
Sbjct: 568 DKMLVGDDPWPEFCNMVKKILI 589



>sp|Q9C8N7|ARFV_ARATH Putative auxin response factor
           22.>gb:AY669796_1620761 Arabidopsis thaliana clone
           C105354 ARF22 (At1g34390) mRNA, complete cds.
          Length = 598

 Score =  109 bits (273), Expect = 2e-22
 Identities = 47/82 (57%), Positives = 64/82 (78%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEG 372
           +++RTCTKVQM+G    RAVDL+ +  YD L+ ELEE+F+LKG+L  R++WE+ + D + 
Sbjct: 506 SSTRTCTKVQMQGVTIERAVDLSVLNGYDQLILELEELFDLKGQLQTRNQWEIAFTDSDD 565

Query: 373 DMMLVGDDPWPEFCKMVRRIFI 438
           D MLVGDDPWPEFC MV++I I
Sbjct: 566 DKMLVGDDPWPEFCNMVKKILI 587



>gb:AF140228_1771529 Oryza sativa (indica cultivar-group) putative
            auxin response factor 1 mRNA, partial cds.
          Length = 857

 Score =  108 bits (270), Expect = 3e-22
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 1/114 (0%)
 Frame = +1

Query: 130  SSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF 309
            SS++    +AS   +     V+T R+C KV  +G   GR+VDLT    Y++L+ EL+++F
Sbjct: 706  SSQQASSQQASRNMSCKSQGVST-RSCKKVHKQGIALGRSVDLTKFNGYEELIAELDDMF 764

Query: 310  ELKGELC-PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            +  GEL  P+ +W V+Y D+EGDMMLVGDDPW EFC MV +IFI + E+V++M+
Sbjct: 765  DFNGELKGPKKEWMVVYTDNEGDMMLVGDDPWIEFCDMVHKIFIYTREEVQRMN 818



>pir|E86468|E86468 protein F12K21.26 [imported] - Arabidopsis
           thaliana>gb:AE005172_892241 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC023279_1539174 Genomic sequence for
           Arabidopsis thaliana BAC F12K21 from chromosome I,
           complete sequence.
          Length = 620

 Score =  107 bits (266), Expect = 1e-21
 Identities = 47/90 (52%), Positives = 67/90 (74%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGD 393
           +VQM+G   GRAVDL+ +  YD L+ ELE++F++KG+L  R++W++ + D +G  MLVGD
Sbjct: 529 QVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQLQTRNQWKIAFTDSDGYEMLVGD 588

Query: 394 DPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
           DPWPEFCKMV++I I S E+VK + S   L
Sbjct: 589 DPWPEFCKMVKKILIYSKEEVKNLKSSKSL 618



>gb:OSA306306_1692454 Oryza sativa subsp. japonica mRNA for auxin
           response factor 1 (arf1 gene).
          Length = 836

 Score =  106 bits (265), Expect = 1e-21
 Identities = 48/97 (49%), Positives = 70/97 (72%), Gaps = 1/97 (1%)
 Frame = +1

Query: 181 KPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELC-PRSKWEVIY 357
           K    ++R+C KV  +G   GR+VDLT    Y++L+ EL+++F+  GEL  P+ +W V+Y
Sbjct: 701 KSQGVSTRSCKKVHKQGIALGRSVDLTKFNGYEELIAELDDMFDFNGELKGPKKEWMVVY 760

Query: 358 ADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            D+EGDMMLVGDDPW EFC MV +IFI + E+V++M+
Sbjct: 761 TDNEGDMMLVGDDPWIEFCDMVHKIFIYTREEVQRMN 797



>gb:AP003925_1835364 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1005_B05.
          Length = 205

 Score =  104 bits (260), Expect = 5e-21
 Identities = 67/179 (37%), Positives = 88/179 (49%), Gaps = 9/179 (5%)
 Frame = +1

Query: 1039 PIISLLSMKNLPKGLSACNTDKSVVSSALTGTALAGAIFSALSVSEPXXXXXX----XXX 1206
            P ISL S+    KG+S  ++  S  ++ +   A+AGA FSAL+ ++              
Sbjct: 31   PSISLKSLAK--KGMSVSSS--SAAAAPVAAAAMAGAFFSALASTDAALAAQQIADVAAA 86

Query: 1207 XXXDGDNRGXXXXXXXXXXXXWVLFNILQPALNQINKMRSTKGVIIXXXXXXXTAAQFIH 1386
                 DNRG            WVL+NILQPALNQ+N+MRS + ++          A    
Sbjct: 87   AAGADDNRGLALLLPIAPAIAWVLYNILQPALNQLNRMRSEQVLVAGLGLGAAAGAGLAF 146

Query: 1387 PYXXXXXX-----XXXXXXXXXNDSRGQLLLIVVAPALLWVGYNILQPALNQLNKMRSE 1548
            P                      D+RG LLL VVAPA+ WV YNILQPALNQLN+MRS+
Sbjct: 147  PPEASAAQEVARLAAEAAAAEGGDNRGLLLLFVVAPAIAWVLYNILQPALNQLNRMRSD 205



>pir|G86476|G86476 protein F15O4.37 [imported] - Arabidopsis
           thaliana>gb:AE005172_892323 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007887_1536315 Genomic sequence for
           Arabidopsis thaliana BAC F15O4 from chromosome I,
           complete sequence.
          Length = 767

 Score =  104 bits (259), Expect = 7e-21
 Identities = 46/87 (52%), Positives = 67/87 (77%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEG 372
           +++RTCTKVQM+G   GRAVDL+ +  YD L+ ELE++F+LKG+L  R++WE+ + ++E 
Sbjct: 563 SSTRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQARNQWEIAFTNNEE 622

Query: 373 DMMLVGDDPWPEFCKMVRRIFICSSEK 453
           D MLVG+DPWPEFC M  R ++ S+ K
Sbjct: 623 DKMLVGEDPWPEFCNM--RGYVASNSK 647



>sp|Q9ZTX9|ARFD_ARATH Auxin response factor 4.>gb:AB011483_1511498
            Arabidopsis thaliana genomic DNA, chromosome 5, P1
            clone:MUF9.>gb:AY080832_1568526 Arabidopsis thaliana
            auxin response factor ARF4 (At5g60450) mRNA, complete
            cds.>gb:AY113977_1578388 Arabidopsis thaliana auxin
            response factor ARF4 (At5g60450) mRNA, complete
            cds.>gb:AF013466_1761272 Arabidopsis thaliana auxin
            response factor 4 (ARF4) mRNA, complete
            cds.>gb:AF344313_1789749 Arabidopsis thaliana auxin
            response factor 4 (At5g60450) mRNA, complete cds.
          Length = 788

 Score =  103 bits (257), Expect = 1e-20
 Identities = 52/123 (42%), Positives = 77/123 (62%), Gaps = 3/123 (2%)
 Frame = +1

Query: 121  HLKSSREIKLVEASL--KDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNE 294
            ++ +S   KL   SL  +   SKP  ++ R CTKV  +GS+ GRA+DL+ +  YDDLL E
Sbjct: 636  NMNASSGCKLFGFSLPVETPASKPQSSSKRICTKVHKQGSQVGRAIDLSRLNGYDDLLME 695

Query: 295  LEEIFELKGEL-CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
            LE +F ++G L  P   W ++Y D E DMM+VGDDPW +FC +V +I + + E+V+  + 
Sbjct: 696  LERLFNMEGLLRDPEKGWRILYTDSENDMMVVGDDPWHDFCNVVWKIHLYTKEEVENAND 755

Query: 472  KCK 480
              K
Sbjct: 756  DNK 758



>gb:AP001539_1821284 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0708G02.
          Length = 699

 Score =  100 bits (249), Expect = 1e-19
 Identities = 59/136 (43%), Positives = 81/136 (59%), Gaps = 4/136 (2%)
 Frame = +1

Query: 88  ANGVGAVQKSEHL----KSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVD 255
           A G G+ + S  L    K ++E    + S ++  S  + T +RT  KVQM G+  GRAVD
Sbjct: 554 AKGTGSHEDSGQLSAFSKVTKEHIAADESPQEIQSHQNYT-ARTRIKVQMHGNAVGRAVD 612

Query: 256 LTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIF 435
           L  +  Y+ L+NELEE+F +K     + KW+V + DDEGD M VGDDPW EFC+MVR+I 
Sbjct: 613 LANLDGYEQLMNELEEMFNIKDL---KQKWKVAFTDDEGDTMEVGDDPWLEFCQMVRKIV 669

Query: 436 ICSSEKVKKMSSKCKL 483
           +   E  KK+    KL
Sbjct: 670 LYPIEDEKKIEPHPKL 685



>gb:AB071300_1522758 Oryza sativa OsARF16 mRNA for auxin response
           factor 16, partial cds.
          Length = 695

 Score =  100 bits (249), Expect = 1e-19
 Identities = 59/136 (43%), Positives = 81/136 (59%), Gaps = 4/136 (2%)
 Frame = +1

Query: 88  ANGVGAVQKSEHL----KSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVD 255
           A G G+ + S  L    K ++E    + S ++  S  + T +RT  KVQM G+  GRAVD
Sbjct: 550 AKGTGSHEDSGQLSAFSKVTKEHIAADESPQEIQSHQNYT-ARTRIKVQMHGNAVGRAVD 608

Query: 256 LTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIF 435
           L  +  Y+ L+NELEE+F +K     + KW+V + DDEGD M VGDDPW EFC+MVR+I 
Sbjct: 609 LANLDGYEQLMNELEEMFNIKDL---KQKWKVAFTDDEGDTMEVGDDPWLEFCQMVRKIV 665

Query: 436 ICSSEKVKKMSSKCKL 483
           +   E  KK+    KL
Sbjct: 666 LYPIEDEKKIEPHPKL 681



>gb:OSJN00292_1698072 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: P0076O17, complete sequence.
          Length = 1673

 Score = 96.7 bits (239), Expect = 1e-18
 Identities = 43/71 (60%), Positives = 56/71 (78%), Gaps = 1/71 (1%)
 Frame = +1

Query: 202 RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK-WEVIYADDEGDM 378
           R+CTKV M+G   GRAVDLT +  Y DL ++LEE+F+++G+LCP  K W+V+Y DDE DM
Sbjct: 425 RSCTKVIMQGMAVGRAVDLTKLNGYGDLRSKLEEMFDIQGDLCPTLKRWQVVYTDDEDDM 484

Query: 379 MLVGDDPWPEF 411
           MLVGDDPW +F
Sbjct: 485 MLVGDDPWEKF 495



>gb:AB112675_1527193 Cucumis sativus CsARF5 mRNA for auxin response
           factor 5, complete cds.
          Length = 733

 Score = 96.3 bits (238), Expect = 2e-18
 Identities = 51/123 (41%), Positives = 77/123 (62%), Gaps = 3/123 (2%)
 Frame = +1

Query: 112 KSEHLKSSRE-IKLVEASLK-DTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDL 285
           K EH+  +    KL   SL  +T +    +  R+CTKV  +GS  GRA+DL+ +  Y DL
Sbjct: 573 KDEHVNDNATGCKLFGFSLTTETATNVQSSGKRSCTKVHKQGSLVGRAIDLSRLNGYTDL 632

Query: 286 LNELEEIFELKGELC-PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKK 462
           ++ELE +F ++G L  P   W V+Y D+E D+M+VGD PW +FC  V +I I + E+V+K
Sbjct: 633 ISELERLFSMEGLLKDPDKGWRVLYTDNENDVMVVGDYPWHDFCDAVSKIHIYTQEEVEK 692

Query: 463 MSS 471
           M++
Sbjct: 693 MTN 695



>gb:AB112671_1527189 Cucumis sativus CsARF1 mRNA for auxin response
            factor 1, complete cds.
          Length = 1081

 Score = 84.3 bits (207), Expect = 7e-15
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGD 375
            RT TKVQ  GS  GR +D+T  K YD+L ++L  +F ++G+L    R+ W+++Y D E D
Sbjct: 970  RTYTKVQKRGS-VGRCIDVTRYKGYDELRHDLARMFGIEGQLEDPQRTDWKLVYVDHEND 1028

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 1029 ILLVGDDPWDEFVSCVQSIKILSSAEVQQMS 1059



>gb:U79557_1726470 Arabidopsis thaliana IAA24 (IAA24) mRNA, partial
            cds.
          Length = 890

 Score = 82.0 bits (201), Expect = 4e-14
 Identities = 48/103 (46%), Positives = 70/103 (67%), Gaps = 2/103 (1%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELC-PRSK-WEVIYADDEGD 375
            RT TKVQ  GS  GR++D+T+ KDY++L + +E +F L+G L  P+S  W+++Y D E D
Sbjct: 781  RTYTKVQKTGS-VGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESD 839

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSDEG 504
            ++LVGDDPW EF   VR I I S  +V++MS +  + LL+  G
Sbjct: 840  VLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEE-GMKLLNSAG 881



>sp|P93024|ARFE_ARATH Auxin response factor 5 (Transcription factor
            MONOPTEROS) (Auxin- responsive protein
            IAA24).>gb:BT002050_1635653 Arabidopsis thaliana
            transcription factor (At1g19850) mRNA, complete
            cds.>gb:BT008805_1640001 Arabidopsis thaliana At1g19850
            gene, complete cds.>gb:AF037228_1763129 Arabidopsis
            thaliana transcription factor (MP) gene, complete
            cds.>gb:AF334716_1787456 Arabidopsis thaliana clone
            C00027 (h) auxin response factor 5 (At1g19850) mRNA,
            complete cds.
          Length = 902

 Score = 82.0 bits (201), Expect = 4e-14
 Identities = 48/103 (46%), Positives = 70/103 (67%), Gaps = 2/103 (1%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELC-PRSK-WEVIYADDEGD 375
            RT TKVQ  GS  GR++D+T+ KDY++L + +E +F L+G L  P+S  W+++Y D E D
Sbjct: 793  RTYTKVQKTGS-VGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESD 851

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSDEG 504
            ++LVGDDPW EF   VR I I S  +V++MS +  + LL+  G
Sbjct: 852  VLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEE-GMKLLNSAG 893



>gb:AF467900_1802448 Prunus persica clone pPn31C7 hypothetical
            proteins, and hypothetical transcription factor genes,
            complete cds.
          Length = 954

 Score = 81.6 bits (200), Expect = 5e-14
 Identities = 53/119 (44%), Positives = 74/119 (62%), Gaps = 4/119 (3%)
 Frame = +1

Query: 130  SSREIKLVEASLKDTLSK--PSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEE 303
            SS  I L E+SL          V   RT TKVQ  GS  GR++D+T+ K+Y++L + +E 
Sbjct: 814  SSSNIDLDESSLLQNNGSWHQVVPPVRTYTKVQKTGS-VGRSIDVTSFKNYEELCSAIEC 872

Query: 304  IFELKGELC-PR-SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
            +F L+G L  PR S W+++Y D E D++LVGDDPW EF   VR I I S  +V++MS +
Sbjct: 873  MFGLEGLLNDPRGSGWKLVYVDYENDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEE 931



>gb:ATH441312_1552602 Arabidopsis thaliana mRNA for early
           auxin-induced protein 22 (iaa22 gene).
          Length = 278

 Score = 81.3 bits (199), Expect = 6e-14
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202 RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGD 375
           RT TKVQ  GS  GR++D+T    YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 150 RTYTKVQKRGS-VGRSIDVTRYSGYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHEND 208

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
           ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 209 ILLVGDDPWEEFVNCVQNIKILSSVEVQQMS 239



>pir|G86325|G86325 hypothetical protein T29M8.9 - Arabidopsis
            thaliana>gb:AE005172_890883 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:T29M8_1723929
            Sequence of BAC T29M8 from Arabidopsis thaliana
            chromosome 1, complete sequence.
          Length = 1062

 Score = 81.3 bits (199), Expect = 6e-14
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGD 375
            RT TKVQ  GS  GR++D+T    YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 934  RTYTKVQKRGS-VGRSIDVTRYSGYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHEND 992

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 993  ILLVGDDPWEEFVNCVQNIKILSSVEVQQMS 1023



>sp|Q8RYC8|ARFS_ARATH Auxin response factor 19 (Auxin-responsive
            protein IAA22).>gb:ATU53672_1557081 Arabidopsis thaliana
            early auxin-induced IAA22 mRNA, complete
            cds.>gb:AY008390_1558213 Arabidopsis thaliana ARF11/IAA22
            gene, complete cds.>gb:AY669794_1620759 Arabidopsis
            thaliana clone C105352 ARF19 (At1g19220) mRNA, complete
            cds.
          Length = 1086

 Score = 81.3 bits (199), Expect = 6e-14
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGD 375
            RT TKVQ  GS  GR++D+T    YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 958  RTYTKVQKRGS-VGRSIDVTRYSGYDELRHDLARMFGIEGQLEDPLTSDWKLVYTDHEND 1016

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 1017 ILLVGDDPWEEFVNCVQNIKILSSVEVQQMS 1047



>gb:AF186466_1775147 Arabidopsis thaliana non-phototropic hypocotyl 4
            (NPH4) gene, complete cds.
          Length = 1165

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGD 375
            RT TKVQ  GS  GR++D+   + YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 1038 RTYTKVQKRGS-VGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHEND 1096

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 1097 ILLVGDDPWEEFVNCVQSIKILSSAEVQQMS 1127



>gb:AF042195_1763624 Arabidopsis thaliana auxin response factor 7
            (ARF7) mRNA, complete cds.
          Length = 1164

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGD 375
            RT TKVQ  GS  GR++D+   + YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 1037 RTYTKVQKRGS-VGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHEND 1095

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 1096 ILLVGDDPWEEFVNCVQSIKILSSAEVQQMS 1126



>gb:AF022368_1761985 Arabidopsis thaliana BIPOSTO (BIP) mRNA, complete
            cds.
          Length = 1165

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGD 375
            RT TKVQ  GS  GR++D+   + YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 1038 RTYTKVQKRGS-VGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHEND 1096

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 1097 ILLVGDDPWEEFVNCVQSIKILSSAEVQQMS 1127



>gb:OSJN00127_1695343 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0084K01, complete sequence.
          Length = 954

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 44/102 (43%), Positives = 66/102 (64%), Gaps = 2/102 (1%)
 Frame = +1

Query: 169  DTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSK 342
            D  +KP     RT TKVQ +GS  GR++D+T  ++Y +L + +  +F L+G+L     S+
Sbjct: 840  DRSAKPMKPPVRTYTKVQKQGS-VGRSIDVTGFRNYHELRSAIACMFGLQGKLEHPGSSE 898

Query: 343  WEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            W+++Y D E D++LVGDDPW EF   VR I I S  +V++MS
Sbjct: 899  WKLVYVDYENDVLLVGDDPWEEFINCVRCIRILSPSEVQQMS 940



>gb:AY080595_1568339 Arabidopsis thaliana unknown protein (At5g20730)
            mRNA, partial cds.
          Length = 1045

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGD 375
            RT TKVQ  GS  GR++D+   + YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 918  RTYTKVQKRGS-VGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHEND 976

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 977  ILLVGDDPWEEFVNCVQSIKILSSAEVQQMS 1007



>gb:ATU49077_1557048 Arabidopsis thaliana early auxin-induced
           (IAA21) mRNA, partial cds.
          Length = 381

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202 RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGD 375
           RT TKVQ  GS  GR++D+   + YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 254 RTYTKVQKRGS-VGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHEND 312

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
           ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 313 ILLVGDDPWEEFVNCVQSIKILSSAEVQQMS 343



>gb:AB071292_1522750 Oryza sativa OsMP mRNA for Arabidopsis
            Monopteros-like protein, complete cds.
          Length = 955

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 44/102 (43%), Positives = 66/102 (64%), Gaps = 2/102 (1%)
 Frame = +1

Query: 169  DTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSK 342
            D  +KP     RT TKVQ +GS  GR++D+T  ++Y +L + +  +F L+G+L     S+
Sbjct: 841  DRSAKPMKPPVRTYTKVQKQGS-VGRSIDVTGFRNYHELRSAIACMFGLQGKLEHPGSSE 899

Query: 343  WEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            W+++Y D E D++LVGDDPW EF   VR I I S  +V++MS
Sbjct: 900  WKLVYVDYENDVLLVGDDPWEEFINCVRCIRILSPSEVQQMS 941



>gb:AE005172_892318 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC007887_1536320 Genomic sequence
           for Arabidopsis thaliana BAC F15O4 from chromosome I,
           complete sequence.
          Length = 570

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 34/64 (53%), Positives = 49/64 (76%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGD 393
           +VQM+G   GRAVDL+ +  YD L+ ELE++F+LKG+L  R++W++I+   + D MLVGD
Sbjct: 507 QVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDLKGQLQTRNQWKIIFTGSDEDEMLVGD 566

Query: 394 DPWP 405
           DPWP
Sbjct: 567 DPWP 570



>sp|P93022|ARFG_ARATH Auxin response factor 7 (Non-phototropic
            hypocotyl 4) (BIPOSTO protein) (Auxin-responsive protein
            IAA21/IAA23/IAA25).>gb:AY008392_1558214 Arabidopsis
            thaliana ARF7 (ARF7) gene, complete
            cds.>gb:AY669789_1620754 Arabidopsis thaliana clone
            C105344 ARF7 (At5g20730) mRNA, complete cds.
          Length = 1164

 Score = 80.5 bits (197), Expect = 1e-13
 Identities = 41/91 (45%), Positives = 61/91 (67%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGD 375
            RT TKVQ  GS  GR++D+   + YD+L ++L  +F ++G+L     S W+++Y D E D
Sbjct: 1037 RTYTKVQKRGS-VGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHEND 1095

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++LVGDDPW EF   V+ I I SS +V++MS
Sbjct: 1096 ILLVGDDPWEEFVNCVQSIKILSSAEVQQMS 1126



>pir|T51807|T51807 transcription factor monopteros [validated] -
            Arabidopsis thaliana>gb:AF037229_1763130 Arabidopsis
            thaliana transcription factor (MP) mRNA, complete cds.
          Length = 902

 Score = 79.7 bits (195), Expect = 2e-13
 Identities = 47/103 (45%), Positives = 69/103 (66%), Gaps = 2/103 (1%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELC-PRSK-WEVIYADDEGD 375
            RT  KVQ  GS  GR++D+T+ KDY++L + +E +F L+G L  P+S  W+++Y D E D
Sbjct: 793  RTYIKVQKTGS-VGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESD 851

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKLPLLSDEG 504
            ++LVGDDPW EF   VR I I S  +V++MS +  + LL+  G
Sbjct: 852  VLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEE-GMKLLNSAG 893



>gb:AB112672_1527190 Cucumis sativus CsARF2 mRNA for auxin response
            factor 2, complete cds.
          Length = 1107

 Score = 77.8 bits (190), Expect = 7e-13
 Identities = 40/97 (41%), Positives = 59/97 (60%), Gaps = 2/97 (2%)
 Frame = +1

Query: 184  PSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK--WEVIY 357
            P     RT TKV   G+  GR++D+     YD+L  +L   F ++G+L  R K  W+++Y
Sbjct: 989  PPFQRMRTYTKVYKRGA-VGRSIDIARYSGYDELKQDLARRFGIEGQLEDRQKIGWKLVY 1047

Query: 358  ADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
             D E D++LVGDDPW +F   VR I I S ++V++MS
Sbjct: 1048 VDHENDVLLVGDDPWDDFVNCVRSIKILSPQEVQQMS 1084



>gb:AY669788_1620753 Arabidopsis thaliana clone C105343 ARF6
            (At1g30330) mRNA, complete cds.
          Length = 935

 Score = 75.9 bits (185), Expect = 3e-12
 Identities = 39/94 (41%), Positives = 60/94 (63%), Gaps = 2/94 (2%)
 Frame = +1

Query: 199  SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEG 372
            S T  KV   GS FGR++D++    Y +L +EL  +F L+G+L    RS W++++ D E 
Sbjct: 795  SNTFVKVYKSGS-FGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDREN 853

Query: 373  DMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
            D++L+GDDPWPEF   V  I I S ++V++M  +
Sbjct: 854  DVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKR 887



>sp|Q9ZTX8|ARFF_ARATH Auxin response factor 6.>pir|F86427|F86427 auxin
            response factor 6 (ARF6) [imported] - Arabidopsis
            thaliana>gb:AE005172_891878 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC025295_1539416 Arabidopsis thaliana
            chromosome 1 BAC T4K22 genomic sequence, complete
            sequence.>gb:AF013467_1761273 Arabidopsis thaliana ARF6
            (ARF6) mRNA, complete cds.
          Length = 933

 Score = 75.9 bits (185), Expect = 3e-12
 Identities = 39/94 (41%), Positives = 60/94 (63%), Gaps = 2/94 (2%)
 Frame = +1

Query: 199  SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEG 372
            S T  KV   GS FGR++D++    Y +L +EL  +F L+G+L    RS W++++ D E 
Sbjct: 793  SNTFVKVYKSGS-FGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDREN 851

Query: 373  DMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
            D++L+GDDPWPEF   V  I I S ++V++M  +
Sbjct: 852  DVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKR 885



>gb:U79555_1726468 Arabidopsis thaliana IAA23 (IAA23) mRNA, partial
           cds.
          Length = 591

 Score = 75.5 bits (184), Expect = 3e-12
 Identities = 38/87 (43%), Positives = 58/87 (66%), Gaps = 2/87 (2%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGDMMLV 387
           KVQ  GS  GR++D+   + YD+L ++L  +F ++G+L     S W+++Y D E D++LV
Sbjct: 483 KVQKRGS-VGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLV 541

Query: 388 GDDPWPEFCKMVRRIFICSSEKVKKMS 468
           GDDPW EF   V+ I I SS +V++MS
Sbjct: 542 GDDPWEEFVNCVQSIKILSSAEVQQMS 568



>gb:AP003726_1832517 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0596H10.>gb:AP004324_1840157 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, BAC
            clone:OJ1215_E11.
          Length = 991

 Score = 74.7 bits (182), Expect = 6e-12
 Identities = 37/91 (40%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK--WEVIYADDEGD 375
            RT TKV   G+  GR++D++    YD+L + L  +F ++G+L  R +  W+++Y D E D
Sbjct: 857  RTFTKVYKRGA-VGRSIDMSQFSGYDELKHALARMFSIEGQLEERQRIGWKLVYKDHEDD 915

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++L+GDDPW EF   V+ I I S ++V++MS
Sbjct: 916  ILLLGDDPWEEFVGCVKCIRILSPQEVQQMS 946



>gb:OSJN00095_1694821 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0004A17, complete sequence.
          Length = 818

 Score = 74.7 bits (182), Expect = 6e-12
 Identities = 51/145 (35%), Positives = 79/145 (54%), Gaps = 4/145 (2%)
 Frame = +1

Query: 52   NTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEAS--LKDTLSKPSVTTSRTCTKVQM 225
            N +P+  + V D N       S +L+++    L ++S  L++T      T  RT  KV  
Sbjct: 669  NMVPNLTSNVSDGNLSTIPSGSTYLQNAMYGCLDDSSGLLQNTGENDPAT--RTFVKVYK 726

Query: 226  EGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGDMMLVGDDP 399
             GS  GR++D+T   +Y +L  EL ++F +KG+L    RS W++++ D E D++L+GDDP
Sbjct: 727  SGS-VGRSLDITRFSNYAELREELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDP 785

Query: 400  WPEFCKMVRRIFICSSEKVKKMSSK 474
            W  F   V  I I S E V KM  +
Sbjct: 786  WESFVNSVWYIKILSPEDVHKMGKQ 810



>gb:AB071298_1522756 Oryza sativa OsARF8 mRNA for auxin response
            factor 8, partial cds.
          Length = 795

 Score = 74.7 bits (182), Expect = 6e-12
 Identities = 51/145 (35%), Positives = 79/145 (54%), Gaps = 4/145 (2%)
 Frame = +1

Query: 52   NTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEAS--LKDTLSKPSVTTSRTCTKVQM 225
            N +P+  + V D N       S +L+++    L ++S  L++T      T  RT  KV  
Sbjct: 646  NMVPNLTSNVSDGNLSTIPSGSTYLQNAMYGCLDDSSGLLQNTGENDPAT--RTFVKVYK 703

Query: 226  EGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGDMMLVGDDP 399
             GS  GR++D+T   +Y +L  EL ++F +KG+L    RS W++++ D E D++L+GDDP
Sbjct: 704  SGS-VGRSLDITRFSNYAELREELGQMFGIKGQLDDPDRSGWQLVFVDRENDVLLLGDDP 762

Query: 400  WPEFCKMVRRIFICSSEKVKKMSSK 474
            W  F   V  I I S E V KM  +
Sbjct: 763  WESFVNSVWYIKILSPEDVHKMGKQ 787



>gb:AB071296_1522754 Oryza sativa OsARF7a mRNA for auxin response
            factor 7a, partial cds.
          Length = 1123

 Score = 74.7 bits (182), Expect = 6e-12
 Identities = 37/91 (40%), Positives = 60/91 (65%), Gaps = 2/91 (2%)
 Frame = +1

Query: 202  RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK--WEVIYADDEGD 375
            RT TKV   G+  GR++D++    YD+L + L  +F ++G+L  R +  W+++Y D E D
Sbjct: 989  RTFTKVYKRGA-VGRSIDMSQFSGYDELKHALARMFSIEGQLEERQRIGWKLVYKDHEDD 1047

Query: 376  MMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
            ++L+GDDPW EF   V+ I I S ++V++MS
Sbjct: 1048 ILLLGDDPWEEFVGCVKCIRILSPQEVQQMS 1078



>gb:AP005294_1850038 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1679_B08.
          Length = 1139

 Score = 73.9 bits (180), Expect = 1e-11
 Identities = 38/97 (39%), Positives = 61/97 (62%), Gaps = 2/97 (2%)
 Frame = +1

Query: 184  PSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK--WEVIY 357
            P +   RT TKV   G+  GR++D+     Y++L + L  +F ++G+L  R +  W+++Y
Sbjct: 1000 PLLQRMRTFTKVYKRGA-VGRSIDIGRYSGYEELKHALARMFGIEGQLEDRQRIGWKLVY 1058

Query: 358  ADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMS 468
             D E D++L+GDDPW EF   VR I I S ++V++MS
Sbjct: 1059 KDHEDDILLLGDDPWEEFVNCVRCIRILSPQEVQQMS 1095



>gb:AB112673_1527191 Cucumis sativus CsARF3 mRNA for auxin response
            factor 3, complete cds.
          Length = 916

 Score = 73.2 bits (178), Expect = 2e-11
 Identities = 39/92 (42%), Positives = 57/92 (61%), Gaps = 2/92 (2%)
 Frame = +1

Query: 205  TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGDM 378
            T  KV   GS FGR++D++    Y  L +EL  +F L+GEL    RS W++++ D E D+
Sbjct: 783  TFVKVYKSGS-FGRSLDISKFSRYHQLRSELAHMFGLEGELEDPLRSGWQLVFVDRENDV 841

Query: 379  MLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
            +L+GDDPWPEF   V  I I S ++V+ M  +
Sbjct: 842  LLLGDDPWPEFVNSVWCIKILSPQEVQDMGKR 873



>gb:AP004622_1842250 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0689E12.>gb:AP005509_1853084 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, BAC
            clone:OJ1003_A09.
          Length = 1113

 Score = 72.4 bits (176), Expect = 3e-11
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query: 184  PSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK--WEVIY 357
            P+    RT TKV   G+  GR++D+     YD+L +++  +F ++G+L  +++  W+++Y
Sbjct: 989  PAHQRMRTYTKVHKRGA-VGRSIDINRYSGYDELKHDVARMFGIEGQLGDQNRVGWKLVY 1047

Query: 358  ADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
             D E D++LVGDDPW +F K VR I I S ++  +M
Sbjct: 1048 EDHEKDVLLVGDDPWEDFVKCVRCIRILSPQEEMQM 1083



>gb:AB071297_1522755 Oryza sativa OsARF7b mRNA for auxin response
            factor 7b, partial cds.
          Length = 1096

 Score = 72.4 bits (176), Expect = 3e-11
 Identities = 36/96 (37%), Positives = 61/96 (63%), Gaps = 2/96 (2%)
 Frame = +1

Query: 184  PSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK--WEVIY 357
            P+    RT TKV   G+  GR++D+     YD+L +++  +F ++G+L  +++  W+++Y
Sbjct: 972  PAHQRMRTYTKVHKRGA-VGRSIDINRYSGYDELKHDVARMFGIEGQLGDQNRVGWKLVY 1030

Query: 358  ADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
             D E D++LVGDDPW +F K VR I I S ++  +M
Sbjct: 1031 EDHEKDVLLVGDDPWEDFVKCVRCIRILSPQEEMQM 1066



>gb:AB071295_1522753 Oryza sativa OsARF6b mRNA for auxin response
            factor 6b, partial cds.
          Length = 880

 Score = 72.0 bits (175), Expect = 4e-11
 Identities = 43/110 (39%), Positives = 67/110 (60%), Gaps = 4/110 (3%)
 Frame = +1

Query: 148  LVEASLKDTLSKPSVTTSRTCT--KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG 321
            L E+   + L+  SV  S+  T  KV   GS  GR++D++    Y +L +ELE +F L+G
Sbjct: 727  LGESGTFNPLNNISVNPSQGATFVKVYKSGS-LGRSLDISRFSSYCELRSELERLFGLEG 785

Query: 322  ELCP--RSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
            +L    RS W++++ D E D++LVGDDPW EF   V  I I S ++V+++
Sbjct: 786  QLEDPVRSGWQLVFVDRENDILLVGDDPWQEFANSVWCIKILSPQEVQQL 835



>gb:AY137966_1582218 Mirabilis jalapa clone SM-01 auxin-responsive
           factor protein mRNA, partial cds.
          Length = 137

 Score = 71.6 bits (174), Expect = 5e-11
 Identities = 38/88 (43%), Positives = 56/88 (63%), Gaps = 2/88 (2%)
 Frame = +1

Query: 199 SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEG 372
           +RT  KV   GS FGR++D++    Y +L +EL  +F L+ EL   PRS  ++++ D E 
Sbjct: 51  TRTFVKVHKMGS-FGRSLDISQFSSYQELRSELARLFGLENELKDSPRSGSQLVFVDREN 109

Query: 373 DMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           D++L+GDDPW EF K V  I I S ++V
Sbjct: 110 DVLLLGDDPWQEFVKTVGHIRILSPQEV 137



>gb:AP003728_1832561 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0710B08.>gb:AP004989_1846778 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, BAC
            clone:B1153E06.
          Length = 917

 Score = 71.2 bits (173), Expect = 6e-11
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
 Frame = +1

Query: 205  TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGDM 378
            T  KV   G+ +GR++D+T    Y +L  EL  +F L+G+L    RS W++++ D E D+
Sbjct: 787  TFVKVYKSGT-YGRSLDITRFSSYHELRRELGRLFGLEGQLENPLRSGWQLVFVDREDDV 845

Query: 379  MLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCKL 483
            +LVGDDPW EF   V  I I S ++V++M    +L
Sbjct: 846  LLVGDDPWQEFVNSVSCIKILSPQEVQQMGKPFEL 880



>gb:AB112674_1527192 Cucumis sativus CsARF4 mRNA for auxin response
           factor 4, complete cds.
          Length = 816

 Score = 70.5 bits (171), Expect = 1e-10
 Identities = 37/92 (40%), Positives = 56/92 (60%), Gaps = 2/92 (2%)
 Frame = +1

Query: 205 TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGDM 378
           T  KV   G+ + R++D+T    Y +L +EL  +F L+GEL    RS W++++ D E D+
Sbjct: 684 TFVKVHKSGT-YSRSLDITKFNSYPELRSELARMFGLEGELEDPLRSGWQLVFVDRENDV 742

Query: 379 MLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
           +L+GD PWPEF   V  I I S E+V+ M  +
Sbjct: 743 LLLGDGPWPEFVNSVWCIKILSPEEVQDMGKR 774



>pir|G86331|G86331 IAA24 [imported] - Arabidopsis
           thaliana>gb:AE005172_890947 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007797_1536223 Arabidopsis thaliana
           chromosome I BAC F6F9 genomic sequence, complete
           sequence.
          Length = 850

 Score = 68.2 bits (165), Expect = 5e-10
 Identities = 35/69 (50%), Positives = 51/69 (73%), Gaps = 2/69 (2%)
 Frame = +1

Query: 202 RTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELC-PRSK-WEVIYADDEGD 375
           RT TKVQ  GS  GR++D+T+ KDY++L + +E +F L+G L  P+S  W+++Y D E D
Sbjct: 782 RTYTKVQKTGS-VGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESD 840

Query: 376 MMLVGDDPW 402
           ++LVGDDPW
Sbjct: 841 VLLVGDDPW 849



>gb:AP004093_1837597 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1661_C12.>gb:AP004863_1846164 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0023I17.
          Length = 908

 Score = 67.8 bits (164), Expect = 7e-10
 Identities = 36/89 (40%), Positives = 55/89 (61%), Gaps = 2/89 (2%)
 Frame = +1

Query: 205  TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYADDEGDM 378
            T  KV   G+  GR +D+T    Y +L +E+  +F L+G+L    RS W++++ D E D+
Sbjct: 778  TFVKVYKSGT-VGRLLDITRFSSYHELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDV 836

Query: 379  MLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
            +LVGDDPW EF   V  I I S ++V++M
Sbjct: 837  LLVGDDPWQEFVNSVSCIKILSPQEVQQM 865



>gb:U79556_1726469 Arabidopsis thaliana IAA25 (IAA25) mRNA, partial
           cds.
          Length = 476

 Score = 66.2 bits (160), Expect = 2e-09
 Identities = 32/77 (41%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = +1

Query: 244 RAVDLTTMKDYDDLLNELEEIFELKGEL--CPRSKWEVIYADDEGDMMLVGDDPWPEFCK 417
           R  D+   + YD+L ++L  +F ++G+L     S W+++Y D E D++LVGDDPW EF  
Sbjct: 362 RMRDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVN 421

Query: 418 MVRRIFICSSEKVKKMS 468
            V+ I I SS +V++MS
Sbjct: 422 CVQSIKILSSAEVQQMS 438



>sp|P49678|IAA2_ARATH Auxin-responsive protein IAA2 (Indoleacetic
           acid-induced protein 2).>gb:AB026655_1517321 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone:
           MXC7.>gb:ATHIAA2A_1553241 Arabidopsis thaliana
           auxin-responsive protein (IAA2) mRNA, 5' partial
           cds.>gb:AF332392_1787205 Arabidopsis thaliana clone
           C00010 (f) auxin-inducible protein IAA2 (At3g23030)
           mRNA, complete cds.
          Length = 174

 Score = 64.7 bits (156), Expect = 6e-09
 Identities = 50/162 (30%), Positives = 75/162 (46%), Gaps = 16/162 (9%)
 Frame = +1

Query: 34  KETPCSNTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSK----PSVTTS 201
           K+T     +P     + +   V  V KS + +   E +  E S   T ++    P V +S
Sbjct: 12  KDTELCLGLPGRTEKIKEEQEVSCV-KSNNKRLFEETRDEEESTPPTKTQIVGWPPVRSS 70

Query: 202 R------TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKW 345
           R      +  KV M+G+ + R +DL T K+Y +LL  LE +F++  GE C R     S +
Sbjct: 71  RKNNNSVSYVKVSMDGAPYLRKIDLKTYKNYPELLKALENMFKVMIGEYCEREGYKGSGF 130

Query: 346 EVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
              Y D +GD MLVGD PW  F    +R+ I        + S
Sbjct: 131 VPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIMKGSDAPALDS 172



>gb:PTR306831_1702725 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA8 gene).
          Length = 204

 Score = 63.2 bits (152), Expect = 2e-08
 Identities = 52/172 (30%), Positives = 76/172 (44%), Gaps = 29/172 (16%)
 Frame = +1

Query: 31  EKETPCSNTMPSNANAVCDANG--VGAVQKSEHLKSSREIKL------------------ 150
           EK+TP SN   SN  ++ D N    G+ +++    SS E K                   
Sbjct: 27  EKQTPNSNLAKSNKRSLPDMNEDPAGSSRENSSTVSSNEEKSHDQETAPPPIKAQVVGWP 86

Query: 151 -VEASLKDTLS--KPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK- 318
            + +  K+ L   K     +    KV M+G+ + R +DL   K Y +LL  LEE+F+ K 
Sbjct: 87  PIRSYRKNCLQAKKQEAEAAGLYVKVSMDGAPYLRKIDLKVYKGYPELLKALEEMFKSKV 146

Query: 319 GELCPR-----SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
           GE   R     S+    Y D +GD MLVGD PW  F    +R+ I    + +
Sbjct: 147 GEYSEREGYNGSEHVPTYEDKDGDWMLVGDVPWDMFINSCKRLRIMKESEAR 198



>gb:AB061223_1521995 Physcomitrella patens PpIAA1b mRNA for IAA/AUX
           protein, complete cds.
          Length = 503

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 39/120 (32%), Positives = 57/120 (47%), Gaps = 24/120 (20%)
 Frame = +1

Query: 187 SVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--LKGELC---------- 330
           S ++S    K+ M+G  FGR VDL T   YD L + LE++F+  + G+ C          
Sbjct: 372 STSSSGNLVKIYMDGVPFGRKVDLKTNDSYDKLYSMLEDMFQQYISGQYCGGRSSSSGES 431

Query: 331 ------------PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
                         S++ +IY D EGD MLVGD PW  F   V+R+ I    +   ++ K
Sbjct: 432 HWVASSRKLNFLEGSEYVLIYEDHEGDSMLVGDVPWELFVNAVKRLRIMKGSEQVNLAPK 491



>gb:AB061222_1521994 Physcomitrella patens PpIAA1a mRNA for IAA/AUX
           protein, complete cds.
          Length = 484

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 39/120 (32%), Positives = 57/120 (47%), Gaps = 24/120 (20%)
 Frame = +1

Query: 187 SVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--LKGELC---------- 330
           S ++S    K+ M+G  FGR VDL T   YD L + LE++F+  + G+ C          
Sbjct: 353 STSSSGNLVKIYMDGVPFGRKVDLKTNDSYDKLYSMLEDMFQQYISGQYCGGRSSSSGES 412

Query: 331 ------------PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
                         S++ +IY D EGD MLVGD PW  F   V+R+ I    +   ++ K
Sbjct: 413 HWVASSRKLNFLEGSEYVLIYEDHEGDSMLVGDVPWELFVNAVKRLRIMKGSEQVNLAPK 472



>sp|Q9FGV1|ARFH_ARATH Auxin response factor 8.>gb:AY669790_1620755
           Arabidopsis thaliana clone C105345 ARF8 (At5g37020)
           mRNA, complete cds.>gb:AF042196_1763625 Arabidopsis
           thaliana auxin response factor 8 (ARF8) mRNA, complete
           cds.
          Length = 811

 Score = 62.8 bits (151), Expect = 2e-08
 Identities = 35/95 (36%), Positives = 54/95 (56%), Gaps = 2/95 (2%)
 Frame = +1

Query: 187 SVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYA 360
           S   ++   KV   GS  GR++D++    Y +L  EL ++F ++G L    RS W++++ 
Sbjct: 700 SSNQTKNFVKVYKSGS-VGRSLDISRFSSYHELREELGKMFAIEGLLEDPLRSGWQLVFV 758

Query: 361 DDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
           D E D++L+GDDPW  F   V  I I S E V +M
Sbjct: 759 DKENDILLLGDDPWESFVNNVWYIKILSPEDVHQM 793



>gb:AF027157_1762245 Arabidopsis thaliana auxin-responsive protein
           IAA2 gene, complete cds.
          Length = 174

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 49/162 (30%), Positives = 74/162 (45%), Gaps = 16/162 (9%)
 Frame = +1

Query: 34  KETPCSNTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSK----PSVTTS 201
           K+T     +P     + +   V  V K  + +   E +  E S   T ++    P V +S
Sbjct: 12  KDTELCLGLPGRTEKIKEEQEVSCV-KINNKRLFEETRDEEESTPPTKTQIVGWPPVRSS 70

Query: 202 R------TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKW 345
           R      +  KV M+G+ + R +DL T K+Y +LL  LE +F++  GE C R     S +
Sbjct: 71  RKNNNSVSYVKVSMDGAPYLRKIDLKTYKNYPELLKALENMFKVMIGEYCEREGYKGSGF 130

Query: 346 EVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
              Y D +GD MLVGD PW  F    +R+ I        + S
Sbjct: 131 VPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIMKGSDAPALDS 172



>sp|Q9M1R4|IAAU_ARATH Putative auxin-responsive protein IAA30
           (Putative indoleacetic acid- induced protein
           30).>pir|T48002|T48002 auxin-induced protein homolog -
           Arabidopsis thaliana>gb:ATT17J13_1554721 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T17J13.
          Length = 172

 Score = 62.4 bits (150), Expect = 3e-08
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL------KGELCPRSKWEVIYADDEGD 375
           KV MEG   GR +DL ++  Y DL+  L+ +F        + ++C      + YAD EGD
Sbjct: 86  KVNMEGVPIGRKIDLLSLNGYHDLITTLDYMFNASILWAEEEDMCSEKSHVLTYADKEGD 145

Query: 376 MMLVGDDPWPEFCKMVRRIFI 438
            M+VGD PW  F   VRR+ I
Sbjct: 146 WMMVGDVPWEMFLSSVRRLKI 166



>sp|Q9XFM0|IAAS_ARATH Auxin-responsive protein IAA28 (Indoleacetic
           acid-induced protein 28).>pir|T52143|T52143
           auxin-induced protein IAA28 [imported] - Arabidopsis
           thaliana>gb:BT000427_1634705 Arabidopsis thaliana
           putative protein (At5g25890) mRNA, complete
           cds.>gb:BT002175_1635778 Arabidopsis thaliana putative
           protein (At5g25890) mRNA, complete
           cds.>gb:AF149816_1772540 Arabidopsis thaliana IAA28
           (IAA28) mRNA, complete cds.
          Length = 175

 Score = 62.0 bits (149), Expect = 4e-08
 Identities = 34/118 (28%), Positives = 61/118 (51%), Gaps = 1/118 (0%)
 Frame = +1

Query: 124 LKSSREIKLVEASLKDTLSKPSVTTSRTC-TKVQMEGSRFGRAVDLTTMKDYDDLLNELE 300
           ++SSR  + + A LK+ + K      +    K+ MEG   GR V+L+   +Y  L + ++
Sbjct: 55  VRSSR--RNLTAQLKEEMKKKESDEEKELYVKINMEGVPIGRKVNLSAYNNYQQLSHAVD 112

Query: 301 EIFELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
           ++F  K       ++ ++Y D EGD +LVGD PW  F   V+R+ +  +     +S +
Sbjct: 113 QLFSKKDSWDLNRQYTLVYEDTEGDKVLVGDVPWEMFVSTVKRLHVLKTSHAFSLSPR 170



>gb:ATU49076_1557047 Arabidopsis thaliana early auxin-induced
           (IAA20) mRNA, partial cds.
          Length = 166

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL------KGELCPRSKWEVIYADDEGD 375
           KV MEG   GR +DL ++  Y DL+  L+ +F        + ++C      + YAD EGD
Sbjct: 79  KVNMEGVPIGRKIDLMSLNGYRDLIRTLDFMFNASILWAEEEDMCNEKSHVLTYADKEGD 138

Query: 376 MMLVGDDPWPEFCKMVRRIFI 438
            M+VGD PW  F   VRR+ I
Sbjct: 139 WMMVGDVPWEMFLSTVRRLKI 159



>gb:AB026823_1517414 Cucumis sativus CsIAA3 mRNA for Aux/IAA
           protein, complete cds.
          Length = 180

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 6/100 (6%)
 Frame = +1

Query: 181 KPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SK 342
           K   T +    KV M+G+ F R VDL   + Y DLL  LE +F+   G+ C R     S+
Sbjct: 81  KKEETAAGMFIKVSMDGAPFLRKVDLKIYQGYPDLLQALENMFKFSLGKFCEREGYNGSE 140

Query: 343 WEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKK 462
           +   Y D +GD MLVGD PW  F    +R+ I    ++ K
Sbjct: 141 FVPTYEDKDGDWMLVGDVPWEMFMSSCKRLRIMKRLRIMK 180



>sp|O24410|IAAK_ARATH Auxin-responsive protein IAA20 (Indoleacetic
           acid-induced protein 20).>pir|T02188|T02188
           auxin-induced protein IAA20 [imported] - Arabidopsis
           thaliana>gb:AC004411_1531680 Arabidopsis thaliana
           chromosome 2 clone F14M4 map CIC06C03, complete
           sequence.>gb:AF348576_1790120 Arabidopsis thaliana clone
           C00049 (f) auxin-induced protein IAA20 (At2g46990) mRNA,
           complete cds.>gb:AK117233_1815278 Arabidopsis thaliana
           At2g46990 mRNA for putative auxin-induced protein,
           complete cds, clone: RAFL16-78-L02.
          Length = 175

 Score = 61.2 bits (147), Expect = 6e-08
 Identities = 32/81 (39%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL------KGELCPRSKWEVIYADDEGD 375
           KV MEG   GR +DL ++  Y DL+  L+ +F        + ++C      + YAD EGD
Sbjct: 88  KVNMEGVPIGRKIDLMSLNGYRDLIRTLDFMFNASILWAEEEDMCNEKSHVLTYADKEGD 147

Query: 376 MMLVGDDPWPEFCKMVRRIFI 438
            M+VGD PW  F   VRR+ I
Sbjct: 148 WMMVGDVPWEMFLSTVRRLKI 168



>sp|P33077|IAA4_ARATH Auxin-responsive protein IAA4 (Indoleacetic
           acid-induced protein 4) (Auxin-induced protein
           AUX2-11).>gb:AB026651_1517262 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MQD19.>gb:ATAUX211_1544124 A.thaliana
           auxin-inducible gene Aux2-11.>gb:ATHIAA4A_1553242
           Arabidopsis thaliana auxin-responsive protein (IAA4)
           mRNA, 5' partial cds.>gb:BT005853_1638775 Arabidopsis
           thaliana At5g43700 gene, complete cds.
          Length = 186

 Score = 59.3 bits (142), Expect = 2e-07
 Identities = 34/88 (38%), Positives = 47/88 (53%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DLT  K Y +L+  LE +F+   GE   R     S +   Y D +GD
Sbjct: 92  KVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKFSVGEYFEREGYKGSDFVPTYEDKDGD 151

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    +R+ I    +VK
Sbjct: 152 WMLVGDVPWEMFVSSCKRLRIMKGSEVK 179



>gb:AF123505_1769920 Nicotiana tabacum Nt-iaa2.5 deduced protein
           mRNA, partial cds.
          Length = 176

 Score = 58.9 bits (141), Expect = 3e-07
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 6/89 (6%)
 Frame = +1

Query: 211 TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEG 372
           +KV M+G+ + R +DL   K Y +LL  LE +F+L  GE   R     S++   Y D +G
Sbjct: 82  SKVSMDGAPYLRKIDLEMYKGYSELLKALENMFKLNIGEYSEREGYKGSEFAPAYEDKDG 141

Query: 373 DMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
           D+MLVGD PW  F    +R+ I    + +
Sbjct: 142 DLMLVGDVPWDMFLSSCKRLRIMKGAEAR 170



>gb:AF123504_1769919 Nicotiana tabacum Nt-iaa2.3 deduced protein
           mRNA, complete cds.
          Length = 179

 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 35/99 (35%), Positives = 51/99 (51%), Gaps = 6/99 (6%)
 Frame = +1

Query: 181 KPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SK 342
           K + T      KV M+G+ + R +DL   K Y +LL  LE +F+L  GE   R     S+
Sbjct: 75  KKTETECGMYVKVSMDGAPYLRKIDLKMYKGYAELLKALENMFKLSIGEYSEREGYNGSE 134

Query: 343 WEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
           +   Y D +GD+MLVGD PW  F    +R+ I    + +
Sbjct: 135 FAPAYEDKDGDLMLVGDVPWDMFLSSCKRLRIMKGSEAR 173



>gb:OSA437536_1692579 Oryza sativa mRNA for manganese-binding
            PsbY-like protein precursor (MgBP1 gene).
          Length = 205

 Score = 58.5 bits (140), Expect = 4e-07
 Identities = 54/165 (32%), Positives = 72/165 (43%), Gaps = 8/165 (4%)
 Frame = +1

Query: 1039 PIISLLSMKNLPKGLSACNTDKSVVSSALTGTALAGAIFSALSVSEPXXXXXX----XXX 1206
            P ISL S+    KG+S  +   S  ++ +   A+AGA FSAL+ ++              
Sbjct: 31   PSISLKSLAK--KGMSVSS---SSAAAPVAAAAMAGAFFSALASTDAALAAQQIADVAAA 85

Query: 1207 XXXDGDNRGXXXXXXXXXXXXWVLFNILQPALNQINKMRSTKGVIIXXXXXXXTAAQF-I 1383
                 DNRG            WVL+NILQPALNQ+N+MRS + ++          A    
Sbjct: 86   AAGADDNRGLALLLPIAPAIAWVLYNILQPALNQLNRMRSEQVLVAGLGLGAAAGAGLAF 145

Query: 1384 HPY---XXXXXXXXXXXXXXXNDSRGQLLLIVVAPALLWVGYNIL 1509
             P                     +RG L      PA+ WV YNIL
Sbjct: 146  RPXVXGAXSGXLXAEAAAAXGGXNRG-LXCCSWWPAIAWVLYNIL 189



 Score = 57.4 bits (137), Expect = 9e-07
 Identities = 26/37 (70%), Positives = 32/37 (86%)
 Frame = +1

Query: 1438 NDSRGQLLLIVVAPALLWVGYNILQPALNQLNKMRSE 1548
            +D+RG  LL+ +APA+ WV YNILQPALNQLN+MRSE
Sbjct: 90   DDNRGLALLLPIAPAIAWVLYNILQPALNQLNRMRSE 126



>pir|S12243|S12243 auxin-induced protein AUX2-11 - Arabidopsis
           thaliana
          Length = 186

 Score = 57.4 bits (137), Expect = 9e-07
 Identities = 33/88 (37%), Positives = 47/88 (53%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DLT  K Y +L+  LE +F+   GE   R     S +   Y D EG+
Sbjct: 92  KVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKFSVGEYFEREGYKGSDFVPTYEDKEGE 151

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVG+ PW  F    +R+ I    +VK
Sbjct: 152 WMLVGEVPWEMFVSSCKRLRIMKGSEVK 179



>gb:AY137962_1582214 Mirabilis jalapa clone RS-31 Aux/IAA2 mRNA,
           partial cds.
          Length = 93

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 33/92 (35%), Positives = 49/92 (53%), Gaps = 6/92 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DL   + Y +LL  LE +F+++ G    R     S +   Y D +GD
Sbjct: 2   KVSMDGAPYLRKIDLKVYQSYAELLRGLENMFKVRIGSYSERDGYNGSDYVPTYEDKDGD 61

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
            MLVGD PW  F    +R+ I  S + K + S
Sbjct: 62  WMLVGDVPWEMFISSCKRLRIMKSSEAKGLGS 93



>sp|Q8H174|IAAV_ARATH Auxin-responsive protein IAA31 (Indoleacetic
           acid-induced protein 31).>gb:AB022219_1515116
           Arabidopsis thaliana genomic DNA, chromosome 3, P1
           clone: MKP6.>gb:AY054274_1563094 Arabidopsis thaliana
           AT3g17600/MKP6_15 mRNA, complete cds.
          Length = 158

 Score = 57.0 bits (136), Expect = 1e-06
 Identities = 37/108 (34%), Positives = 53/108 (49%), Gaps = 7/108 (6%)
 Frame = +1

Query: 151 VEASLKDTLSKPSVTTSRTCT----KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK 318
           +++ L+DTL    +      T    KV MEG   GR +DL     Y+ LL  L  +F+  
Sbjct: 51  IKSRLRDTLKGRRLLRRGDDTSLFVKVYMEGVPIGRKLDLCVFSGYESLLENLSHMFDTS 110

Query: 319 GELC---PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
             +C    R    + Y D +GD M+VGD PW  F + VRR+ I   E+
Sbjct: 111 -IICGNRDRKHHVLTYEDKDGDWMMVGDIPWDMFLETVRRLKITRPER 157



>gb:BT000543_1634821 Arabidopsis thaliana putative auxin-induced
           protein (At3g17600/MKP6_15) mRNA, complete cds.
          Length = 158

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 37/108 (34%), Positives = 53/108 (49%), Gaps = 7/108 (6%)
 Frame = +1

Query: 151 VEASLKDTLSKPSVTTSRTCT----KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK 318
           +++ L+DTL    +      T    KV MEG   GR +DL     Y+ LL  L  +F+  
Sbjct: 51  IKSRLRDTLKGRRLLRRGDDTSLFVKVYMEGVPIGRKLDLCVFSGYESLLENLSHMFDTS 110

Query: 319 GELC---PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
             +C    R    + Y D +GD M+VGD PW  F + VRR+ I   E+
Sbjct: 111 -IICGNRDRKHHVLTYEDKDGDWMMVGDIPWDMFLETVRRLKIPRPER 157



>gb:AB026821_1517412 Cucumis sativus CsIAA1 mRNA for Aux/IAA
           protein, complete cds.
          Length = 188

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 32/82 (39%), Positives = 45/82 (54%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGD 393
           KV  EG+ F R VDL  +K Y DL+  +E++F   G      ++ V Y D +GD MLVGD
Sbjct: 101 KVSFEGTPFLRKVDLGMVKGYGDLVGAMEKLF---GSPIGCYEYTVTYEDRDGDWMLVGD 157

Query: 394 DPWPEFCKMVRRIFICSSEKVK 459
            PW  F +  +R+ I    + K
Sbjct: 158 VPWKMFIESCKRLRIMKKTEGK 179



>gb:AB024026_1515710 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K15O15.
          Length = 821

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 9/106 (8%)
 Frame = +1

Query: 187  SVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCP--RSKWEVIYA 360
            S   ++   KV   GS  GR++D++    Y +L  EL ++F ++G L    RS W++++ 
Sbjct: 700  SSNQTKNFVKVYKSGS-VGRSLDISRFSSYHELREELGKMFAIEGLLEDPLRSGWQLVFV 758

Query: 361  DDEGDMMLVGDDPWPEF-------CKMVRRIFICSSEKVKKMSSKC 477
            D E D++L+GDDPW  +        +++ +  +  S K + +S  C
Sbjct: 759  DKENDILLLGDDPWEYYHQKMCIKWEIMEKAVVGYSRKTRPISRSC 804



>sp|O24542|AX2D_PHAAU Auxin-induced protein 22D (Indole-3-acetic
           acid induced protein ARG13).>pir|T10884|T10884
           auxin-induced protein Aux22d - mung
           bean>gb:AB004932_1509224 Vigna radiata mRNA for Aux22d,
           complete cds.
          Length = 193

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE-LKGELCPR-----SKWEVIYADDEGD 375
           KV M G+ + R +DL   K Y +LL  LE +F+ + GE   R     S++   Y D +GD
Sbjct: 101 KVSMAGAPYLRKIDLKVYKSYPELLKALENMFKCIFGEYSEREGYNGSEYAPTYEDKDGD 160

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    +R+ I    + K
Sbjct: 161 WMLVGDVPWNMFVSSCKRLRIMKGSEAK 188



>gb:AY062215_1565008 Antirrhinum majus auxin-induced AUX/IAA1 mRNA,
           partial cds.
          Length = 172

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 45/155 (29%), Positives = 72/155 (46%), Gaps = 15/155 (9%)
 Frame = +1

Query: 31  EKETPCSNTMPSNANAVCDANGVGAVQKS----EHLKSSREIKLV-----EASLKDTLSK 183
           E E   S+++ +N N    +   G+ QKS    E +  + + ++V      +  K+ +  
Sbjct: 14  ESEPQTSSSIKNNNNKRSSSEMQGSCQKSTQQEESIAPAPKAQVVGWPPVRSFRKNVMKA 73

Query: 184 PSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKW 345
                S    KV M+G+ + R +DL    +Y DLL  LE +F+   G    R     S++
Sbjct: 74  SESDGSGMFVKVSMDGAPYLRKIDLKFYNNYFDLLKALENMFKCTIGVYSEREGYNGSEF 133

Query: 346 EVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSE 450
              Y D +GD MLVGD PW  F    +R+ I  S+
Sbjct: 134 APTYEDKDGDWMLVGDVPWDMFITSCKRLRIMQSK 168



>gb:AB023482_1515593 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone P0680A03.>gb:AP002536_1822479
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, BAC clone:OSJNBa0015I14.
          Length = 183

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF-----ELKGELCPRSKWEVIYADDEGDM 378
           KV+MEG   GR +DL+ +  Y +LL+ L  +F     E   +   R  + V Y D EGD 
Sbjct: 102 KVKMEGLAIGRKLDLSILGSYAELLDTLHLMFPSTNQEDGHDRRRRHPYAVTYEDGEGDW 161

Query: 379 MLVGDDPWPEFCKMVRRIFI 438
           M VGD PW  F K V+R+ I
Sbjct: 162 MQVGDVPWEAFAKSVKRLKI 181



>sp|P13088|AX22_SOYBN Auxin-induced protein AUX22.>pir|B28993|B28993
           auxin-induced protein aux22 -
           soybean>gb:SOYAUX22_1715966 Soybean auxin-regulated
           protein (Aux22) mRNA, complete cds.
          Length = 195

 Score = 55.8 bits (133), Expect = 3e-06
 Identities = 33/92 (35%), Positives = 46/92 (50%), Gaps = 5/92 (5%)
 Frame = +1

Query: 199 SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL-----CPRSKWEVIYAD 363
           S+   KV M+G+ F R +DL   K Y DL   L+++F   G +        S+   IY D
Sbjct: 85  SKMYVKVSMDGAPFLRKIDLGLHKGYSDLALALDKLFGCYGMVEALKNADNSEHVPIYED 144

Query: 364 DEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            +GD MLVGD PW  F +  +R+ I      K
Sbjct: 145 KDGDWMLVGDVPWEMFMESCKRLRIMKKSDAK 176



>gb:AY088042_1573066 Arabidopsis thaliana clone 40608 mRNA, complete
           sequence.
          Length = 239

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 12/99 (12%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF-ELKGELCPR-----------SKWEVIY 357
           KV M+G   GR VD+     Y++L   LEE+F  + G  C             S + + Y
Sbjct: 128 KVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGSSDFVLTY 187

Query: 358 ADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
            D EGD MLVGD PW  F   V+R+ I  + +   ++ +
Sbjct: 188 EDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPR 226



>sp|Q38830|IAAC_ARATH Auxin-responsive protein IAA12 (Indoleacetic
           acid-induced protein 12) (BODENLOS
           protein).>pir|S58498|S58498 IAA12 protein - Arabidopsis
           thaliana>gb:AE005172_889475 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATU18414_1556800 Arabidopsis thaliana IAA12
           (IAA12) gene, complete cds.>gb:AY065240_1566392
           Arabidopsis thaliana auxin-induced protein IAA12
           (At1g04550) mRNA, complete cds.>gb:AY096535_1576077
           Arabidopsis thaliana auxin-induced protein IAA12
           (At1g04550) mRNA, complete cds.>gb:T1G11_1723599
           Sequence of BAC T1G11 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AF332398_1787211
           Arabidopsis thaliana auxin-induced protein, IAA12
           (At1g04550) mRNA, complete cds.
          Length = 239

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 12/99 (12%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF-ELKGELCPR-----------SKWEVIY 357
           KV M+G   GR VD+     Y++L   LEE+F  + G  C             S + + Y
Sbjct: 128 KVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGSSDFVLTY 187

Query: 358 ADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
            D EGD MLVGD PW  F   V+R+ I  + +   ++ +
Sbjct: 188 EDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPR 226



>sp|P49679|IAA4_PEA Auxin-induced protein IAA4.>pir|S39075|S39075
           auxin-induced protein IAA4/5 - garden
           pea>gb:PSPIAA45R_1702348 P.sativum mRNA for pIAA4/5.1.
          Length = 189

 Score = 55.5 bits (132), Expect = 4e-06
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DL     Y +LL  LE +F+L  GE   R     S++   Y D +GD
Sbjct: 96  KVSMDGAPYLRKIDLRVYGGYSELLKALETMFKLTIGEYSEREGYKGSEYAPTYEDKDGD 155

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    +R+ I    + K
Sbjct: 156 WMLVGDVPWDMFVTSCKRLRIMKGTEAK 183



>gb:AP005681_1855911 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1439_F07.
          Length = 140

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 31/90 (34%), Positives = 50/90 (55%), Gaps = 4/90 (4%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK--GELCPRSKWE--VIYADDEGDMM 381
           KV M+G+ + R VD+    DY +L+  L ++F     G +    +WE  V+Y D +GD M
Sbjct: 49  KVSMDGTPYLRKVDVAAYGDYLELVEALNDMFYCSTIGLMDGYGEWEHAVVYEDGDGDWM 108

Query: 382 LVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
           LVGD PW  F    +R+ +  + + + +SS
Sbjct: 109 LVGDVPWEMFVSSCKRMRVMRACEARGLSS 138



>gb:AC145396_1744454 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0042F15, complete
           sequence.>gb:AC145477_1744489 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone B1402B06, complete
           sequence.
          Length = 257

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 32/82 (39%), Positives = 44/82 (53%), Gaps = 7/82 (8%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF-------ELKGELCPRSKWEVIYADDEG 372
           KV M+G+ + R VDL T K+Y DL   LE++F       +   E     ++ + Y D +G
Sbjct: 155 KVSMDGAPYLRKVDLKTYKNYKDLSTALEKMFIGFTTGKDGLSESRKDGEYVLTYEDKDG 214

Query: 373 DMMLVGDDPWPEFCKMVRRIFI 438
           D MLVGD PW  F    RR+ I
Sbjct: 215 DWMLVGDVPWEMFANSCRRLRI 236



>pir|S58499|S58499 auxin regulated protein (IAA13) [imported] -
           Arabidopsis thaliana>gb:AC002332_1530303 Arabidopsis
           thaliana chromosome 2 clone F4P9 map ve015, complete
           sequence.>gb:ATU18415_1556801 Arabidopsis thaliana IAA13
           (IAA13) gene, complete cds.>gb:AY085194_1570273
           Arabidopsis thaliana clone 13741 mRNA, complete
           sequence.>gb:AF332399_1787212 Arabidopsis thaliana clone
           C00020 (e) auxin-regulated protein IAA13 (At2g33310)
           mRNA, complete cds.
          Length = 246

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 37/143 (25%), Positives = 63/143 (44%), Gaps = 15/143 (10%)
 Frame = +1

Query: 103 AVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDD 282
           A + +   + + + K+ +   KD   K +        KV M+G   GR VDL     Y++
Sbjct: 95  ATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVGFIKVNMDGVAIGRKVDLNAHSSYEN 154

Query: 283 LLNELEEIFELKGE---------------LCPRSKWEVIYADDEGDMMLVGDDPWPEFCK 417
           L   LE++F                    L   S++ + Y D EGD MLVGD PW  F  
Sbjct: 155 LAQTLEDMFFRTNPGTVGLTSQFTKPLRLLDGSSEFVLTYEDKEGDWMLVGDVPWRMFIN 214

Query: 418 MVRRIFICSSEKVKKMSSKCKLP 486
            V+R+ +  + +   ++++ + P
Sbjct: 215 SVKRLRVMKTSEANGLAARNQEP 237



>sp|Q38831|IAAD_ARATH Auxin-responsive protein IAA13 (Indoleacetic
           acid-induced protein 13).>gb:BT005874_1638796
           Arabidopsis thaliana At2g33310 gene, complete cds.
          Length = 247

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 37/143 (25%), Positives = 63/143 (44%), Gaps = 15/143 (10%)
 Frame = +1

Query: 103 AVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDD 282
           A + +   + + + K+ +   KD   K +        KV M+G   GR VDL     Y++
Sbjct: 96  ATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVGFIKVNMDGVAIGRKVDLNAHSSYEN 155

Query: 283 LLNELEEIFELKGE---------------LCPRSKWEVIYADDEGDMMLVGDDPWPEFCK 417
           L   LE++F                    L   S++ + Y D EGD MLVGD PW  F  
Sbjct: 156 LAQTLEDMFFRTNPGTVGLTSQFTKPLRLLDGSSEFVLTYEDKEGDWMLVGDVPWRMFIN 215

Query: 418 MVRRIFICSSEKVKKMSSKCKLP 486
            V+R+ +  + +   ++++ + P
Sbjct: 216 SVKRLRVMKTSEANGLAARNQEP 238



>sp|O24543|AX2E_PHAAU Auxin-induced protein 22E (Indole-3-acetic
           acid induced protein ARG14).>pir|T10885|T10885
           auxin-induced protein Aux22e - mung
           bean>gb:AB004933_1509225 Vigna radiata mRNA for Aux22e,
           complete cds.
          Length = 203

 Score = 55.1 bits (131), Expect = 5e-06
 Identities = 32/88 (36%), Positives = 45/88 (51%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M G+ + R +DL   K Y +LL  L+ +F+   GE   R     S++   Y D +GD
Sbjct: 111 KVSMAGAPYLRKIDLKVYKSYPELLKALQNLFKCTFGEYSEREGYNGSEYAPTYEDKDGD 170

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    +R+ I    + K
Sbjct: 171 WMLVGDVPWNMFVSSCKRLRIIKGSEAK 198



>gb:T1N24_1723668 Arabidopsis thaliana BAC T1N24.
          Length = 147

 Score = 54.7 bits (130), Expect = 6e-06
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 1/94 (1%)
 Frame = +1

Query: 124 LKSSREIKLVEASLKDTLSKPSVTTSRTC-TKVQMEGSRFGRAVDLTTMKDYDDLLNELE 300
           ++SSR  + + A LK+ + K      +    K+ MEG   GR V+L+   +Y  L + ++
Sbjct: 55  VRSSR--RNLTAQLKEEMKKKESDEEKELYVKINMEGVPIGRKVNLSAYNNYQQLSHAVD 112

Query: 301 EIFELKGELCPRSKWEVIYADDEGDMMLVGDDPW 402
           ++F  K       ++ ++Y D EGD +LVGD PW
Sbjct: 113 QLFSKKDSWDLNRQYTLVYEDTEGDKVLVGDVPW 146



>sp|P32294|AX2B_PHAAU Auxin-induced protein 22B (Indole-3-acetic
           acid induced protein ARG4).>pir|T10941|T10941
           auxin-induced protein Aux22 - mung
           bean>gb:VIRAUX22B_1727241 Vigna radiata auxin-regulated
           mRNA.
          Length = 196

 Score = 54.7 bits (130), Expect = 6e-06
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R VDL     Y +LL  LE +F+L  GE   R     S++   Y D +GD
Sbjct: 103 KVSMDGAPYLRKVDLKVYGGYPELLKALETMFKLAIGEYSEREGYKGSEYAPTYEDKDGD 162

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    +R+ I    + +
Sbjct: 163 WMLVGDVPWDMFVTSCKRLRIMKGSEAR 190



>gb:AY099670_1576695 Arabidopsis thaliana early auxin-inducible
           protein 11 (At4g28640) mRNA, complete
           cds.>gb:BT000261_1634539 Arabidopsis thaliana early
           auxin-inducible protein 11 (At4g28640) mRNA, complete
           cds.
          Length = 246

 Score = 54.3 bits (129), Expect = 8e-06
 Identities = 38/99 (38%), Positives = 47/99 (47%), Gaps = 19/99 (19%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR------------------- 336
           KV M+G   GR +DL   K Y+ L N LEE+F LK +L  R                   
Sbjct: 140 KVTMDGIPIGRKIDLNAHKCYESLSNTLEEMF-LKPKLGSRTLETDGHMETPVKILPDGS 198

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
           S   + Y D EGD MLVGD PW  F   VRR+ I  + +
Sbjct: 199 SGLVLTYEDKEGDWMLVGDVPWGMFIGSVRRLRIMKTSE 237



>sp|Q38829|IAAB_ARATH Auxin-responsive protein IAA11 (Indoleacetic
           acid-induced protein 11).>pir|S58497|S58497 early
           auxin-inducible protein IAA11 - Arabidopsis
           thaliana>gb:ATCHRIV69_1546744 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           69.>gb:ATU18413_1556799 Arabidopsis thaliana IAA11
           (IAA11) gene, complete cds.>gb:AF332397_1787210
           Arabidopsis thaliana clone C00018 (e) early
           auxin-inducible protein 11 (At4g28640) mRNA, complete
           cds.>gb:AK118377_1816358 Arabidopsis thaliana At4g28640
           mRNA for putative early auxin-inducible protein 11
           (IAA11), complete cds, clone: RAFL19-64-E04.
          Length = 246

 Score = 54.3 bits (129), Expect = 8e-06
 Identities = 38/99 (38%), Positives = 47/99 (47%), Gaps = 19/99 (19%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR------------------- 336
           KV M+G   GR +DL   K Y+ L N LEE+F LK +L  R                   
Sbjct: 140 KVTMDGIPIGRKIDLNAHKCYESLSNTLEEMF-LKPKLGSRTLETDGHMETPVKILPDGS 198

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
           S   + Y D EGD MLVGD PW  F   VRR+ I  + +
Sbjct: 199 SGLVLTYEDKEGDWMLVGDVPWGMFIGSVRRLRIMKTSE 237



>sp|Q38822|IAA3_ARATH Auxin-responsive protein IAA3 (Indoleacetic
           acid-induced protein 3) (Short hypocotyl) (Suppressor of
           HY2).>pir|S58491|S58491 auxin-induced protein IAA3 -
           Arabidopsis thaliana>gb:AE005172_889441 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATU18406_1556792 Arabidopsis thaliana IAA3
           (IAA3) gene, complete cds.>gb:AY064007_1565948
           Arabidopsis thaliana putative auxin-induced protein IAA3
           (At1g04240) mRNA, complete cds.>gb:F19P19_1677738
           Sequence of BAC F19P19 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AF332393_1787206
           Arabidopsis thaliana clone C00011 (f) auxin-induced
           protein IAA3 (At1g04240) mRNA, complete cds.
          Length = 189

 Score = 54.3 bits (129), Expect = 8e-06
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DL+  K Y +LL  LE +F+   GE   R     S +   Y D +GD
Sbjct: 96  KVSMDGAPYLRKIDLSCYKGYSELLKALEVMFKFSVGEYFERDGYKGSDFVPTYEDKDGD 155

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            ML+GD PW  F    +R+ I    + K
Sbjct: 156 WMLIGDVPWEMFICTCKRLRIMKGSEAK 183



>sp|O24541|AX2C_PHAAU Auxin-induced protein 22C (Indole-3-acetic
           acid induced protein ARG12).>pir|T10859|T10859
           auxin-induced protein Aux22c - mung
           bean>gb:AB004931_1509223 Vigna radiata mRNA for Aux22c,
           complete cds.
          Length = 188

 Score = 53.9 bits (128), Expect = 1e-05
 Identities = 35/99 (35%), Positives = 47/99 (47%), Gaps = 6/99 (6%)
 Frame = +1

Query: 181 KPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSK------ 342
           K +V   +   KV M+G+ F R +DL   K Y DL   L++ F   G +C   K      
Sbjct: 72  KNTVNEPKLYVKVSMDGAPFLRKIDLAMHKGYSDLAFALDKFFGCYG-ICEALKDAENAE 130

Query: 343 WEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
              IY D +GD MLVGD PW  F +  +R+ I      K
Sbjct: 131 HVPIYEDKDGDWMLVGDVPWEMFRESCKRLRIMKRSDAK 169



>gb:AX365265_1466305 Sequence 1 from Patent WO0206499.
          Length = 197

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 34/89 (38%), Positives = 45/89 (50%), Gaps = 14/89 (15%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE-------------LKGELCPRSKWEVI 354
           KV++EG   GR VD++    Y +LL  LE +F              +  E   R  + V 
Sbjct: 107 KVKLEGVPIGRKVDVSIHGSYQELLRTLESMFPSGNQQDHAEDEVVVSHERRRRHPYVVT 166

Query: 355 YADDEGDMMLVGDD-PWPEFCKMVRRIFI 438
           Y D EGD +LVGDD PW  F K V+R+ I
Sbjct: 167 YEDGEGDWLLVGDDVPWEVFVKSVKRLKI 195



>sp|Q9ZSY8|IAAR_ARATH Auxin-responsive protein IAA27 (Indoleacetic
           acid-induced protein 27) (Auxin-induced protein 27)
           (Phytochrome-associated protein 2).>pir|T08963|T08963
           phytochrome-associated protein PAP2 - Arabidopsis
           thaliana>gb:ATCHRIV70_1546829 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           70.>gb:ATF19B15_1549281 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19B15 (ESSA
           project).>gb:ATH458326_1552606 Arabidopsis thaliana mRNA
           for putative auxin-induced protein 27 (iaa27
           gene).>gb:AY053404_1562917 Arabidopsis thaliana
           AT4g29080/F19B15_110 mRNA, complete
           cds.>gb:AY133516_1581339 Arabidopsis thaliana
           At4g29080/F19B15_110 mRNA, complete
           cds.>gb:AF087936_1767257 Arabidopsis thaliana
           phytochrome-associated protein 2 (PAP2) mRNA, complete
           cds.>gb:AF332402_1787215 Arabidopsis thaliana clone
           C00024 (f) putative phytochrome-associated protein 2
           (At4g29080) mRNA, complete cds.
          Length = 305

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 44/167 (26%), Positives = 70/167 (41%), Gaps = 21/167 (12%)
 Frame = +1

Query: 34  KETPCSNTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCT 213
           KE   S T P++   V     + + +K+    S  +     +  ++  +K          
Sbjct: 129 KEKKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLYV 188

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL---------------------KGELC 330
           KV MEG+ + R +DL T K Y +L + LE++F                         +L 
Sbjct: 189 KVSMEGAPYLRKIDLKTYKSYLELSSALEKMFSCFTIGQFGSHGGCGRDGLNESRLTDLL 248

Query: 331 PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
             S++ V Y D + D MLVGD PW         +FICS +K++ M S
Sbjct: 249 RGSEYVVTYEDKDSDWMLVGDVPW--------EMFICSCKKLRIMKS 287



>sp|P32293|AX2A_PHAAU Auxin-induced protein 22A (Indole-3-acetic
           acid induced protein ARG3).>pir|T10939|T10939
           auxin-induced protein aux22 - mung
           bean>gb:VIRAUX22A_1727240 Vigna radiata auxin-regulated
           mRNA.
          Length = 194

 Score = 53.5 bits (127), Expect = 1e-05
 Identities = 34/92 (36%), Positives = 45/92 (48%), Gaps = 5/92 (5%)
 Frame = +1

Query: 199 SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWE-----VIYAD 363
           S+   KV M+G+ F R +DL   K Y DL   LE++F   G +      E      IY D
Sbjct: 84  SKMYVKVSMDGAPFLRKMDLGMHKGYSDLAFALEKLFGCYGMVEALKNVENGEHVPIYED 143

Query: 364 DEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            +GD MLVGD PW  F +  +R+ I      K
Sbjct: 144 KDGDWMLVGDVPWEMFMESCKRLRIMKRADAK 175



>gb:AP002743_1822682 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0710E05.
          Length = 238

 Score = 53.1 bits (126), Expect = 2e-05
 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 17/110 (15%)
 Frame = +1

Query: 169 DTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------ 312
           D  SK          K+ M+G   GR VDL     Y  L   ++++F             
Sbjct: 107 DKASKDGGAEKGMFVKINMDGVPIGRKVDLAAYGGYAQLSAAVDKLFRGLLAAQSAAADG 166

Query: 313 -----LKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSS 447
                  GE+    ++ ++Y DDEGD MLVGD PW  F    +R+ +  S
Sbjct: 167 EADAAAAGEMVGGGEYTLVYEDDEGDRMLVGDVPWQMFIATAKRLRVLKS 216



>gb:PTR306826_1702720 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA3 gene).
          Length = 174

 Score = 53.1 bits (126), Expect = 2e-05
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 7/102 (6%)
 Frame = +1

Query: 172 TLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWE- 348
           T  +   ++S    KV MEG + GR ++L     Y DL+  L+++F     L P    E 
Sbjct: 74  TSEENEYSSSTLFVKVYMEGIQIGRKLNLLAHDGYHDLIQTLDQMFNTS-ILWPEMDVEH 132

Query: 349 ------VIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
                 + Y D EGD ++VGD PW  F   VRR+ I  ++ +
Sbjct: 133 SGKCHVLTYEDQEGDWLIVGDVPWEVFLPSVRRLKITRADSL 174



>gb:AY098938_1576502 Solanum tuberosum Aux/IAA protein mRNA,
           complete cds.
          Length = 349

 Score = 52.4 bits (124), Expect = 3e-05
 Identities = 47/166 (28%), Positives = 71/166 (42%), Gaps = 31/166 (18%)
 Frame = +1

Query: 34  KETPCSNTMPSNANAVCDAN---GVGAVQKSEH------LKSSREIKLVEASLKDTLSKP 186
           K+    +T+P   +AV DA+   G GA            ++S R+  L  AS  +     
Sbjct: 164 KDANTQSTVPERPSAVNDASNRAGSGAPATKAQVVGWPPIRSFRKNTLASASKNNEEVDG 223

Query: 187 SVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF------------------- 309
              +     KV M+G+ + R VDL T   Y +L + LE +F                   
Sbjct: 224 KAGSPALFIKVSMDGAPYLRKVDLRTYSAYQELSSALETMFSCFTIGQYGSHGAPGKDML 283

Query: 310 ---ELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
              +LK +L   S++ + Y D +GD MLVGD PW  F    +R+ I
Sbjct: 284 SESKLK-DLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLRI 328



>gb:ATHIAA1A_1553240 Arabidopsis thaliana auxin-responsive protein
           (IAA1) mRNA, 5' partial cds.
          Length = 168

 Score = 52.4 bits (124), Expect = 3e-05
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DL   K+Y +LL  LE +F+   GE   R     S +   Y D +GD
Sbjct: 78  KVSMDGAPYLRKIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKGSGFVPTYEDKDGD 137

Query: 376 MMLVGDDPWPEFCKMVRRIFI 438
            MLVGD PW  F    +++ I
Sbjct: 138 WMLVGDVPWDMFSSSCQKLRI 158



>gb:AC069158_1540668 Genomic Sequence for Oryza sativa, Nipponbare
           strain, clone OSJNBa0049O12, from chromosome 2, complete
           sequence.>gb:AP004240_1839145 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1548_F12.
          Length = 182

 Score = 52.4 bits (124), Expect = 3e-05
 Identities = 34/107 (31%), Positives = 47/107 (43%), Gaps = 16/107 (14%)
 Frame = +1

Query: 166 KDTLSKPSVTTSRTC------TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGEL 327
           K  +  P V+++R         KV+ EG   GR VDL     YD+L   L  +F      
Sbjct: 74  KTVVGWPPVSSARRACGGANYVKVKKEGDAIGRKVDLALHSSYDELAATLARMFPTNDHQ 133

Query: 328 CPRSKWE----------VIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
             +              V Y D +GD MLVGD PW +F + V+R+ I
Sbjct: 134 GEKKMANDDHGDAAGPVVTYEDGDGDWMLVGDVPWDDFARSVKRLKI 180



>sp|P49677|IAA1_ARATH Auxin-responsive protein IAA1 (Indoleacetic
           acid-induced protein 1).>pir|A71408|A71408 auxin-induced
           protein IAA1 - Arabidopsis thaliana>gb:ATCHRIV39_1545220
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 39.>gb:ATFCA1_1551506 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No.
           1.>gb:AY133714_1581534 Arabidopsis thaliana clone C00009
           auxin-responsive protein IAA1 (At4g14560) mRNA, complete
           cds.>gb:AK176546_1818534 Arabidopsis thaliana mRNA for
           auxin-responsive protein IAA1, complete cds, clone:
           RAFL25-06-K23.
          Length = 168

 Score = 52.4 bits (124), Expect = 3e-05
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DL   K+Y +LL  LE +F+   GE   R     S +   Y D +GD
Sbjct: 78  KVSMDGAPYLRKIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKGSGFVPTYEDKDGD 137

Query: 376 MMLVGDDPWPEFCKMVRRIFI 438
            MLVGD PW  F    +++ I
Sbjct: 138 WMLVGDVPWDMFSSSCQKLRI 158



>gb:AP001550_1821298 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0431F01.>gb:AP001859_1821444 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0485D09.
          Length = 263

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF------ELKGELCPRSKWEVIYADDEGD 375
           KV M+G+ + R VDL T K+Y D+   LE++F      +   E     ++ + Y D +GD
Sbjct: 162 KVSMDGAPYLRKVDLKTYKNYKDMSLGLEKMFIGFSTGKEGAENQKDGEYVLTYEDKDGD 221

Query: 376 MMLVGDDPWPEFCKMVRRIFI 438
            MLVGD PW  F    RR+ I
Sbjct: 222 WMLVGDVPWEMFTDSCRRLRI 242



>gb:AF123507_1769922 Nicotiana tabacum Nt-iaa4.5 deduced protein
           mRNA, complete cds.
          Length = 195

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 31/88 (35%), Positives = 42/88 (47%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G  + R +DL     Y +LL  L+ +F+   G    R     S +   Y D +GD
Sbjct: 101 KVSMDGGTYLRKIDLKVYNSYPELLKALQNMFKCTIGVYTEREGYNGSDYAPTYEDKDGD 160

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    RR+ I    + K
Sbjct: 161 WMLVGDVPWDMFLNSCRRLRIMKGSEAK 188



>gb:AF088281_1767266 Arabidopsis thaliana phytochrome-associated
           protein 1 (PAP1) mRNA, complete cds.
          Length = 267

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 18/99 (18%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------------LKGELCPRS 339
           K+ M+G   GR VDL     Y+ L   ++++F                   + G L  + 
Sbjct: 153 KINMDGVPIGRKVDLNAYNSYEQLSFVVDKLFRGLLAAQRDISDGQGEEKPIIGLLDGKG 212

Query: 340 KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           ++ + Y D+EGD MLVGD PW  F   V+R+ +  S ++
Sbjct: 213 EFTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKSSEI 251



>gb:AY337616_1600425 Gossypium barbadense Gbiaa-Re (iaa-re) mRNA,
           complete cds.
          Length = 190

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 30/88 (34%), Positives = 44/88 (50%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DL     Y +LL  +E +F+   GE   R     S +   Y D +GD
Sbjct: 97  KVSMDGAPYLRKIDLKIYSGYPELLQAIENMFKFTIGEYSEREGYKGSDYAPTYEDKDGD 156

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    +R+ I    + +
Sbjct: 157 WMLVGDVPWEMFITSCKRLRIMKGSEAR 184



>gb:AY088753_1573766 Arabidopsis thaliana clone 94231 mRNA, complete
           sequence.
          Length = 197

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-----ELCPRSKWEVIYADDEGDM 378
           KV M+G  + R +DL + + YDDL   L+++F  +G     +     ++  IY D +GD 
Sbjct: 100 KVSMDGVPYLRKMDLGSSQGYDDLAFSLDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDW 159

Query: 379 MLVGDDPWPEFCKMVRRIFI 438
           ML GD PW  F +  +R+ I
Sbjct: 160 MLAGDXPWGMFLESCKRLRI 179



>gb:AY087745_1572773 Arabidopsis thaliana clone 38146 mRNA, complete
           sequence.
          Length = 269

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 18/99 (18%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------------LKGELCPRS 339
           K+ M+G   GR VDL     Y+ L   ++++F                   + G L  + 
Sbjct: 155 KINMDGVPIGRKVDLNAYNSYEQLSFVVDKLFRGLLAAQRDISDGQGEEKPIIGLLDGKG 214

Query: 340 KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           ++ + Y D+EGD MLVGD PW  F   V+R+ +  S ++
Sbjct: 215 EFTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKSSEI 253



>gb:AY082522_1569184 Vitis vinifera Aux/IAA protein mRNA, complete
           cds.
          Length = 359

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 47/163 (28%), Positives = 70/163 (42%), Gaps = 22/163 (13%)
 Frame = +1

Query: 25  RREKETPCSNTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSR 204
           R   ETP ++T   N N+   A     V     ++S R+  L   S K+T          
Sbjct: 182 RATNETPPNHTGTGNNNSSAPATKAQVVGWPP-IRSFRKNTLATTS-KNTEVDGKAGPGA 239

Query: 205 TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF----------------------ELK 318
              KV M+G+ + R VDL     Y +L + LE++F                      +LK
Sbjct: 240 LFVKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLK 299

Query: 319 GELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSS 447
            +L   S++ + Y D +GD MLVGD PW  F +  +R+ I  S
Sbjct: 300 -DLLHGSEYVLTYEDKDGDWMLVGDVPWQMFIETCKRLRIMKS 341



>sp|Q8LAL2|IAAQ_ARATH Auxin-responsive protein IAA26 (Indoleacetic
           acid-induced protein 26) (Phytochrome-associated protein
           1).>gb:AY072502_1567319 Arabidopsis thaliana
           phytochrome-associated protein 1 (At3g16500; MDC8.13)
           mRNA, complete cds.>gb:AF332394_1787207 Arabidopsis
           thaliana clone C00012 (f) auxin-induced protein AUX2-11
           (At5g43700) mRNA, complete cds.>gb:AF332401_1787214
           Arabidopsis thaliana clone C00023 (e) putative
           phytochrome-associated protein 1 (At3g16500) mRNA,
           complete cds.>gb:AF386948_1794753 Arabidopsis thaliana
           phytochrome-associated protein 1 (MDC8.13) mRNA,
           complete cds.>gb:AP000373_1819811 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone: MDC8.
          Length = 269

 Score = 52.0 bits (123), Expect = 4e-05
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 18/99 (18%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------------LKGELCPRS 339
           K+ M+G   GR VDL     Y+ L   ++++F                   + G L  + 
Sbjct: 155 KINMDGVPIGRKVDLNAYNSYEQLSFVVDKLFRGLLAAQRDISDGQGEEKPIIGLLDGKG 214

Query: 340 KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           ++ + Y D+EGD MLVGD PW  F   V+R+ +  S ++
Sbjct: 215 EFTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKSSEI 253



>gb:AP003835_1833996 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1506_G02.
          Length = 219

 Score = 51.6 bits (122), Expect = 5e-05
 Identities = 27/87 (31%), Positives = 44/87 (50%), Gaps = 5/87 (5%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE-----LKGELCPRSKWEVIYADDEGDM 378
           KV M+G+ + R VDL   K Y +L   L+ +F         + C   ++ + Y D +GD+
Sbjct: 133 KVSMDGAPYLRKVDLKMCKGYRELREALDLLFTKCFSATASDGCSDGQFAIAYEDKDGDL 192

Query: 379 MLVGDDPWPEFCKMVRRIFICSSEKVK 459
           MLVGD PW  F    +++ I    + +
Sbjct: 193 MLVGDVPWEMFISSCKKLRIMKGSEAR 219



>gb:AF123506_1769921 Nicotiana tabacum Nt-iaa4.3 deduced protein
           mRNA, complete cds.
          Length = 202

 Score = 51.6 bits (122), Expect = 5e-05
 Identities = 31/88 (35%), Positives = 43/88 (48%), Gaps = 6/88 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G  + R +DL   K Y +LL  L+ +F+   G    R     S++   Y D + D
Sbjct: 101 KVSMDGGTYLRKIDLKVYKSYPELLKALQNMFKCTIGVYTEREGYNGSEYAPTYEDKDRD 160

Query: 376 MMLVGDDPWPEFCKMVRRIFICSSEKVK 459
            MLVGD PW  F    RR+ I    + K
Sbjct: 161 WMLVGDVPWDMFINSCRRLRIMKGSEAK 188



>gb:PSIAA45D_1702189 P.sativum PS-IAA4/5 gene.
          Length = 187

 Score = 51.6 bits (122), Expect = 5e-05
 Identities = 32/78 (41%), Positives = 43/78 (55%), Gaps = 7/78 (8%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGD 375
           KV M+G+ + R +DL     Y +LL  LE +F+L  GE   R     S++   Y D +GD
Sbjct: 96  KVSMDGAPYLRKIDLRVYGGYSELLKALETMFKLTIGEYSEREGYKGSEYAPTYEDKDGD 155

Query: 376 MMLVGDDPWP-EFCKMVR 426
            MLVGD PW    CK +R
Sbjct: 156 WMLVGDVPWDVTSCKRLR 173



>gb:PSIAA6R_1702191 P.sativum mRNA for auxin-induced protein (clone
           pIAA6).
          Length = 156

 Score = 50.8 bits (120), Expect = 9e-05
 Identities = 33/95 (34%), Positives = 46/95 (48%), Gaps = 8/95 (8%)
 Frame = +1

Query: 199 SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG--------ELCPRSKWEVI 354
           S+   KV M+G+ + R +DL   K Y +L   LE++F+  G        E C       I
Sbjct: 51  SKMYMKVSMDGAPYLRKIDLCLHKGYLELALALEKLFDCCGIEEALKDAENCEHVP---I 107

Query: 355 YADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
           Y D +GD MLVGD PW  F +  +R+ I      K
Sbjct: 108 YEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAK 142



>gb:ATU49075_1557046 Arabidopsis thaliana early auxin-induced
           (IAA19) mRNA, partial cds.
          Length = 145

 Score = 50.8 bits (120), Expect = 9e-05
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-----ELCPRSKWEVIYADDEGDM 378
           KV M+G  + R +DL + + YDDL   L+++F  +G     +     ++  IY D +GD 
Sbjct: 48  KVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDW 107

Query: 379 MLVGDDPWPEFCKMVRRIFI 438
           ML GD PW  F +  +R+ I
Sbjct: 108 MLAGDVPWGMFLESCKRLRI 127



>sp|O24409|IAAJ_ARATH Auxin-responsive protein IAA19 (Indoleacetic
           acid-induced protein 19) (MASSUGU2
           protein).>gb:AB022218_1515101 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MJK13.>gb:AC024081_1539280 Arabidopsis thaliana
           chromosome III P1 MJK13 genomic sequence, complete
           sequence.
          Length = 197

 Score = 50.8 bits (120), Expect = 9e-05
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 5/80 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-----ELCPRSKWEVIYADDEGDM 378
           KV M+G  + R +DL + + YDDL   L+++F  +G     +     ++  IY D +GD 
Sbjct: 100 KVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDW 159

Query: 379 MLVGDDPWPEFCKMVRRIFI 438
           ML GD PW  F +  +R+ I
Sbjct: 160 MLAGDVPWGMFLESCKRLRI 179



>sp|P49680|IAA6_PEA Auxin-induced protein IAA6.>pir|S39078|S39078
           auxin-induced protein IAA6 - garden
           pea>gb:PSIAA6D_1702190 P.sativum gene for PS-IAA6.
          Length = 179

 Score = 50.8 bits (120), Expect = 9e-05
 Identities = 33/95 (34%), Positives = 46/95 (48%), Gaps = 8/95 (8%)
 Frame = +1

Query: 199 SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG--------ELCPRSKWEVI 354
           S+   KV M+G+ + R +DL   K Y +L   LE++F+  G        E C       I
Sbjct: 74  SKMYMKVSMDGAPYLRKIDLCLHKGYLELALALEKLFDCCGIEEALKDAENCEHVP---I 130

Query: 355 YADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
           Y D +GD MLVGD PW  F +  +R+ I      K
Sbjct: 131 YEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAK 165



>gb:PTR306827_1702721 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA4 gene).
          Length = 176

 Score = 50.4 bits (119), Expect = 1e-04
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 7/88 (7%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWE-------VIYADDEG 372
           KV MEG   GR ++L     Y DL+  L+++F     L P    E       + Y D EG
Sbjct: 90  KVYMEGIPIGRKLNLLAHDGYHDLIQTLDQMFNTS-ILWPEMDIEHSGQCHVLTYEDKEG 148

Query: 373 DMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           D ++VGD PW  F   VRR+ I  ++ +
Sbjct: 149 DWLIVGDVPWEMFLPSVRRLKITRADSL 176



>gb:NTA417876_1691404 Nicotiana tabacum mRNA for IAA9 protein.
          Length = 346

 Score = 50.4 bits (119), Expect = 1e-04
 Identities = 45/166 (27%), Positives = 70/166 (42%), Gaps = 31/166 (18%)
 Frame = +1

Query: 34  KETPCSNTMPSNANAVCDAN---GVGAVQKSEH------LKSSREIKLVEASLKDTLSKP 186
           KE    NT+P   +AV  A+   G GA            ++S ++  L   S  +     
Sbjct: 161 KEATNQNTVPERTSAVNGASNRVGSGAPATKAQVVGWPPIRSFKKNTLASTSKNNEKVDG 220

Query: 187 SVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF------------------- 309
              +     KV M+G+ + R VDL     Y +L + LE++F                   
Sbjct: 221 KAGSPALFIKVSMDGAPYLRKVDLKNYSAYQELSSALEKMFSCFTIGQYGSHGAPGKEML 280

Query: 310 ---ELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
              +LK +L   S++ + Y D +GD MLVGD PW  F +  +R+ I
Sbjct: 281 SESQLK-DLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRI 325



>pir|S12244|S12244 auxin-induced protein AUX2-27 - Arabidopsis
           thaliana
          Length = 174

 Score = 50.4 bits (119), Expect = 1e-04
 Identities = 31/83 (37%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK---GELCPRSKWEVIYADD 366
           T  +  KV +EG+ F R +DL   K Y DL + L+ +F       +    S+   IY D 
Sbjct: 72  TKSSYVKVSVEGAAFLRKIDLEMYKCYQDLASALQILFGCYINFDDTLKESECVPIYEDK 131

Query: 367 EGDMMLVGDDPWPEF---CKMVR 426
           +GD ML GD PW  F   CK +R
Sbjct: 132 DGDWMLAGDVPWEMFLGSCKRLR 154



>gb:AC144740_1744194 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0075A10, complete sequence.
          Length = 327

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 32/111 (28%), Positives = 46/111 (41%), Gaps = 23/111 (20%)
 Frame = +1

Query: 169 DTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------ 312
           D  +KP +   R   K+ M+G   GR VDL     Y  L + +EE+F             
Sbjct: 199 DDKAKP-ICKKRPLVKINMDGIPIGRKVDLQIYDSYQKLSSAVEELFRGFLEAQKDLSCA 257

Query: 313 -----------LKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRI 432
                        G L     + ++Y D++GD ML GD PW  F   V+R+
Sbjct: 258 ESGEQGAEDKIFSGLLDGTGVYTLVYEDNDGDRMLAGDIPWKVFVSTVKRL 308



>gb:AY088406_1573425 Arabidopsis thaliana clone 6493 mRNA, complete
           sequence.
          Length = 267

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 18/99 (18%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------------LKGELCPRS 339
           K+ M G   GR VDL+    Y+ L   ++++F                   + G L    
Sbjct: 153 KINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNG 212

Query: 340 KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           ++ + Y D+EGD MLVGD PW  F   V+R+ +  + ++
Sbjct: 213 EYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEI 251



>gb:ATU49074_1557045 Arabidopsis thaliana early auxin-induced
           (IAA18) mRNA, partial cds.
          Length = 236

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 18/99 (18%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------------LKGELCPRS 339
           K+ M G   GR VDL+    Y+ L   ++++F                   + G L    
Sbjct: 122 KINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNG 181

Query: 340 KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           ++ + Y D+EGD MLVGD PW  F   V+R+ +  + ++
Sbjct: 182 EYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEI 220



>pir|T52144|T52144 auxin-induced protein IAA18 [imported] -
           Arabidopsis thaliana (fragment)
          Length = 236

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 18/99 (18%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------------LKGELCPRS 339
           K+ M G   GR VDL+    Y+ L   ++++F                   + G L    
Sbjct: 122 KINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNG 181

Query: 340 KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           ++ + Y D+EGD MLVGD PW  F   V+R+ +  + ++
Sbjct: 182 EYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEI 220



>sp|O24408|IAAI_ARATH Auxin-responsive protein IAA18 (Indoleacetic
           acid-induced protein 18).>pir|H96558|H96558 IAA18
           [imported] - Arabidopsis thaliana>gb:AE005173_893108
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC015448_1538023 Arabidopsis thaliana
           chromosome I BAC T14L22 genomic sequence, complete
           sequence.>gb:AY056062_1563412 Arabidopsis thaliana
           At1g51950/T14L22_14 mRNA, complete
           cds.>gb:AF367263_1791716 Arabidopsis thaliana
           At1g51950/T14L22_14 mRNA, complete cds.
          Length = 267

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 18/99 (18%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE------------------LKGELCPRS 339
           K+ M G   GR VDL+    Y+ L   ++++F                   + G L    
Sbjct: 153 KINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNG 212

Query: 340 KWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV 456
           ++ + Y D+EGD MLVGD PW  F   V+R+ +  + ++
Sbjct: 213 EYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEI 251



>gb:ATU18407_1556793 Arabidopsis thaliana IAA5 (IAA5) gene, partial
           cds.
          Length = 158

 Score = 49.3 bits (116), Expect = 3e-04
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK---GELCPRSKWEVIYADD 366
           T  +  KV ++G+ F R +DL   K Y DL + L+ +F       +    S+   IY D 
Sbjct: 67  TKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILFGCYINFDDTLKESECVPIYEDK 126

Query: 367 EGDMMLVGDDPWPEF---CKMVR 426
           +GD ML GD PW  F   CK +R
Sbjct: 127 DGDWMLAGDVPWEMFLGSCKRLR 149



>pir|G86289|G86289 auxin-induced protein AUX2-27 [imported] -
           Arabidopsis thaliana>gb:AE005172_890547 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC013453_1537942 Arabidopsis thaliana
           chromosome I BAC T16N11 genomic sequence, complete
           sequence.>gb:ATAUX227_1544125 A.thaliana auxin-inducible
           Aux2-27 gene.
          Length = 174

 Score = 49.3 bits (116), Expect = 3e-04
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK---GELCPRSKWEVIYADD 366
           T  +  KV ++G+ F R +DL   K Y DL + L+ +F       +    S+   IY D 
Sbjct: 72  TKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILFGCYINFDDTLKESECVPIYEDK 131

Query: 367 EGDMMLVGDDPWPEF---CKMVR 426
           +GD ML GD PW  F   CK +R
Sbjct: 132 DGDWMLAGDVPWEMFLGSCKRLR 154



>pir|S58492|S58492 auxin-induced protein IAA5 - Arabidopsis thaliana
          Length = 174

 Score = 49.3 bits (116), Expect = 3e-04
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK---GELCPRSKWEVIYADD 366
           T  +  KV ++G+ F R +DL   K Y DL + L+ +F       +    S+   IY D 
Sbjct: 72  TKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILFGCYINFDDTLKESECVPIYEDK 131

Query: 367 EGDMMLVGDDPWPEF---CKMVR 426
           +GD ML GD PW  F   CK +R
Sbjct: 132 DGDWMLAGDVPWEMFLGSCKRLR 154



>sp|Q9C966|IAAF_ARATH Auxin-responsive protein IAA15 (Indoleacetic
           acid-induced protein 15).>pir|F96835|F96835 unknown
           protein F5I6.14 [imported] - Arabidopsis
           thaliana>gb:AE005173_895552 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC018848_1538409 Arabidopsis thaliana
           chromosome 1 BAC F5I6 genomic sequence, complete
           sequence.>gb:ATH441300_1552601 Arabidopsis thaliana mRNA
           for putative auxin-induced protein 21 (iaa21 gene).
          Length = 179

 Score = 49.3 bits (116), Expect = 3e-04
 Identities = 29/86 (33%), Positives = 43/86 (50%), Gaps = 6/86 (6%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWE------VI 354
           T  R   KV ++G+ + R VDL     Y  L   LE +F+    +C  ++ E        
Sbjct: 83  TVRRKYVKVALDGAAYLRKVDLGMYDCYGQLFTALENMFQGIITICRVTELERKGEFVAT 142

Query: 355 YADDEGDMMLVGDDPWPEFCKMVRRI 432
           Y D +GD+MLVGD PW  F +  +R+
Sbjct: 143 YEDKDGDLMLVGDVPWMMFVESCKRM 168



>sp|P33078|IAA5_ARATH Auxin-responsive protein IAA5 (Indoleacetic
           acid-induced protein 5) (Auxin-induced protein
           AUX2-27).>gb:AY150496_1585061 Arabidopsis thaliana
           putative auxin-induced protein IAA5 (At1g15580) mRNA,
           complete cds.
          Length = 163

 Score = 49.3 bits (116), Expect = 3e-04
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 6/83 (7%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK---GELCPRSKWEVIYADD 366
           T  +  KV ++G+ F R +DL   K Y DL + L+ +F       +    S+   IY D 
Sbjct: 72  TKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILFGCYINFDDTLKESECVPIYEDK 131

Query: 367 EGDMMLVGDDPWPEF---CKMVR 426
           +GD ML GD PW  F   CK +R
Sbjct: 132 DGDWMLAGDVPWEMFLGSCKRLR 154



>gb:AP004732_1843950 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0021M10.
          Length = 265

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 27/83 (32%), Positives = 40/83 (48%), Gaps = 14/83 (16%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------------LKGELCP 333
           +S    KV +EG   GR +DL   + YD L   L+ +F                + E   
Sbjct: 89  SSTMFVKVNLEGYAVGRKIDLKAHRSYDSLSQALQSMFHGFLSDGIATRDNELQRMEEGS 148

Query: 334 RSKWEVIYADDEGDMMLVGDDPW 402
           + ++ ++Y D+EGD MLVGD PW
Sbjct: 149 KKRYVLVYEDNEGDRMLVGDVPW 171



>gb:AF040632_1763404 Arabidopsis thaliana IAA17/AXR3-1 protein
           (AXR3) gene, complete cds.
          Length = 229

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 23/94 (24%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL------KGE------------LCPRS 339
           KV M+G+ + R +DL   K YD+L N L  +F         GE            +   +
Sbjct: 114 KVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVN 173

Query: 340 KWEVI--YADDEGDMMLVGDDPWPEF---CKMVR 426
            W+ +  Y D +GD MLVGD PWP F   CK +R
Sbjct: 174 SWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLR 207



>gb:GHI458442_1680050 Gossypium hirsutum mRNA for IAA16 protein.
          Length = 208

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 30/97 (30%), Positives = 46/97 (47%), Gaps = 10/97 (10%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF----------ELKGELCPRSKWEVIYAD 363
           KV ++G+ + R VDL     Y  LL  LE++F          E K +     ++   Y D
Sbjct: 103 KVAVDGAPYLRKVDLEIYNSYQQLLTSLEDMFSCFTIRNYLNEKKIDQVNGIEYMPTYED 162

Query: 364 DEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
            +GD MLVGD PW  F +  +R+ +  S +   +  K
Sbjct: 163 KDGDWMLVGDVPWQMFVESCKRLRLMKSSEAVGLGLK 199



>gb:AY087284_1572317 Arabidopsis thaliana clone 33613 mRNA, complete
           sequence.
          Length = 228

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 23/94 (24%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL------KGE------------LCPRS 339
           KV M+G+ + R +DL   K YD+L N L  +F         GE            +   +
Sbjct: 113 KVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVN 172

Query: 340 KWEVI--YADDEGDMMLVGDDPWPEF---CKMVR 426
            W+ +  Y D +GD MLVGD PWP F   CK +R
Sbjct: 173 SWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLR 206



>sp|P93830|IAAH_ARATH Auxin-responsive protein IAA17 (Indoleacetic
           acid-induced protein 17) (Auxin response
           3).>pir|H86173|H86173 hypothetical protein [imported] -
           Arabidopsis thaliana>gb:AE005172_889442 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATU49073_1557044 Arabidopsis thaliana early
           auxin-induced (IAA17) mRNA, complete
           cds.>gb:AY070094_1566734 Arabidopsis thaliana
           auxin-induced protein IAA17/AXR3-1 (At1g04250) mRNA,
           complete cds.>gb:AY117183_1579224 Arabidopsis thaliana
           auxin-induced protein IAA17/AXR3-1 (At1g04250) mRNA,
           complete cds.>gb:F19P19_1677737 Sequence of BAC F19P19
           from Arabidopsis thaliana chromosome 1, complete
           sequence.>gb:AF040631_1763403 Arabidopsis thaliana
           IAA17/AXR3 protein (AXR3) gene, complete
           cds.>gb:AF336916_1787608 Arabidopsis thaliana
           auxin-induced protein, IAA17/AXR3-1 (At1g04250) mRNA,
           complete cds.
          Length = 229

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 33/94 (35%), Positives = 45/94 (47%), Gaps = 23/94 (24%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL------KGE------------LCPRS 339
           KV M+G+ + R +DL   K YD+L N L  +F         GE            +   +
Sbjct: 114 KVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVN 173

Query: 340 KWEVI--YADDEGDMMLVGDDPWPEF---CKMVR 426
            W+ +  Y D +GD MLVGD PWP F   CK +R
Sbjct: 174 SWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLR 207



>sp|O24407|IAAG_ARATH Auxin-responsive protein IAA16 (Indoleacetic
           acid-induced protein 16).>gb:ATAC011437_1543285
           Arabidopsis thaliana chromosome III BAC F7O18 genomic
           sequence, complete sequence.>gb:ATU49072_1557043
           Arabidopsis thaliana early auxin-induced (IAA16) mRNA,
           complete cds.>gb:AY087195_1572229 Arabidopsis thaliana
           clone 32727 mRNA, complete sequence.>gb:BT000857_1635112
           Arabidopsis thaliana At3g04730/F7O18_22 mRNA, complete
           cds.>gb:AF332400_1787213 Arabidopsis thaliana clone
           C00021 (e) auxin-induced protein IAA16 (At3g04730) mRNA,
           complete cds.>gb:AF375420_1792925 Arabidopsis thaliana
           AT3g04730/F7O18_22 mRNA, complete cds.
          Length = 236

 Score = 48.9 bits (115), Expect = 3e-04
 Identities = 37/124 (29%), Positives = 51/124 (41%), Gaps = 23/124 (18%)
 Frame = +1

Query: 178 SKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE-----------LKG- 321
           S  S   +    KV M+G+ + R +DL   K Y DL N L ++F            +K  
Sbjct: 110 SSASACATVAYVKVSMDGAPYLRKIDLKLYKTYQDLSNALSKMFSSFTIGNYGPQGMKDF 169

Query: 322 -------ELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMS 468
                  +L   S +   Y D +GD MLVGD PW  F    +RI I    +      +  
Sbjct: 170 MNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRAL 229

Query: 469 SKCK 480
            KCK
Sbjct: 230 EKCK 233



>gb:AP004028_1836596 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1136_C12.>gb:AP005111_1848050 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0643F09.
          Length = 281

 Score = 48.5 bits (114), Expect = 4e-04
 Identities = 31/88 (35%), Positives = 42/88 (47%), Gaps = 13/88 (14%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-ELCPR------------SKWEVI 354
           KV M+G   GR VDL   + Y  L   LE +F      LC              +++++ 
Sbjct: 167 KVNMDGEVIGRKVDLNAHRSYKTLALALELMFTKPSIGLCASHNTNSLKLLDNSAEYQLT 226

Query: 355 YADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           Y D +GD MLVGD PW  F   V+R+ I
Sbjct: 227 YEDRDGDWMLVGDVPWEMFVSSVKRLRI 254



>gb:AP004028_1836595 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1136_C12.>gb:AP005111_1848049 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0643F09.
          Length = 280

 Score = 48.5 bits (114), Expect = 4e-04
 Identities = 31/88 (35%), Positives = 42/88 (47%), Gaps = 13/88 (14%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-ELCPR------------SKWEVI 354
           KV M+G   GR VDL   + Y  L   LE +F      LC              +++++ 
Sbjct: 166 KVNMDGEVIGRKVDLNAHRSYKTLALALELMFTKPSIGLCASHNTNSLKLLDNSAEYQLT 225

Query: 355 YADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           Y D +GD MLVGD PW  F   V+R+ I
Sbjct: 226 YEDRDGDWMLVGDVPWEMFVSSVKRLRI 253



>gb:AP003768_1833262 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0439E07.
          Length = 335

 Score = 48.5 bits (114), Expect = 4e-04
 Identities = 36/137 (26%), Positives = 58/137 (42%), Gaps = 23/137 (16%)
 Frame = +1

Query: 115 SEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNE 294
           S   K S E +   A+ K TL+           K+ M+G   GR +DL     YD L + 
Sbjct: 192 SSSSKHSPEPQNDNANAKVTLT----CKKNPLVKINMDGIPIGRKIDLAAYNSYDGLSSA 247

Query: 295 LEEIFE--LKGE---------------------LCPRSKWEVIYADDEGDMMLVGDDPWP 405
           ++++F   L+ +                     L    ++ ++Y D EGD MLVGD PW 
Sbjct: 248 VKQLFHGFLQAQKDQTNAQIAQQGADDKIFYQLLDGSGEYTLVYEDSEGDRMLVGDVPWK 307

Query: 406 EFCKMVRRIFICSSEKV 456
            F    +R+ +  S ++
Sbjct: 308 VFVSTAKRLRVLRSSEL 324



>gb:OSA563599_1692714 Oryza sativa (indica cultivar-group) iaa1 gene
           for Aux/IAA protein, exons 1-6.>gb:AC096855_1736354
           Oryza sativa chromosome 3 BAC OJ1365_D05 genomic
           sequence, complete sequence.
          Length = 236

 Score = 48.5 bits (114), Expect = 4e-04
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 11/132 (8%)
 Frame = +1

Query: 118 EHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNEL 297
           + +KS +E +  +   +   +  S + S    KV M+G+ + R VDL     Y DL   L
Sbjct: 104 QSVKSKKEEE-ADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSLAL 162

Query: 298 EEIF-----------ELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICS 444
           +++F           E+ G     S     Y D +GD MLVGD PW  F +  +R+ I  
Sbjct: 163 QKMFGTFTATGNNMNEVNG-----SDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMK 217

Query: 445 SEKVKKMSSKCK 480
             +   ++ + K
Sbjct: 218 GSEAIGLAPRAK 229



>gb:OSA251791_1692420 Oryza sativa partial mRNA for putative IAA1
           protein (iaa1 gene).
          Length = 236

 Score = 48.5 bits (114), Expect = 4e-04
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 11/132 (8%)
 Frame = +1

Query: 118 EHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNEL 297
           + +KS +E +  +   +   +  S + S    KV M+G+ + R VDL     Y DL   L
Sbjct: 104 QSVKSKKEEE-ADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSLAL 162

Query: 298 EEIF-----------ELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICS 444
           +++F           E+ G     S     Y D +GD MLVGD PW  F +  +R+ I  
Sbjct: 163 QKMFGTFTATGNNMNEVNG-----SDAGTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMK 217

Query: 445 SEKVKKMSSKCK 480
             +   ++ + K
Sbjct: 218 GSEAIGLAPRAK 229



>gb:AY254569_1593096 Gossypium barbadense auxin responsive protein
           IAA-Re (iaa-Re) mRNA, complete cds.
          Length = 91

 Score = 48.5 bits (114), Expect = 4e-04
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 6/85 (7%)
 Frame = +1

Query: 223 MEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPR-----SKWEVIYADDEGDMML 384
           M+G+ + R +DL     Y +LL  +E +F+   GE   R     S +   Y D +GD ML
Sbjct: 1   MDGAPYLRKIDLKIYSGYPELLQAIENMFKFTIGEYSEREGYKGSDYAPTYEDKDGDWML 60

Query: 385 VGDDPWPEFCKMVRRIFICSSEKVK 459
           VGD PW  F    +R+ I    + +
Sbjct: 61  VGDVPWEMFITSCKRLRIMKGSEAR 85



>gb:PTR306825_1702719 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA2 gene).
          Length = 365

 Score = 48.1 bits (113), Expect = 6e-04
 Identities = 35/115 (30%), Positives = 52/115 (45%), Gaps = 26/115 (22%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF----------------------ELKGEL 327
           KV M+G+ + R VDL     Y +L + LE++F                      +LK +L
Sbjct: 249 KVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGSHGAPGREMLSESKLK-DL 307

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
              S++ + Y D +GD MLVGD PW  F +  +R+ I  S        +   KCK
Sbjct: 308 LHGSEYVLTYEDKDGDWMLVGDVPWEMFIETCKRLRIMKSSDAIGLAPRAMEKCK 362



>sp|Q93YR9|ARFP_ARATH Auxin response factor 16.>gb:AY059792_1564638
           Arabidopsis thaliana putative transcription factor
           (At4g30080) mRNA, complete cds.>gb:AY091198_1574407
           Arabidopsis thaliana putative transcription factor
           (At4g30080) mRNA, complete cds.
          Length = 670

 Score = 48.1 bits (113), Expect = 6e-04
 Identities = 26/79 (32%), Positives = 43/79 (54%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGD 393
           KV ME    GR +DL+ +  Y++L  +L ++F +K      S   V+Y D  G +   G+
Sbjct: 588 KVFMESDDVGRTLDLSVLGSYEELSRKLSDMFGIKKSEMLSS---VLYRDASGAIKYAGN 644

Query: 394 DPWPEFCKMVRRIFICSSE 450
           +P+ EF K  RR+ I + +
Sbjct: 645 EPFSEFLKTARRLTILTEQ 663



>gb:AC145379_1744347 Oryza sativa chromosome 3 BAC OSJNBa0010N03
           genomic sequence, complete sequence.
          Length = 226

 Score = 47.8 bits (112), Expect = 7e-04
 Identities = 28/101 (27%), Positives = 48/101 (47%), Gaps = 3/101 (2%)
 Frame = +1

Query: 178 SKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL---KGELCPRSKWE 348
           S  +     +  KV M+G+ + R +DL   K Y +L   LE +F       +    S++ 
Sbjct: 120 SSAAAANGGSLVKVSMDGAPYLRKIDLRMYKGYRELREALEAMFVCFSGAADGANPSEFA 179

Query: 349 VIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSS 471
           + Y D +GD+MLVGD P+  F    +++ I    +   + S
Sbjct: 180 ITYQDKDGDLMLVGDVPFDMFTSTCKKLRIMKRSEATGLGS 220



>gb:AY085353_1570424 Arabidopsis thaliana clone 147711 mRNA,
           complete sequence.
          Length = 189

 Score = 47.8 bits (112), Expect = 7e-04
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 4/79 (5%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG----ELCPRSKWEVIYADDEGDMM 381
           KV M+G  + R +DL +  +Y +L+  LE +F   G    +   + ++ +IY D + D M
Sbjct: 97  KVSMDGVPYMRKIDLGSSNNYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWM 156

Query: 382 LVGDDPWPEFCKMVRRIFI 438
           LVGD PW  F +  +R+ I
Sbjct: 157 LVGDVPWQMFKESCKRLRI 175



>gb:AC144738_1744170 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0029B02, complete sequence.
          Length = 212

 Score = 47.4 bits (111), Expect = 0.001
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 15/123 (12%)
 Frame = +1

Query: 151 VEASLKDTLSKPSVTTSRTC--TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF----- 309
           V A  K+ L+  +  +S      KV ++G+ + R VDL   + YD LL  L++ F     
Sbjct: 88  VRAFRKNALAALAAASSSKAKFVKVAVDGAPYLRKVDLEAYRGYDQLLAALQDKFFSHFT 147

Query: 310 -------ELK-GELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKM 465
                  E+K  +    +++   Y D +GD MLVGD PW  F +  +R+ +  S +   +
Sbjct: 148 IRKLGNEEMKLVDAVSGNEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKSSEAVNL 207

Query: 466 SSK 474
           + +
Sbjct: 208 APR 210



>gb:AB026822_1517413 Cucumis sativus CsIAA2 mRNA for Aux/IAA
           protein, complete cds.
          Length = 355

 Score = 47.4 bits (111), Expect = 0.001
 Identities = 44/167 (26%), Positives = 70/167 (41%), Gaps = 27/167 (16%)
 Frame = +1

Query: 28  REKETPCSNTMPSNANAVCDANGVGAVQKSE-----HLKSSREIKLVEASLKDTLSKPSV 192
           +E+    S + PS+ N   + N    V K++      ++S R+  L   S  +       
Sbjct: 173 QERPQENSESRPSH-NETANNNTSTPVSKAQVVGWPPIRSFRKNTLATTSKNNDEVDGKA 231

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF--------------------- 309
                  KV M+G+ + R VDL     Y +L + LE++F                     
Sbjct: 232 MAGALFIKVSMDGAPYLRKVDLRNYSAYQELSSALEKMFSCFTIGQYGAHGALGMEKMSE 291

Query: 310 -ELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSS 447
            +LK +L   S++ + Y D +GD MLVGD PW  F    +R+ I  S
Sbjct: 292 SKLK-DLLHGSEYVLTYEDKDGDWMLVGDVPWEMFIDSCKRLRIMKS 337



>pir|S58493|S58493 auxin-induced protein IAA6 - Arabidopsis
           thaliana>gb:ATU18408_1556794 Arabidopsis thaliana IAA6
           (IAA6) gene, complete cds.
          Length = 189

 Score = 47.4 bits (111), Expect = 0.001
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG----ELCPRSKWEVIYADDEGDMM 381
           KV M+G  + R +DL +   Y +L+  LE +F   G    +   + ++ +IY D + D M
Sbjct: 97  KVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWM 156

Query: 382 LVGDDPWPEFCKMVRRIFI 438
           LVGD PW  F +  +R+ I
Sbjct: 157 LVGDVPWQMFKESCKRLRI 175



>sp|Q38824|IAA6_ARATH Auxin-responsive protein IAA6 (Indoleacetic
           acid-induced protein 6).>pir|E96569|E96569 probable IAA6
           protein, 42631-41742 [imported] - Arabidopsis
           thaliana>gb:AE005173_893194 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC019018_1538490 Arabidopsis thaliana
           chromosome 1 BAC F14G24 genomic sequence, complete
           sequence.>gb:AF336915_1787607 Arabidopsis thaliana clone
           C00013 (h) IAA6 (At1g52830) mRNA, complete cds.
          Length = 189

 Score = 47.4 bits (111), Expect = 0.001
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 4/79 (5%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG----ELCPRSKWEVIYADDEGDMM 381
           KV M+G  + R +DL +   Y +L+  LE +F   G    +   + ++ +IY D + D M
Sbjct: 97  KVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWM 156

Query: 382 LVGDDPWPEFCKMVRRIFI 438
           LVGD PW  F +  +R+ I
Sbjct: 157 LVGDVPWQMFKESCKRLRI 175



>sp|P13089|AX28_SOYBN Auxin-induced protein AUX28.>pir|A28993|A28993
           auxin-induced protein aux28 -
           soybean>gb:SOYAUX28_1715967 Soybean auxin-regulated
           protein (Aux28) mRNA, complete cds.
          Length = 243

 Score = 47.4 bits (111), Expect = 0.001
 Identities = 35/126 (27%), Positives = 58/126 (46%), Gaps = 25/126 (19%)
 Frame = +1

Query: 178 SKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF--------ELKG---- 321
           S+ + + + +  KV M+G+ + R VDL   K Y +L + L ++F        E +G    
Sbjct: 115 SEKNSSPNASFVKVSMDGAPYLRKVDLKMYKSYRELSDSLGKMFSSFTFGNCESQGMKDF 174

Query: 322 -------ELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK------VKK 462
                  +L   S +   Y D +GD MLVGD PW  F +  +R+ I   ++        +
Sbjct: 175 MNESKLNDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLGLAPR 234

Query: 463 MSSKCK 480
             +KCK
Sbjct: 235 AMAKCK 240



>gb:AY129669_1581148 Mirabilis jalapa auxin-responsive protein IAA1
           mRNA, partial cds.
          Length = 194

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 23/112 (20%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL--------KG-----------ELCPR 336
           KV M+G+ + R VDL   K Y DL + L ++F          +G           +L   
Sbjct: 80  KVSMDGAPYLRKVDLKLYKSYQDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLING 139

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMS----SKCK 480
           S +   Y D +GD MLVGD PW  F +  +R+ I   ++   ++     KCK
Sbjct: 140 SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAAGLAPRAMEKCK 191



>gb:ATU18416_1556802 Arabidopsis thaliana IAA14 (IAA14) gene,
           partial cds.
          Length = 164

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 19/94 (20%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------LKG-----------ELCPR 336
           KV M+G+ + R VDL     Y DL + L ++F          +G           +L   
Sbjct: 50  KVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNS 109

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           S++   Y D +GD MLVGD PWP F +  +R+ I
Sbjct: 110 SEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRI 143



>pir|H71407|H71407 auxin-induced protein - Arabidopsis thaliana
          Length = 225

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 19/94 (20%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------LKG-----------ELCPR 336
           KV M+G+ + R VDL     Y DL + L ++F          +G           +L   
Sbjct: 114 KVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNS 173

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           S++   Y D +GD MLVGD PWP F +  +R+ I
Sbjct: 174 SEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRI 207



>pir|C85159|C85159 IAA7 like protein [imported] - Arabidopsis
           thaliana>gb:ATCHRIV39_1545219 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 39.>gb:ATFCA1_1551505
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 1.
          Length = 234

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 19/94 (20%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------LKG-----------ELCPR 336
           KV M+G+ + R VDL     Y DL + L ++F          +G           +L   
Sbjct: 114 KVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNS 173

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           S++   Y D +GD MLVGD PWP F +  +R+ I
Sbjct: 174 SEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRI 207



>sp|Q38832|IAAE_ARATH Auxin-responsive protein IAA14 (Indoleacetic
           acid-induced protein 14) (SOLITARY-ROOT
           protein).>gb:AF334718_1787458 Arabidopsis thaliana IAA14
           (At4g14550) mRNA, complete cds.
          Length = 228

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 31/94 (32%), Positives = 45/94 (47%), Gaps = 19/94 (20%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------LKG-----------ELCPR 336
           KV M+G+ + R VDL     Y DL + L ++F          +G           +L   
Sbjct: 114 KVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNS 173

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           S++   Y D +GD MLVGD PWP F +  +R+ I
Sbjct: 174 SEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRI 207



>gb:AC093713_1736106 Oryza sativa chromosome 3 BAC OSJNBa0094F01
           genomic sequence, complete sequence.
          Length = 195

 Score = 46.6 bits (109), Expect = 0.002
 Identities = 41/167 (24%), Positives = 66/167 (39%), Gaps = 30/167 (17%)
 Frame = +1

Query: 16  DNYRREKETPCSNTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVE-----ASLKDTLS 180
           D    +K    S+T+ S A+      G GA    +    + ++++V      +  + T  
Sbjct: 21  DGVAAKKRRSASSTVKSEASGTACCGGAGARDVEDGASPASKVQVVGWPPVGSYRRSTFQ 80

Query: 181 KPSVTTSRTC--------------------TKVQMEGSRFGRAVDLTTMKDYDDLLNELE 300
             S +T+                        KV M+G+ + R VDL     Y +L + L+
Sbjct: 81  SSSSSTAAAAKGKGGGETDQGRKNKGGGLYVKVSMDGAPYLRKVDLRMYGGYRELRDALD 140

Query: 301 EIFELKGELCPRSK--WEVIYADDEGDMMLVGDDPWPEF---CKMVR 426
            +F         S   + V Y D +GD+ML GD PW  F   CK +R
Sbjct: 141 ALFGCFSADASASAAHFAVAYEDKDGDLMLAGDVPWDMFISSCKKLR 187



>gb:PPI315675_1701380 Pinus pinaster mRNA for putative auxin induced
           transcription factor Aux/Iaa (iaa88 gene).
          Length = 302

 Score = 46.6 bits (109), Expect = 0.002
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 21/117 (17%)
 Frame = +1

Query: 166 KDTL---SKPS---VTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-- 321
           K+TL   SKP+    +++    KV M+G+ + R VDL     Y +L + LE++F      
Sbjct: 170 KNTLAANSKPNDEGSSSNALYVKVSMDGAPYLRKVDLKMYSTYHELSSALEKMFSCFNMG 229

Query: 322 -------------ELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
                        +L   S++   Y D +GD MLVGD PW  F    +R+ I  + +
Sbjct: 230 QCGAPGLSESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRITKASE 286



>gb:AY087765_1572792 Arabidopsis thaliana clone 38286 mRNA, complete
           sequence.
          Length = 238

 Score = 46.6 bits (109), Expect = 0.002
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 24/113 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------LKG-----------ELCPR 336
           KV M+G+ + R VDL   K Y DL + L ++F          +G            L   
Sbjct: 123 KVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNS 182

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV-----KKMSSKCK 480
           S++   Y D +GD MLVGD PW  F +  +R+ I    +      + M   CK
Sbjct: 183 SEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKYCK 235



>sp|Q38825|IAA7_ARATH Auxin-responsive protein IAA7 (Indoleacetic
           acid-induced protein 7) (Auxin resistant
           2).>pir|S58494|S58494 auxin-induced protein IAA7 -
           Arabidopsis thaliana>gb:AB026655_1517323 Arabidopsis
           thaliana genomic DNA, chromosome 3, P1 clone:
           MXC7.>gb:ATU18409_1556795 Arabidopsis thaliana IAA7
           (IAA7) gene, complete cds.>gb:AY054651_1563305
           Arabidopsis thaliana auxin-responsive protein IAA7
           (At3g23050; MXC7.8) mRNA, complete
           cds.>gb:AY072461_1567278 Arabidopsis thaliana
           auxin-responsive protein IAA7 (At3g23050; MXC7.8) mRNA,
           complete cds.>gb:AF332395_1787208 Arabidopsis thaliana
           clone C00014 (o) indoleacetic acid-inducible protein
           IAA7 (At3g23050) mRNA, complete cds.
          Length = 243

 Score = 46.6 bits (109), Expect = 0.002
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 24/113 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------LKG-----------ELCPR 336
           KV M+G+ + R VDL   K Y DL + L ++F          +G            L   
Sbjct: 128 KVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNS 187

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKV-----KKMSSKCK 480
           S++   Y D +GD MLVGD PW  F +  +R+ I    +      + M   CK
Sbjct: 188 SEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCK 240



>sp|Q9SKN5|ARFJ_ARATH Auxin response factor 10.>pir|G84683|G84683
           hypothetical protein At2g28350 [imported] - Arabidopsis
           thaliana>gb:AC006283_1533981 Arabidopsis thaliana
           chromosome 2 clone T1B3 map mi54, complete
           sequence.>gb:AF325073_1786527 Arabidopsis thaliana
           unknown protein (At2g28350) mRNA, complete
           cds.>gb:AF336919_1787611 Arabidopsis thaliana clone
           C00034 (b) auxin response factor 10 (At2g28350) mRNA,
           complete cds.
          Length = 693

 Score = 46.6 bits (109), Expect = 0.002
 Identities = 33/109 (30%), Positives = 52/109 (47%), Gaps = 2/109 (1%)
 Frame = +1

Query: 118 EHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNEL 297
           E  ++  E  LV   L    S   + T     KV ME    GR +DL+ +  Y +L  +L
Sbjct: 554 EEAEAEEEKGLVARGLTWNYSLQGLETGHC--KVFMESEDVGRTLDLSVIGSYQELYRKL 611

Query: 298 EEIFELKGELCPRSKW--EVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
            E+F ++     RS     V+Y D  G +  +GD+P+ +F K  +R+ I
Sbjct: 612 AEMFHIE----ERSDLLTHVVYRDANGVIKRIGDEPFSDFMKATKRLTI 656



>sp|Q38826|IAA8_ARATH Auxin-responsive protein IAA8 (Indoleacetic
           acid-induced protein 8).>pir|S58495|S58495 auxin-induced
           protein IAA8 - Arabidopsis thaliana>gb:AC006340_1534071
           Arabidopsis thaliana chromosome 2 clone T9I22 map
           CIC06C07, complete sequence.>gb:ATU18410_1556796
           Arabidopsis thaliana IAA8 (IAA8) gene complete
           cds.>gb:AY059905_1564749 Arabidopsis thaliana
           auxin-regulated protein (IAA8) (At2g22670; T9I22.11)
           mRNA, complete cds.>gb:AY070399_1566798 Arabidopsis
           thaliana auxin-regulated protein IAA8 (At2g22670) mRNA,
           complete cds.>gb:AY087635_1572665 Arabidopsis thaliana
           clone 37274 mRNA, complete sequence.>gb:AY096452_1575996
           Arabidopsis thaliana auxin-regulated protein IAA8
           (At2g22670) mRNA, complete cds.>gb:AY114671_1578713
           Arabidopsis thaliana auxin-regulated protein IAA8
           (At2g22670) mRNA, complete cds.>gb:AF334714_1787454
           Arabidopsis thaliana auxin-regulated protein IAA8
           (At2g22670) mRNA, complete cds.
          Length = 321

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 31/96 (32%), Positives = 47/96 (48%), Gaps = 21/96 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF--------------------ELK-GELC 330
           KV M+G+ + R VDL T   Y  L + LE++F                    E+K  +L 
Sbjct: 203 KVSMDGAPYLRKVDLRTYTSYQQLSSALEKMFSCFTLGQCGLHGAQGRERMSEIKLKDLL 262

Query: 331 PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
             S++ + Y D +GD MLVGD PW  F +  +++ I
Sbjct: 263 HGSEFVLTYEDKDGDWMLVGDVPWEIFTETCQKLKI 298



>gb:AP006168_1861222 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:B1469H02.
          Length = 681

 Score = 45.8 bits (107), Expect = 0.003
 Identities = 35/119 (29%), Positives = 60/119 (50%), Gaps = 1/119 (0%)
 Frame = +1

Query: 85  DANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTT 264
           + +G G +Q S    +S E +L       T+S+  +   +   KV +E    GR +DL++
Sbjct: 559 EGSGSGVIQNSPTDNTSSE-RLQWFRENSTVSELGLEPGQC--KVFIESDTVGRNLDLSS 615

Query: 265 MKDYDDLLNELEEIFEL-KGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           +  ++ L   L E+F +   EL  R    V+Y    G++   GD+P+ EF K+ RR+ I
Sbjct: 616 LASFEQLYGRLSEMFCIDSAELRSR----VLYRGATGEVRHAGDEPFSEFIKLARRLTI 670



>gb:TAE575098_1724464 Triticum aestivum partial mRNA for IAA1
           protein.
          Length = 233

 Score = 45.8 bits (107), Expect = 0.003
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 9/98 (9%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL------KGELCPR---SKWEVIYADD 366
           KV M+G+ + R VDL     Y DL   L+++F        +G++      S     Y D 
Sbjct: 129 KVSMDGAPYLRKVDLKMYNTYKDLSIALQKMFSTFTATGNEGKMVEAVNGSDVVTTYEDK 188

Query: 367 EGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSKCK 480
           +GD MLVGD PW  F    +R+ I    +   ++ + K
Sbjct: 189 DGDWMLVGDVPWEMFVASCKRLRIMKGSEAIGLAPRAK 226



>gb:AY289601_1594942 Pinus taeda auxin-induced protein 2 (IAA2)
           mRNA, complete cds.
          Length = 302

 Score = 45.8 bits (107), Expect = 0.003
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 21/117 (17%)
 Frame = +1

Query: 166 KDTL---SKPS---VTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-- 321
           K+TL   SKP+    +++    KV M+G+ + R VDL     Y +L + LE++F      
Sbjct: 170 KNTLAANSKPNDEGSSSNALYVKVSMDGAPYLRKVDLKMYSTYHELSSALEKMFSCFTMG 229

Query: 322 -------------ELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
                        +L   S++   Y D +GD MLVGD PW  F    +R+ I  + +
Sbjct: 230 QCGSPGLSESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRITKASE 286



>gb:AB029148_1518138 Cucumis sativus mRNA expressed in cucumber
           hypocotyls, complete cds.
          Length = 230

 Score = 45.8 bits (107), Expect = 0.003
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 24/113 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF------------ELKG--------ELCP 333
           KV M+G+ + R VDL   K Y  L + L  +F            E+K         +L  
Sbjct: 115 KVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFGSFTTIGNCGSQEMKDFMNESKLMDLLS 174

Query: 334 RSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
            S +   Y D +GD MLVGD PW  F +  +R+ I   ++      +   KCK
Sbjct: 175 GSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAIGLAPRAMEKCK 227



>gb:AP005394_1851031 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0620H05.>gb:AP005756_1857293 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0035N08.
          Length = 300

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 23/96 (23%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE-----------------------LKGE 324
           K+ M+G   GR +DL     Y+ L   ++++F                        + G 
Sbjct: 181 KINMDGVPIGRKIDLNAFDSYEKLSLAVDKLFRGLLAAQRDPLTAGAKDCQQEDVAISGL 240

Query: 325 LCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRI 432
           L    ++ ++Y D EGD +LVGD PW  F   V+R+
Sbjct: 241 LDGTGEYTLVYEDYEGDKVLVGDVPWGMFVSSVKRL 276



>gb:AP003766_1833221 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0009H10.>gb:AP005395_1851035 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0623A10.
          Length = 700

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL-KGELCPRSKWEVIYADDEGDMMLVG 390
           KV M+    GR +DL+ +  Y++L   L ++F + K EL       V Y D  G +   G
Sbjct: 618 KVFMQSEDVGRTLDLSVVGSYEELYRRLADMFGIEKAELMSH----VFYRDAAGALKHTG 673

Query: 391 DDPWPEFCKMVRRIFI 438
           D+P+ EF K  RR+ I
Sbjct: 674 DEPFSEFTKTARRLNI 689



>gb:AF016633_1761508 Glycine max GH1 protein (GH1) mRNA, partial
           cds.
          Length = 339

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 22/97 (22%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF-----------------ELKGE-----L 327
           KV M+G+ + R VDL +   Y +L + LE++F                 E+  E     L
Sbjct: 222 KVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDL 281

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
              S++ + Y D +GD MLVGD PW  F    +R+ I
Sbjct: 282 LHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKI 318



>gb:AY289603_1594944 Pinus taeda auxin-induced protein 4 (IAA4)
           mRNA, complete cds.
          Length = 231

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 16/102 (15%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK----------------GEL 327
           +S    KV M+G+ + R VDL     Y DL + LE +F                    ++
Sbjct: 119 SSSLYVKVSMDGAPYLRKVDLKMYSTYHDLSSALENMFGCLITMGKCGSSGIKESNLMDV 178

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
              S++   Y D +GD MLVGD PW  F    +R+ I  + +
Sbjct: 179 VNGSEYVATYEDKDGDWMLVGDVPWQMFVDSCQRVRIMKASE 220



>gb:AB071299_1522757 Oryza sativa OsARF10 mRNA for auxin response
           factor 10, partial cds.
          Length = 700

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL-KGELCPRSKWEVIYADDEGDMMLVG 390
           KV M+    GR +DL+ +  Y++L   L ++F + K EL       V Y D  G +   G
Sbjct: 618 KVFMQSEDVGRTLDLSVVGSYEELYRRLADMFGIEKAELMSH----VFYRDAAGALKHTG 673

Query: 391 DDPWPEFCKMVRRIFI 438
           D+P+ EF K  RR+ I
Sbjct: 674 DEPFSEFTKTARRLNI 689



>pir|T05726|T05726 GH1 protein - soybean (fragment)
          Length = 339

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 22/97 (22%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF-----------------ELKGE-----L 327
           KV M+G+ + R VDL +   Y +L + LE++F                 E+  E     L
Sbjct: 222 KVSMDGAPYLRKVDLRSYTTYQELSSALEKMFLSCFTLGQCGSHGAPGREMLSESKLRDL 281

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
              S++ + Y D +GD MLVGD PW  F    +R+ I
Sbjct: 282 LHGSEYVLTYEDKDGDWMLVGDVPWEMFIDTCKRLKI 318



>sp|Q38828|IAAA_ARATH Auxin-responsive protein IAA10 (Indoleacetic
           acid-induced protein 10).>pir|S58496|S58496 IAA1 protein
           - Arabidopsis thaliana>gb:AE005172_889428 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:ATU18412_1556798 Arabidopsis thaliana IAA10
           (IAA10) gene, complete cds.>gb:F20D22_1677751
           Arabidopsis thaliana chromosome 1 BAC F20D22 sequence,
           complete sequence.>gb:AF332396_1787209 Arabidopsis
           thaliana clone C00017 (e) IAA10 (At1g04100) mRNA,
           complete cds.
          Length = 261

 Score = 45.4 bits (106), Expect = 0.004
 Identities = 40/150 (26%), Positives = 62/150 (41%), Gaps = 21/150 (14%)
 Frame = +1

Query: 52  NTMPSNANAVCDANGVGAVQKSEHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEG 231
           N++ + A ++    G+ +  + E  KS     +V A+  D       + +    KV M+G
Sbjct: 106 NSLVNQAKSLATEGGLSSGIQKETTKS-----VVVAAKNDDACFIKSSRTSMLVKVTMDG 160

Query: 232 SRFGRAVDLTTMKDYDDLLNELEEIF---------------ELKGELCPR------SKWE 348
              GR VDL  +  Y  L   L+ +F               +   E C        S++ 
Sbjct: 161 VIIGRKVDLNALDSYAALEKTLDLMFFQIPSPVTRSNTQGYKTIKETCTSKLLDGSSEYI 220

Query: 349 VIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           + Y D +GD MLVGD PW  F   V R+ I
Sbjct: 221 ITYQDKDGDWMLVGDVPWQMFLGSVTRLRI 250



>gb:AJ843999_1814691 Plantago major mRNA for auxin resistance
           protein (axr2 gene).
          Length = 227

 Score = 45.1 bits (105), Expect = 0.005
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 23/117 (19%)
 Frame = +1

Query: 199 SRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF--------ELKG----------- 321
           S    KV M+G+ + R VDL   K Y++L + L ++F        + +G           
Sbjct: 108 SAAFVKVSMDGAPYLRKVDLKMYKTYEELSDALGKMFSSFTMSKCDAQGMMDFMNESKLM 167

Query: 322 ELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
           +L   S +   Y D +GD MLVGD PW  F    +R+ I    +      +   KCK
Sbjct: 168 DLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVGSCKRLRIMKGTEAIGLAPRAMEKCK 224



>gb:AF373100_1792696 Populus tremula x Populus tremuloides
           auxin-regulated protein (IAA1) mRNA, complete cds.
          Length = 249

 Score = 45.1 bits (105), Expect = 0.005
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 25/140 (17%)
 Frame = +1

Query: 136 REIKLVEASLKDTLSKPSVT--TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF 309
           + +  V+ +  D   K S +  T     KV M+G+ + R VDL   K Y +L + L ++F
Sbjct: 107 KNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMF 166

Query: 310 EL--------KG-----------ELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRI 432
                     +G           +L   S++   Y D +GD MLVGD PW  F    +R+
Sbjct: 167 SSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRL 226

Query: 433 FICSSEK----VKKMSSKCK 480
            I    +      +   KCK
Sbjct: 227 RIMKGSEAIGLAPRAVEKCK 246



>gb:PTR306829_1702723 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA6 gene).
          Length = 277

 Score = 45.1 bits (105), Expect = 0.005
 Identities = 44/154 (28%), Positives = 66/154 (42%), Gaps = 25/154 (16%)
 Frame = +1

Query: 94  GVGA-VQKSEHLKSSREIKLVEASLKDTLSKPSVT-TSRTCTKVQMEGSRFGRAVDLTTM 267
           G GA V+    ++S R+  LV+ +  +   K S    S    KV M+G+ + R VDL   
Sbjct: 121 GFGAQVEGWPPVRSYRKNVLVQKNASEEGEKASTGGCSAAFVKVCMDGAPYLRKVDLKMY 180

Query: 268 KDYDDLLNELEEIFE--------LKG-----------ELCPRSKWEVIYADDEGDMMLVG 390
           K Y +L + L ++F          +G           +L   S++   Y D +GD MLVG
Sbjct: 181 KSYQELSDALAKMFSSLTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVG 240

Query: 391 DDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
           D PW  F    +R  I    +      +   KCK
Sbjct: 241 DVPWEMFVDSCKRPRIMKGSEAVGLAPRAMEKCK 274



>gb:PTR306828_1702722 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA5 gene).
          Length = 289

 Score = 45.1 bits (105), Expect = 0.005
 Identities = 33/106 (31%), Positives = 47/106 (44%), Gaps = 24/106 (22%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF---------------ELKGEL 327
           T +    KV M+G+  GR VDL+    Y+ L   LE +F               E K  +
Sbjct: 173 TRTSLFVKVNMDGTLIGRKVDLSAHGCYETLAQALENMFLRTTTTLNMARLSTPEYKIMI 232

Query: 328 CPR---------SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
             +         S++ + Y D +GD MLVGD PW  F   V+R+ I
Sbjct: 233 DAKRHSQLLGGSSEFVLTYEDKDGDWMLVGDVPWGMFISSVKRLRI 278



>gb:AP004236_1839117 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0417D05.
          Length = 193

 Score = 44.7 bits (104), Expect = 0.006
 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 16/103 (15%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE----LKG------------ELCPRSKW 345
           KV ++G+ + R VDL     Y  LL  L  +F     ++G            +L   +++
Sbjct: 87  KVAVDGAPYLRKVDLAAHAGYAPLLRALHGMFASCLAVRGGGGGDGEGTKLVDLVTGAEY 146

Query: 346 EVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
              Y D +GD MLVGD PW  F +  +RI +  S +   +S +
Sbjct: 147 VPTYEDKDGDWMLVGDVPWKMFVESCKRIRLMKSSEAVNLSPR 189



>gb:AP002524_1822385 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP002903_1823789 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0509B06.
          Length = 199

 Score = 44.7 bits (104), Expect = 0.006
 Identities = 29/100 (29%), Positives = 48/100 (48%), Gaps = 13/100 (13%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF------------ELK-GELCPRSKWEVI 354
           KV ++G+ + R VDL     YD LL  L++ F            E K  +    +++   
Sbjct: 97  KVAVDGAPYLRKVDLEAYSGYDQLLRALQDKFFSHFTIRKFADDERKLVDAVNGTEYVPT 156

Query: 355 YADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
           Y D +GD MLVGD PW  F +  +R+ +  S +   ++ +
Sbjct: 157 YEDKDGDWMLVGDVPWKMFVETCQRLRLMKSSEAVNLAPR 196



>gb:AC144735_1744126 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0001A14, complete sequence.
          Length = 281

 Score = 44.7 bits (104), Expect = 0.006
 Identities = 29/108 (26%), Positives = 45/108 (41%), Gaps = 21/108 (19%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL---------------------KGELC 330
           KV M+G+ + R VDL T   Y+DL   LE++F                       + +  
Sbjct: 165 KVSMDGAPYLRKVDLKTYSSYEDLSLALEKMFSCFITGRSSSHKTSKRDRLTDGSRADAL 224

Query: 331 PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVKKMSSK 474
              ++ + Y D + D MLVGD PW  F    R++ I        M+ +
Sbjct: 225 KDQEYVLTYEDKDADWMLVGDLPWDLFTTSCRKLRIMRGSDAAGMAPR 272



>gb:AY289602_1594943 Pinus taeda auxin-induced protein 3 (IAA3)
           mRNA, complete cds.
          Length = 252

 Score = 44.7 bits (104), Expect = 0.006
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 16/96 (16%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE---LKG-------------ELCPRSKW 345
           KV M+G+ + R VDL     Y +L + LE++F    + G             +L   S++
Sbjct: 137 KVSMDGAPYLRKVDLKLYSTYHELTSALEKMFSCLIIMGKCGSLALNESNLMDLPNGSEY 196

Query: 346 EVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK 453
              Y D +GD ML+GD PW  F    +R+ I ++ +
Sbjct: 197 VPTYEDKDGDWMLIGDVPWQMFVDSCQRMRIMTASE 232



>pir|S58501|S58501 auxin-induced protein IAA14 - Arabidopsis
           thaliana  (fragment)
          Length = 164

 Score = 44.7 bits (104), Expect = 0.006
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 19/94 (20%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE--------LKGELCPRSKWEVI----- 354
           KV M+G+ + R VDL     Y DL + L ++F          +G +   ++ +V+     
Sbjct: 50  KVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNS 109

Query: 355 ------YADDEGDMMLVGDDPWPEFCKMVRRIFI 438
                 Y D +GD MLVGD PWP F +  +R+ I
Sbjct: 110 FEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRI 143



>gb:AP005113_1848076 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0685G12.
          Length = 205

 Score = 44.3 bits (103), Expect = 0.008
 Identities = 28/92 (30%), Positives = 39/92 (42%), Gaps = 13/92 (14%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-------------GELCPRSKWEVI 354
           KV MEG   GR +DL  +  Y  L+  L  +F                G    +    + 
Sbjct: 107 KVYMEGVPIGRKLDLLPLDGYKGLVARLASMFRASITYHHCHRQFAVVGMKTNKVHHVLT 166

Query: 355 YADDEGDMMLVGDDPWPEFCKMVRRIFICSSE 450
           Y D EGD M+ GD PW  F   V+R+ I  ++
Sbjct: 167 YEDQEGDWMMAGDVPWELFLTSVKRLRIARAD 198



>gb:AP003374_1828707 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1117_G01.
          Length = 271

 Score = 44.3 bits (103), Expect = 0.008
 Identities = 28/96 (29%), Positives = 42/96 (43%), Gaps = 21/96 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL---------------------KGELC 330
           KV M+G+ + R VDL     Y+DL   LE++F                       K +  
Sbjct: 155 KVSMDGAPYLRKVDLKMYSSYEDLSMALEKMFSCFITGQSGLRKSSNRDRLTNGSKADAL 214

Query: 331 PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
              ++ + Y D + D MLVGD PW  F  + R++ I
Sbjct: 215 QDQEYVLTYEDKDADWMLVGDLPWDLFTTICRKLKI 250



>gb:AC145379_1744348 Oryza sativa chromosome 3 BAC OSJNBa0010N03
           genomic sequence, complete sequence.>gb:AC145780_1744490
           Oryza sativa chromosome 3 BAC OSJNBb0069P02 genomic
           sequence, complete sequence.
          Length = 233

 Score = 44.3 bits (103), Expect = 0.008
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 18/107 (16%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF------------ELKGELCPRSKWEVI- 354
           KV M+G+ + R +D+   K Y +L    + +F            +LK     R   E + 
Sbjct: 126 KVSMDGAPYLRKIDVAMYKSYPELSMAFQNMFTSFTIGKCGSHQQLKESNKLRDDLEYVP 185

Query: 355 -YADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
            Y D +GD MLVGD PW  F +  +R+ I    +      +   KCK
Sbjct: 186 TYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCK 232



>gb:AY781902_1628331 Saccharum hybrid cultivar isolate c57
           auxin-induced protein mRNA, partial cds.
          Length = 188

 Score = 44.3 bits (103), Expect = 0.008
 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 24/113 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMK---DYDDLLNELEEIFE----------LKG-------ELCP 333
           KV ++G+ + R VDL   K    Y +L   LE++F           + G       +L  
Sbjct: 73  KVSLDGAPYLRKVDLKMYKMYKSYQELSKALEKMFSSTIGSCGSQGMNGMNESKLVDLLN 132

Query: 334 RSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
            S++   Y D EGD MLVGD PW  F +  +R+ I    +      +   KCK
Sbjct: 133 GSEYVPTYEDKEGDWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCK 185



>gb:AY054137_1562959 Arabidopsis thaliana AT4g32280/F10M6_80 mRNA,
           complete cds.>gb:AF380646_1793630 Arabidopsis thaliana
           AT4g32280/F10M6_80 mRNA, complete cds.
          Length = 194

 Score = 43.9 bits (102), Expect = 0.011
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 2/96 (2%)
 Frame = +1

Query: 157 ASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR 336
           A++  + S    + S    KV+M+G    R VD+     Y+ L N L  +F  + E C R
Sbjct: 87  ATVGSSSSSSISSRSSMYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMF-TEYEDCDR 145

Query: 337 --SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
             + +   +   EGD +L GD  W  F + V RI I
Sbjct: 146 EDTNYTFTFQGKEGDWLLRGDVTWKIFAESVHRISI 181



>gb:AB010075_1510979 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPA24.
          Length = 333

 Score = 43.9 bits (102), Expect = 0.011
 Identities = 35/114 (30%), Positives = 55/114 (48%), Gaps = 26/114 (22%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF----------------------ELKGEL 327
           KV M+G+ + R VDL +  +Y +L + LE++F                      +LK +L
Sbjct: 220 KVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLK-DL 278

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEF---CKMVRRIFICSSEKVKKM-SSKC 477
                + + Y D +GD MLVGD PW  F   CK ++ +  C +  + K+ SS C
Sbjct: 279 LNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLGKVYSSLC 332



>sp|Q93WC4|IAAT_ARATH Auxin-responsive protein IAA29 (Indoleacetic
           acid-induced protein 29).
          Length = 251

 Score = 43.9 bits (102), Expect = 0.011
 Identities = 30/96 (31%), Positives = 45/96 (46%), Gaps = 2/96 (2%)
 Frame = +1

Query: 157 ASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR 336
           A++  + S    + S    KV+M+G    R VD+     Y+ L N L  +F  + E C R
Sbjct: 144 ATVGSSSSSSISSRSSMYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMF-TEYEDCDR 202

Query: 337 --SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
             + +   +   EGD +L GD  W  F + V RI I
Sbjct: 203 EDTNYTFTFQGKEGDWLLRGDVTWKIFAESVHRISI 238



>gb:AC096855_1736355 Oryza sativa chromosome 3 BAC OJ1365_D05
           genomic sequence, complete sequence.
          Length = 224

 Score = 43.5 bits (101), Expect = 0.014
 Identities = 35/119 (29%), Positives = 53/119 (44%), Gaps = 11/119 (9%)
 Frame = +1

Query: 118 EHLKSSREIKLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNEL 297
           + +KS +E +  +   +   +  S + S    KV M+G+ + R VDL     Y DL   L
Sbjct: 104 QSVKSKKEEE-ADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSLAL 162

Query: 298 EEIF-----------ELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFIC 441
           +++F           E+ G     S     Y D +GD MLVGD PW    + V   F+C
Sbjct: 163 QKMFGTFTATGNNMNEVNG-----SDAVTTYEDKDGDWMLVGDVPW----QYVTTSFLC 212



>gb:AY289604_1594945 Pinus taeda auxin-induced protein 5 (IAA5)
           mRNA, complete cds.
          Length = 252

 Score = 43.5 bits (101), Expect = 0.014
 Identities = 35/121 (28%), Positives = 50/121 (41%), Gaps = 24/121 (19%)
 Frame = +1

Query: 190 VTTSRTC----TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK------------- 318
           V T  TC     KV M+G+ + R V+L     Y DL + LE +F                
Sbjct: 129 VRTISTCDSLYVKVSMDGAPYLRKVNLKIYSTYHDLSSALENMFSCLLTMGKSRSHGLNE 188

Query: 319 ---GELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKC 477
               ++   S +   Y D +GD MLVGD PW  F    +R+ I  + +      +   KC
Sbjct: 189 SSLMDMPNGSGYVPTYEDKDGDWMLVGDVPWQMFVDSCQRMRIMKASEAIGLAPRTMEKC 248

Query: 478 K 480
           K
Sbjct: 249 K 249



>gb:AY090553_1574159 Zinnia elegans auxin-regulated protein (IAA8)
           mRNA, complete cds.
          Length = 351

 Score = 43.5 bits (101), Expect = 0.014
 Identities = 28/96 (29%), Positives = 43/96 (44%), Gaps = 21/96 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFEL---------------------KGELC 330
           KV M+G+ + R VDL +   Y  L + +E++F                         +L 
Sbjct: 235 KVSMDGAPYLRKVDLRSYSTYQQLSSAIEKMFSCFTIGQCGSQGAPGRESLSESKLRDLL 294

Query: 331 PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
             S++ + Y D +GD MLVGD PW  F    +R+ I
Sbjct: 295 HGSEYVLTYEDKDGDWMLVGDVPWDMFIGSCKRLKI 330



>gb:AY087089_1572125 Arabidopsis thaliana clone 31563 mRNA, complete
           sequence.
          Length = 338

 Score = 43.5 bits (101), Expect = 0.014
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 22/97 (22%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF----------------------ELKGEL 327
           KV M+G+ + R VDL +  +Y +L + LE++F                      +LK +L
Sbjct: 220 KVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLK-DL 278

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
                + + Y D +GD MLVGD PW  F  + +++ I
Sbjct: 279 LNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKI 315



>sp|Q38827|IAA9_ARATH Auxin-responsive protein IAA9 (Indoleacetic
           acid-induced protein 9).>pir|T05902|T05902 auxin-induced
           protein IAA9 - Arabidopsis thaliana>gb:ATF6H11_1550864
           Arabidopsis thaliana DNA chromosome 5, BAC clone F6H11
           (ESSAII project).>gb:ATU18411_1556797 Arabidopsis
           thaliana IAA9 (IAA9) gene, complete
           cds.>gb:AF334715_1787455 Arabidopsis thaliana clone
           C00016 (e) auxin-induced protein IAA9 (At5g65670) mRNA,
           complete cds.
          Length = 338

 Score = 43.5 bits (101), Expect = 0.014
 Identities = 29/97 (29%), Positives = 47/97 (48%), Gaps = 22/97 (22%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF----------------------ELKGEL 327
           KV M+G+ + R VDL +  +Y +L + LE++F                      +LK +L
Sbjct: 220 KVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLK-DL 278

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
                + + Y D +GD MLVGD PW  F  + +++ I
Sbjct: 279 LNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKI 315



>gb:PTR306830_1702724 Populus tremula x Populus tremuloides mRNA for
           aux/IAA protein (IAA7 gene).
          Length = 229

 Score = 43.1 bits (100), Expect = 0.018
 Identities = 30/97 (30%), Positives = 45/97 (46%), Gaps = 19/97 (19%)
 Frame = +1

Query: 205 TCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE-----------LKG--------EL 327
           T  KV M+G+ + R VDL   K Y +L + L ++F            +K         +L
Sbjct: 118 TFVKVSMDGAPYLRKVDLNMYKTYHELSDALGKMFSSFTIGNCGSHGMKDFLNESKLIDL 177

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
              + +   Y D +GD MLVGD PW  F +  +R+ I
Sbjct: 178 LNGTDYVPSYEDKDGDWMLVGDVPWDMFVESCKRLRI 214



>sp|Q9C5X0|IAAY_ARATH Auxin-responsive protein IAA34 (Indoleacetic
           acid-induced protein 34).>gb:ATH458327_1552607
           Arabidopsis thaliana mRNA for putative auxin-induced
           protein 29 (iaa29 gene).>gb:AF334713_1787453 Arabidopsis
           thaliana clone C00006 (e) IAA34 (At1g15050) mRNA,
           complete cds.
          Length = 185

 Score = 43.1 bits (100), Expect = 0.018
 Identities = 27/80 (33%), Positives = 42/80 (52%), Gaps = 5/80 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR-----SKWEVIYADDEGDM 378
           KV M+G   GR V +     Y  L ++LE++F ++     R     S++ ++Y D+EG  
Sbjct: 96  KVTMDGLVVGRKVCVLDHGSYSTLAHQLEDMFGMQSVSGLRLFQMESEFCLVYRDEEGLW 155

Query: 379 MLVGDDPWPEFCKMVRRIFI 438
              GD PW EF + V R+ I
Sbjct: 156 RNAGDVPWNEFIESVERLRI 175



>gb:AF099735_1768078 Arabidopsis thaliana auxin response factor 10
           (ARF10) mRNA, partial cds.
          Length = 701

 Score = 42.7 bits (99), Expect = 0.024
 Identities = 24/75 (32%), Positives = 39/75 (52%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGD 393
           KV ME    GR +DL+ +    +L  +L E+F ++    P     V Y D  G +  +GD
Sbjct: 585 KVFMESEDVGRTLDLSVIGSVQELYRKLAEMFHIEER--PDLVTHVGYRDANGVIKRIGD 642

Query: 394 DPWPEFCKMVRRIFI 438
           +P+ +F K  +R+ I
Sbjct: 643 EPFSDFMKATKRLTI 657



>gb:AY289600_1594941 Pinus taeda auxin-induced protein 1 (IAA1)
           mRNA, complete cds.
          Length = 218

 Score = 42.7 bits (99), Expect = 0.024
 Identities = 30/97 (30%), Positives = 43/97 (44%), Gaps = 16/97 (16%)
 Frame = +1

Query: 196 TSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK----------------GEL 327
           +S    KV M+G+ + R VDL     Y DL + LE +F                    ++
Sbjct: 119 SSSLYVKVSMDGAPYLRKVDLKMYSTYHDLSSALENMFGCLITMGKSGSHALNESNLFDV 178

Query: 328 CPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
              S++   Y D +GD MLVGD PW  F    +R+ I
Sbjct: 179 RNGSEYVPTYEDKDGDWMLVGDVPWDMFVDSCQRMRI 215



>gb:AF123509_1769924 Nicotiana tabacum Nt-iaa4.1 deduced protein
           mRNA, complete cds.
          Length = 220

 Score = 41.6 bits (96), Expect = 0.053
 Identities = 34/128 (26%), Positives = 50/128 (39%), Gaps = 23/128 (17%)
 Frame = +1

Query: 166 KDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-------- 321
           K T +  S +      KV ++G+ + R VDL   K Y  L + L ++F            
Sbjct: 90  KSTGNGESSSGGAAFVKVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGNHG 149

Query: 322 -----------ELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----V 456
                      +L   S +   Y D +GD MLVGD PW  F    +R+ I    +     
Sbjct: 150 FKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLA 209

Query: 457 KKMSSKCK 480
            +   KCK
Sbjct: 210 PRAVEKCK 217



>gb:AP004784_1845015 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0012F14.
          Length = 266

 Score = 40.8 bits (94), Expect = 0.090
 Identities = 31/96 (32%), Positives = 44/96 (45%), Gaps = 21/96 (21%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIF--------ELKG-------------ELC 330
           KV M+G+ + R VDL   K+Y +L   LE++F        E  G             +L 
Sbjct: 150 KVSMDGAPYLRKVDLKMYKNYKELSLALEKMFSCFTVGHGESNGKSGRDGLSDCRLMDLK 209

Query: 331 PRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
             ++  + Y D + D MLVGD PW  F    RR+ I
Sbjct: 210 NGTELVLTYEDKDEDWMLVGDVPWRMFTDSCRRLRI 245



>gb:AF123508_1769923 Nicotiana tabacum Nt-iaa28 deduced protein
           mRNA, complete cds.
          Length = 240

 Score = 40.8 bits (94), Expect = 0.090
 Identities = 31/112 (27%), Positives = 45/112 (40%), Gaps = 23/112 (20%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG-------------------ELCPR 336
           KV ++G+ + R VDL   K Y  L + L ++F                       +L   
Sbjct: 126 KVSVDGAPYLRKVDLKMYKSYQQLSDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNG 185

Query: 337 SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
           S +   Y D +GD MLVGD PW  F    +R+ I    +      +   KCK
Sbjct: 186 SDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCK 237



>sp|Q8RYC6|IAAW_ARATH Auxin-responsive protein IAA32 (Indoleacetic
           acid-induced protein 32).
          Length = 191

 Score = 40.0 bits (92), Expect = 0.15
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 5/80 (6%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR-----SKWEVIYADDEGDM 378
           KV ++G   GR V L     Y  L  +L ++F ++     R     S++ ++Y D EG  
Sbjct: 102 KVNLDGLVVGRKVCLVDQGAYATLALQLNDMFGMQTVSGLRLFQTESEFSLVYRDREGIW 161

Query: 379 MLVGDDPWPEFCKMVRRIFI 438
             VGD PW EF + V R+ I
Sbjct: 162 RNVGDVPWKEFVESVDRMRI 181



>gb:AF022022_1761759 Lycopersicon esculentum auxin-regulated IAA11
           (IAA11) mRNA, partial cds.
          Length = 77

 Score = 38.5 bits (88), Expect = 0.44
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG 321
           + ++   KV M+G+ F R VDL+T K YD L+  LE++F+  G
Sbjct: 17  SNNKMYVKVSMDGAPFLRKVDLSTHKGYDQLVMALEKLFDCYG 59



>pir|T05712|T05712 auxin-induced protein IAA11 - tomato (fragment)
          Length = 77

 Score = 38.5 bits (88), Expect = 0.44
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = +1

Query: 193 TTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG 321
           + ++   KV M+G+ F R VDL+T K YD L+  LE++F+  G
Sbjct: 17  SNNKMYVKVSMDGAPFLRKVDLSTHKGYDQLVMALEKLFDCYG 59



>gb:AF169830_1774231 Glycine max auxin-induced protein ali50 mRNA,
           partial cds.
          Length = 218

 Score = 37.7 bits (86), Expect = 0.76
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 19/108 (17%)
 Frame = +1

Query: 145 KLVEASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKG- 321
           K+    + D  +  ++  S    +V M+G+ + R VDL   K Y  L++ L +  +L   
Sbjct: 27  KVSNEEVADNTTISTLANSGAFVQVSMDGAPYLRKVDLPMYKSYIRLISCLGQNVQLLHH 86

Query: 322 ------------------ELCPRSKWEVIYADDEGDMMLVGDDPWPEF 411
                             +L P S++   + + +GD MLVGD PW  F
Sbjct: 87  GYLWGPRNDIFMNDSKLMDLPPSSEYVPPHQNTDGDWMLVGDVPWEMF 134



>pir|T05400|T05400 hypothetical protein F10M6.80 - Arabidopsis
           thaliana>gb:ATCHRIV76_1547149 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 76.>gb:ATF10M6_1548194
           Arabidopsis thaliana DNA chromosome 4, BAC clone F10M6
           (ESSAII project).
          Length = 842

 Score = 37.4 bits (85), Expect = 0.99
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 2/84 (2%)
 Frame = +1

Query: 157 ASLKDTLSKPSVTTSRTCTKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELKGELCPR 336
           A++  + S    + S    KV+M+G    R VD+     Y+ L N L  +F  + E C R
Sbjct: 122 ATVGSSSSSSISSRSSMYVKVKMDGVAIARKVDIKLFNSYESLTNSLITMF-TEYEDCDR 180

Query: 337 --SKWEVIYADDEGDMMLVGDDPW 402
             + +   +   EGD +L GD  W
Sbjct: 181 EDTNYTFTFQGKEGDWLLRGDVTW 204



>sp|P40600|LIPE_AERHY Extracellular lipase precursor (EC 3.1.1.3)
            (Triacylglycerol lipase).>gb:S65123_168807
            lip=extracellular lipase [Aeromonas hydrophila, H3,
            Genomic, 2842 nt].
          Length = 684

 Score = 36.6 bits (83), Expect = 1.7
 Identities = 20/67 (29%), Positives = 26/67 (38%), Gaps = 8/67 (11%)
 Frame = +3

Query: 1209 SCRWRQPW--------AGTLAAHHPSHSMGALQHPPACTEPDQQNEEHQGCDHRARAWRP 1364
            +C WR  W        AG+L  H   HS+GA + P  C       +   GC  + R   P
Sbjct: 541  ACVWRLAWPTPRAIGTAGSLKVHFLGHSLGASRVPTCCGRQPDHRQRASGCPVQVRYRWP 600

Query: 1365 DRRPVHS 1385
                 HS
Sbjct: 601  GHAGSHS 607



>gb:AC133930_1741615 Oryza sativa chromosome 3 BAC OSJNBa0039O18
            genomic sequence, complete sequence.>gb:AC145388_1744439
            Oryza sativa chromosome 3 BAC OSJNBb0036M02 genomic
            sequence, complete sequence.
          Length = 456

 Score = 36.2 bits (82), Expect = 2.2
 Identities = 27/84 (32%), Positives = 32/84 (38%), Gaps = 5/84 (5%)
 Frame = +3

Query: 1125 HRNSPGWGDLLRPECV*AGFRRPADSGDS-----CRWRQPWAGTLAAHHPSHSMGALQHP 1289
            HR +P  G   RP     G RRP  +  S      RWR  W     A H     G     
Sbjct: 58   HRAAP-CGRARRP-----GARRPRGNPRSRKPPAARWRSAWPRPATAAHLPQLAGCPYSS 111

Query: 1290 PACTEPDQQNEEHQGCDHRARAWR 1361
            P C +  QQ     G +HR R +R
Sbjct: 112  PRCGDQQQQQLTKTGAEHRHRRFR 135



>gb:AY137961_1582213 Mirabilis jalapa clone SM-36 Aux/IAA1 mRNA,
           partial cds.
          Length = 97

 Score = 36.2 bits (82), Expect = 2.2
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
 Frame = +1

Query: 280 DLLNELEEIFELKGELCPRSKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFICSSEKVK 459
           D +NE + +  + G     S +   Y D +GD MLVGD PW  F +  +R+ I   ++  
Sbjct: 29  DFMNESKLMDLING-----SDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGKEAA 83

Query: 460 KMS----SKCK 480
            ++     KCK
Sbjct: 84  GLAPRAMEKCK 94



>gb:AF443092_2256675 HIV-1 isolate 00BW1616.2 from Botswana,
           complete genome.
          Length = 501

 Score = 35.8 bits (81), Expect = 2.9
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 898 HPVMVFWEXXXXFSNATIHLPKINFKKPQKILFCHGTGNNGLQLFHLD*NKQAP 737
           H   V  E      NATI + K NFK P++I+ C   G  G    H+  N +AP
Sbjct: 356 HKARVLAEAMSQAGNATIMMQKSNFKGPRRIVKCFNCGKEG----HIARNCRAP 405



>gb:AF391268_2246953 HIV-1 clone TV018G60 from South Africa gag
           protein (gag) gene, complete cds.
          Length = 492

 Score = 35.8 bits (81), Expect = 2.9
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 898 HPVMVFWEXXXXFSNATIHLPKINFKKPQKILFCHGTGNNGLQLFHLD*NKQAP 737
           H   V  E     +NA I + K NFK P+KI+ C   G  G    H+  N +AP
Sbjct: 355 HKARVLAEAMSQANNAVIMMQKSNFKGPRKIIRCFNCGKEG----HIARNCRAP 404



>gb:AF443099_2256738 HIV-1 isolate 00BW1859.5 from Botswana,
           complete genome.
          Length = 492

 Score = 35.4 bits (80), Expect = 3.8
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 898 HPVMVFWEXXXXFSNATIHLPKINFKKPQKILFCHGTGNNGLQLFHLD*NKQAP 737
           H   V  E     +NA I + + NFK P+KI+ C   G  G    HL  N +AP
Sbjct: 355 HKARVLAEAMSQANNANIMMQRSNFKGPRKIIKCFNCGKEG----HLARNCRAP 404



>gb:HIM306159_2412019 Human immunodeficiency virus type 1 proviral
           partial gag gene, clone 7888.
          Length = 139

 Score = 35.0 bits (79), Expect = 4.9
 Identities = 20/54 (37%), Positives = 26/54 (48%)
 Frame = -3

Query: 898 HPVMVFWEXXXXFSNATIHLPKINFKKPQKILFCHGTGNNGLQLFHLD*NKQAP 737
           H   V  E     S ATI + K NFK P++++ C   G  G    HL  N +AP
Sbjct: 89  HKARVLAEAMSQASGATIMMQKSNFKGPRRMIKCFNCGKEG----HLARNCRAP 138



>gb:AF022012_1761749 Lycopersicon esculentum auxin-regulated IAA1
           (IAA1) mRNA, partial cds.
          Length = 77

 Score = 35.0 bits (79), Expect = 4.9
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)
 Frame = +1

Query: 178 SKPSVTTSRTC---TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPRSKW 345
           S PS      C    KV M+G+ + R +DL   K Y +LL  LE++F+L  GE   R  +
Sbjct: 8   SFPSKKAEAECGMYVKVSMDGAPYLRKIDLKLYKGYPELLKALEKMFKLSIGEYSEREGY 67

Query: 346 E 348
           +
Sbjct: 68  K 68



>pir|B86284|B86284 T15D22.10 protein - Arabidopsis
           thaliana>gb:AE005172_890502 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T15D22_1723481 Arabidopsis thaliana
           chromosome 1 BAC T15D22 sequence, complete sequence.
          Length = 161

 Score = 35.0 bits (79), Expect = 4.9
 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 5/60 (8%)
 Frame = +1

Query: 274 YDDLLNELEEIFELKGELCPR-----SKWEVIYADDEGDMMLVGDDPWPEFCKMVRRIFI 438
           Y  L ++LE++F ++     R     S++ ++Y D+EG     GD PW EF + V R+ I
Sbjct: 92  YSTLAHQLEDMFGMQSVSGLRLFQMESEFCLVYRDEEGLWRNAGDVPWNEFIESVERLRI 151



>pir|T04345|T04345 auxin-induced protein IAA1 - tomato (fragment)
          Length = 77

 Score = 35.0 bits (79), Expect = 4.9
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 4/61 (6%)
 Frame = +1

Query: 178 SKPSVTTSRTC---TKVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFELK-GELCPRSKW 345
           S PS      C    KV M+G+ + R +DL   K Y +LL  LE++F+L  GE   R  +
Sbjct: 8   SFPSKKAEAECGMYVKVSMDGAPYLRKIDLKLYKGYPELLKALEKMFKLSIGEYSEREGY 67

Query: 346 E 348
           +
Sbjct: 68  K 68



>gb:AE016815_1746261 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome II, complete sequence.
          Length = 1131

 Score = 34.7 bits (78), Expect = 6.4
 Identities = 34/139 (24%), Positives = 43/139 (30%), Gaps = 3/139 (2%)
 Frame = +3

Query: 957  CHHSYNRHA*CQELNHTQSVH*PCQAKTHHLTSLHEKPSQGTLSLQHRQVCSFICPHRN- 1133
            C HS+     C         H P Q+  H      + P        H       C H + 
Sbjct: 690  CTHSHRPGETCTH-------HHPGQSTGHVEHPKPDHPHHPGKPCTHSHRAGETCTHHHR 742

Query: 1134 --SPGWGDLLRPECV*AGFRRPADSGDSCRWRQPWAGTLAAHHPSHSMGALQHPPACTEP 1307
              S G G   +P+        P   G  C        T   HHP  S G   HP    +P
Sbjct: 743  GQSTGHGPHPKPD-------HPHHPGKPCTHSHRAGETCTHHHPGQSTGHGPHP----KP 791

Query: 1308 DQQNEEHQGCDHRARAWRP 1364
            D  +   + C H  RA  P
Sbjct: 792  DHPHHPGKPCTHSQRAGEP 810



>gb:HIM306153_2412013 Human immunodeficiency virus type 1 proviral
           partial gag gene, clone 3656.
          Length = 139

 Score = 34.3 bits (77), Expect = 8.4
 Identities = 19/54 (35%), Positives = 26/54 (48%)
 Frame = -3

Query: 898 HPVMVFWEXXXXFSNATIHLPKINFKKPQKILFCHGTGNNGLQLFHLD*NKQAP 737
           H   +  E     S ATI + K NFK P++++ C   G  G    HL  N +AP
Sbjct: 89  HKARILAEAMSQVSGATIMMQKSNFKGPKRMIKCFNCGKEG----HLARNCRAP 138



>gb:AF423760_2253866 HIV-1 isolate X558 from Spain, complete genome.
          Length = 493

 Score = 34.3 bits (77), Expect = 8.4
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = -3

Query: 898 HPVMVFWEXXXXFSNATIHLPKINFKKPQKILFCHGTGNNGLQLFHLD*NKQAP 737
           H   V  E     S ATI + K NFK P++ + C   G  G    HL  N +AP
Sbjct: 357 HKARVLAEAMSQASGATIMMQKSNFKGPRRTIKCFNCGKEG----HLARNCRAP 406



>gb:AF169204_1774204 Capsicum annuum differentially expressed
           osmotic protein ODE2 (ODE2) mRNA, partial cds.
          Length = 67

 Score = 34.3 bits (77), Expect = 8.4
 Identities = 13/25 (52%), Positives = 20/25 (80%)
 Frame = +1

Query: 394 DPWPEFCKMVRRIFICSSEKVKKMS 468
           DPW EFC++V +I I + E+V+KM+
Sbjct: 3   DPWHEFCEVVSKIHIYTQEEVEKMT 27



>gb:AF022013_1761750 Lycopersicon esculentum auxin-regulated IAA2
           (IAA2) mRNA, partial cds.
          Length = 69

 Score = 34.3 bits (77), Expect = 8.4
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE 312
           KV M+G+ + R +DL T K Y  LL  LE +F+
Sbjct: 15  KVSMDGAAYLRKIDLNTYKSYPQLLKALENMFK 47



>gb:AB051384_1521105 Cucumis sativus mRNA, putative member of
           Aux/IAA gene family, partial cds.
          Length = 51

 Score = 34.3 bits (77), Expect = 8.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 4/44 (9%)
 Frame = +1

Query: 361 DDEGDMMLVGDDPWPEFCKMVRRIFICSSEK----VKKMSSKCK 480
           D +GD MLVGD PW  F +  RR+ I    +      + + KCK
Sbjct: 5   DKDGDWMLVGDVPWEMFTESCRRLRIMKGSEAIGLAPRATEKCK 48



>pir|T04350|T04350 auxin-induced protein IAA2 - tomato (fragment)
          Length = 69

 Score = 34.3 bits (77), Expect = 8.4
 Identities = 15/33 (45%), Positives = 21/33 (63%)
 Frame = +1

Query: 214 KVQMEGSRFGRAVDLTTMKDYDDLLNELEEIFE 312
           KV M+G+ + R +DL T K Y  LL  LE +F+
Sbjct: 15  KVSMDGAAYLRKIDLNTYKSYPQLLKALENMFK 47


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,747,803,203
Number of Sequences: 1806583
Number of extensions: 37422943
Number of successful extensions: 91530
Number of sequences better than 10.0: 248
Number of HSP's better than 10.0 without gapping: 85711
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 91290
length of database: 581,917,975
effective HSP length: 130
effective length of database: 347,062,185
effective search space used: 156177983250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)