BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11800
         (799 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:ITU20948_1683300 Ipomoea trifida receptor protein kinase (IRK...   204   1e-63   
gb:AP003406_1828888 Oryza sativa (japonica cultivar-group) genom...   205   4e-63   
gb:AC130597_1740689 Oryza sativa (japonica cultivar-group) chrom...   201   5e-63   
gb:AF403128_1796416 Oryza sativa S-locus receptor-like kinase RL...   187   7e-63   
gb:AB092809_1525112 Lotus corniculatus var. japonicus HAR1 gene ...   207   9e-63   
gb:AE005173_894228 Arabidopsis thaliana chromosome 1, bottom arm...   192   6e-62   
pir|S70769|S70769 S-receptor kinase (EC 2.7.1.-) Ark1 precursor ...   192   6e-62   Arabidopsis thaliana [mouse-ear cress]
pir|T05754|T05754 S-receptor kinase (EC 2.7.1.-) M4I22.110 precu...   188   7e-62   Arabidopsis thaliana [mouse-ear cress]
gb:BOARLKGEN_1633734 B.oleraceae gene encoding serine/threonine ...   197   1e-61   
gb:AB097116_1525939 Brassica rapa SRK-60, SLG-60 genes for S rec...   197   1e-61   
gb:AB024416_1515946 Brassica oleracea SRK2-b mRNA, complete cds.      195   2e-61   
gb:BOY18260_1633945 Brassica oleracea mRNA for SRK15 protein, pa...   196   2e-61   
gb:AP004401_1841243 Oryza sativa (japonica cultivar-group) genom...   196   3e-61   
gb:AB052756_1521238 Arabidopsis lyrata mRNA for SRKb, complete cds.   195   4e-61   
pir|T05180|T05180 S-receptor kinase (EC 2.7.1.-) ARK3 precursor ...   192   4e-61   Arabidopsis thaliana [mouse-ear cress]
pir|T14470|T14470 receptor-like kinase (EC 2.7.1.-) SFR2 - wild ...   194   6e-61   Brassica oleracea
gb:BOY18259_1633944 Brassica oleracea mRNA for SRK5 protein, par...   193   8e-61   
gb:OSJN00019_1693377 Oryza sativa genomic DNA, chromosome 4, BAC...   191   8e-61   
pir|A85041|A85041 probable receptor kinase [imported] - Arabidop...   190   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb:AB041621_1519688 Brassica rapa BcRK5 gene for receptor kinase...   194   1e-60   
gb:LCO580824_1684037 Lotus corniculatus var. japonicus har1 gene...   200   1e-60   
gb:LCO580824_1684038 Lotus corniculatus var. japonicus har1 gene...   200   2e-60   
gb:AB092809_1525113 Lotus corniculatus var. japonicus HAR1 gene ...   200   2e-60   
gb:AY534539_1612232 Raphanus sativus haplotype S23 S-locus recep...   196   3e-60   
gb:AF403127_1796415 Oryza sativa S-locus receptor-like kinase RL...   190   4e-60   
gb:OSJN00097_1694866 Oryza sativa genomic DNA, chromosome 4, BAC...   188   5e-60   
gb:AF403126_1796414 Oryza sativa S-locus receptor-like kinase RL...   181   5e-60   
gb:AY534534_1612227 Raphanus sativus haplotype S15 S-locus recep...   188   5e-60   
pir|T14377|T14377 S-receptor kinase (EC 2.7.1.-) SRK29 - turnip>...   192   9e-60   Brassica rapa
gb:OSJN00195_1696529 Oryza sativa genomic DNA, chromosome 4, BAC...   188   9e-60   
gb:AF527808_1808433 Sorghum bicolor clone BAC SBTXS_0040L6 php20...   193   9e-60   
gb:BT005954_1638876 Arabidopsis thaliana At4g23180 gene, complet...   196   1e-59   
gb:AF083790_1767020 Arabidopsis thaliana clone sps866 unknown mRNA.   196   1e-59   
pir|T04835|T04835 probable serine/threonine-specific protein kin...   196   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AP003406_1828884 Oryza sativa (japonica cultivar-group) genom...   191   2e-59   
gb:AB052755_1521237 Arabidopsis lyrata mRNA for SRKa, partial cds.    187   2e-59   
pir|T14375|T14375 S-receptor kinase (EC 2.7.1.-) 1 - turnip>gb:A...   186   2e-59   Brassica rapa
pir|T05179|T05179 S-receptor kinase (EC 2.7.1.-) T6K22.100 precu...   196   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb:AP003368_1828580 Oryza sativa (japonica cultivar-group) genom...   196   2e-59   
gb:AF084036_1767053 Arabidopsis thaliana receptor-like protein k...   189   3e-59   
pir|T14520|T14520 probable S-receptor kinase (EC 2.7.1.-) SFR3 p...   187   6e-59   Brassica oleracea
gb:AF224705_1778584 Arabidopsis thaliana receptor-like protein k...   193   6e-59   
pir|T14519|T14519 probable S-receptor kinase (EC 2.7.1.-) SFR1 -...   183   1e-58   Brassica oleracea
gb:AF403129_1796417 Oryza sativa S-locus receptor-like kinase RL...   185   1e-58   
gb:AY052581_1562777 Raphanus sativus haplotype S6 S-locus recept...   187   1e-58   
pir|T04837|T04837 probable serine/threonine-specific protein kin...   189   2e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AB041620_1519687 Brassica rapa BcRL3 gene for receptor kinase...   181   3e-58   
gb:AY327041_1599682 Oryza sativa (japonica cultivar-group) recep...   189   3e-58   
gb:OSJN00019_1693374 Oryza sativa genomic DNA, chromosome 4, BAC...   184   3e-58   
pir|T10573|T10573 probable serine/threonine-specific protein kin...   198   3e-58   Arabidopsis thaliana [mouse-ear cress]
pir|B85122|B85122 serine/threonine kinase-like protein (partial)...   198   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb:AY062569_1565225 Arabidopsis thaliana putative protein (At4g2...   197   3e-58   
gb:AY052582_1562778 Raphanus sativus haplotype S7 S-locus recept...   185   3e-58   
pir|JQ1677|JQ1677 S-receptor kinase (EC 2.7.1.-) precursor - rap...   191   5e-58   Brassica napus var. napus [annual rape]
gb:AP004231_1839010 Oryza sativa (japonica cultivar-group) genom...   189   5e-58   
gb:OSJN00097_1694867 Oryza sativa genomic DNA, chromosome 4, BAC...   185   5e-58   
gb:AC091233_1734637 Oryza sativa chromosome 3 BAC OSJNBa0053G10 ...   191   6e-58   
gb:AC091234_1734688 Oryza sativa chromosome 3 BAC OSJNBa0057E11 ...   191   6e-58   
gb:AY133720_1581540 Arabidopsis thaliana clone C103370 putative ...   192   8e-58   
pir|A41369|A41369 S-receptor kinase (EC 2.7.1.-) 6 precursor - w...   186   1e-57   Brassica oleracea var. viridis [collards]
pir|T05753|T05753 S-receptor kinase (EC 2.7.1.-) M4I22.100 precu...   191   1e-57   Arabidopsis thaliana [mouse-ear cress]
sp|Q09092|SRK6_BRAOL|SRK6_BRAOL Putative serine/threonine-protein kinase re...   186   2e-57   Brassica oleracea
gb:BOLSRKA_1633859 Turnip mRNA for S-receptor kinase SRK9, parti...   180   3e-57   
pir|T14398|T14398 S-receptor kinase (EC 2.7.1.-) - turnip>gb:D88...   180   3e-57   Brassica rapa
gb:AP004348_1840627 Oryza sativa (japonica cultivar-group) genom...   191   4e-57   
pir|T04845|T04845 probable serine/threonine-specific protein kin...   186   4e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AY534540_1612233 Raphanus sativus haplotype S27 S-locus recep...   186   4e-57   
pir|E96641|E96641 hypothetical protein T25B24.4 [imported] - Ara...   191   5e-57   Arabidopsis thaliana [mouse-ear cress]
pir|D85065|D85065 receptor protein kinase-like protein [imported...   196   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AY534543_1612236 Raphanus sativus haplotype S31 S-locus recep...   185   5e-57   
gb:AY534538_1612231 Raphanus sativus haplotype S22 S-locus recep...   185   5e-57   
pir|T05181|T05181 S-receptor kinase (EC 2.7.1.-) T6K22.120 precu...   190   7e-57   Arabidopsis thaliana [mouse-ear cress]
pir|T14450|T14450 serine/threonine kinase (EC 2.7.1.-) BRLK - wi...   189   7e-57   Brassica oleracea
gb:AY303171_1597401 Solanum bulbocastanum chromosome 8 clone 177...   185   1e-56   
pir|T14471|T14471 probable S-receptor kinase (EC 2.7.1.-) srk29 ...   183   2e-56   Brassica oleracea
gb:AY534536_1612229 Raphanus sativus haplotype S18 S-locus recep...   187   2e-56   
pir|H86246|H86246 hypothetical protein [imported] - Arabidopsis ...   182   3e-56   Arabidopsis thaliana [mouse-ear cress]
gb:STU306626_1723037 Solanum tuberosum mRNA for putative recepto...   184   3e-56   
gb:AP004401_1841245 Oryza sativa (japonica cultivar-group) genom...   191   4e-56   
pir|T02053|T02053 S-receptor kinase (EC 2.7.1.-) KIK1 precursor ...   179   4e-56   Zea mays [maize]
pir|T10567|T10567 probable serine/threonine-specific protein kin...   183   4e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1020856 Oryza sativa (japonica cultivar-group) chrom...   181   4e-56   
gb:AY052583_1562779 Raphanus sativus haplotype S8 S-locus recept...   182   6e-56   
pir|T47526|T47526 protein kinase-like - Arabidopsis thaliana>gb:...   181   7e-56   Arabidopsis thaliana [mouse-ear cress]
gb:AB032473_1518696 Brassica oleracea SRK18 mRNA for S18 S-locus...   184   1e-55   
pir|T04841|T04841 protein kinase homolog F21P8.130 - Arabidopsis...   184   1e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AY052579_1562775 Raphanus sativus haplotype S1 S-locus recept...   181   1e-55   
pir|T04833|T04833 hypothetical protein F21P8.50 - Arabidopsis th...   181   1e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AP004401_1841247 Oryza sativa (japonica cultivar-group) genom...   180   1e-55   
gb:AF078082_1766256 Phaseolus vulgaris receptor-like protein kin...   184   1e-55   
pir|T04839|T04839 protein kinase homolog F21P8.110 - Arabidopsis...   182   2e-55   Arabidopsis thaliana [mouse-ear cress]
pir|T04832|T04832 probable serine/threonine-specific protein kin...   184   2e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AY090250_1574003 Arabidopsis thaliana AT4g23250/F21P8_140 mRN...   184   2e-55   
gb:BT000052_1634330 Arabidopsis thaliana serine/threonine kinase...   182   2e-55   
pir|A86247|A86247 hypothetical protein [imported] - Arabidopsis ...   182   3e-55   Arabidopsis thaliana [mouse-ear cress]
gb:AB013720_1512253 Brassica oleracea mRNA for SRK23Bol, partial...   181   4e-55   
pir|S31429|S31429 S-receptor kinase (EC 2.7.1.-) precursor - wil...   185   5e-55   Brassica oleracea
pir|T14472|T14472 S-receptor kinase (EC 2.7.1.-) - wild cabbage>...   176   5e-55   Brassica oleracea
gb:AF224706_1778585 Arabidopsis thaliana receptor-like protein k...   181   5e-55   
gb:STU306629_1723040 Solanum tuberosum mRNA for putative recepto...   181   5e-55   
gb:STU306627_1723038 Solanum tuberosum mRNA for putative recepto...   181   5e-55   
pir|T04831|T04831 probable serine/threonine-specific protein kin...   181   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb:STU306628_1723039 Solanum tuberosum mRNA for putative recepto...   181   5e-55   
gb:AY099582_1576608 Arabidopsis thaliana serine/threonine kinase...   178   5e-55   
gb:AP003983_1835897 Oryza sativa (japonica cultivar-group) genom...   178   5e-55   
gb:OSJN00019_1693373 Oryza sativa genomic DNA, chromosome 4, BAC...   175   6e-55   
gb:AF084035_1767052 Arabidopsis thaliana receptor-like protein k...   186   6e-55   
pir|T10569|T10569 probable serine/threonine-specific protein kin...   185   1e-54   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00019_1693376 Oryza sativa genomic DNA, chromosome 4, BAC...   178   3e-54   
gb:AE016959_1020855 Oryza sativa (japonica cultivar-group) chrom...   180   3e-54   
pir|S51527|S51527 S-receptor kinase (EC 2.7.1.-) A14 precursor -...   174   4e-54   Brassica napus [oilseed rape]
gb:AY052580_1562776 Raphanus sativus haplotype S2 S-locus recept...   174   4e-54   
gb:AP005742_1856983 Oryza sativa (japonica cultivar-group) genom...   174   5e-54   
gb:AB012106_1511634 Brassica rapa mRNA for SRK45, complete cds.       173   7e-54   
gb:AC129718_1740653 Oryza sativa (japonica cultivar-group) chrom...   180   7e-54   
pir|T10568|T10568 probable serine/threonine-specific protein kin...   173   7e-54   Arabidopsis thaliana [mouse-ear cress]
pir|T04842|T04842 protein kinase AK4 (EC 2.7.1.-) - Arabidopsis ...   183   9e-54   Arabidopsis thaliana [mouse-ear cress]
pir|T04848|T04848 protein kinase homolog F16G20.10 - Arabidopsis...   177   9e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AF084037_1767054 Arabidopsis thaliana receptor-like protein k...   183   9e-54   
gb:AY140033_1582473 Arabidopsis thaliana protein kinase-like pro...   183   9e-54   
gb:AB032474_1518697 Brassica oleracea SRK60 mRNA for S60 S-locus...   182   1e-53   
gb:AB024419S2_1515949 Brassica oleracea SRK13 gene, exon 2, 3, 4...   182   1e-53   
gb:AB024421S2_1515950 Brassica oleracea SRK13-b gene, exon 2, 3,...   182   1e-53   
gb:AY534541_1612234 Raphanus sativus haplotype S29 S-locus recep...   178   1e-53   
gb:AP005742_1856979 Oryza sativa (japonica cultivar-group) genom...   171   2e-53   
gb:ATH011674_1551954 Arabidopsis thaliana mRNA for receptor-like...   171   2e-53   
gb:AB054061_1521307 Brassica rapa SRK22 mRNA for S locus recepto...   181   2e-53   
gb:AP003811_1833703 Oryza sativa (japonica cultivar-group) genom...   174   2e-53   
gb:AP003856_1834380 Oryza sativa (japonica cultivar-group) genom...   179   3e-53   
gb:AY052584_1562780 Raphanus sativus haplotype S9 S-locus recept...   179   3e-53   
gb:AK118493_1816466 Arabidopsis thaliana At4g23140 mRNA for puta...   175   4e-53   
gb:AY534533_1612226 Raphanus sativus haplotype S11 S-locus recep...   178   4e-53   
gb:AP005679_1855870 Oryza sativa (japonica cultivar-group) genom...   174   7e-53   
pir|D86247|D86247 hypothetical protein [imported] - Arabidopsis ...   164   7e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AY534535_1612228 Raphanus sativus haplotype S16 S-locus recep...   177   7e-53   
gb:BOLRPKB_1633858 Brassica campestris mRNA for receptor protein...   179   9e-53   
gb:AY534537_1612230 Raphanus sativus haplotype S20 S-locus recep...   177   9e-53   
pir|T02153|T02153 protein kinase homolog T1F15.1 - Arabidopsis t...   179   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AB041622_1519689 Brassica rapa BcRK6 gene for receptor kinase...   200   2e-52   
pir|T10566|T10566 probable serine/threonine-specific protein kin...   175   5e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AB012247_1511814 Arabidopsis thaliana genomic DNA, chromosome...   179   8e-52   
pir|E86247|E86247 receptor-like protein kinase [imported] - Arab...   175   8e-52   Arabidopsis thaliana [mouse-ear cress]
gb:AY052585_1562781 Raphanus sativus haplotype S10 S-locus recep...   176   8e-52   
gb:AP003863_1834484 Oryza sativa (japonica cultivar-group) genom...   167   1e-51   
pir|T06082|T06082 protein kinase homolog T9A14.110 - Arabidopsis...   168   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AP005810_1858257 Oryza sativa (japonica cultivar-group) genom...   175   2e-51   
gb:AB013717S2_1512251 Brassica rapa gene for SRK46Bra, exon 2, 3...   174   3e-51   
pir|JC2481|JC2481 S-receptor kinase (EC 2.7.1.-) 8 precursor - f...   174   3e-51   Brassica rapa
gb:OSJN00019_1693370 Oryza sativa genomic DNA, chromosome 4, BAC...   173   5e-51   
gb:AP003368_1828581 Oryza sativa (japonica cultivar-group) genom...   165   7e-51   
pir|JC2482|JC2482 S-receptor kinase (EC 2.7.1.-) 12 precursor - ...   170   2e-50   Brassica rapa
gb:AP003863_1834480 Oryza sativa (japonica cultivar-group) genom...   160   2e-50   
gb:AY303171_1597402 Solanum bulbocastanum chromosome 8 clone 177...   153   4e-50   
gb:AP003811_1833701 Oryza sativa (japonica cultivar-group) genom...   174   4e-50   
gb:AP003863_1834477 Oryza sativa (japonica cultivar-group) genom...   164   5e-50   
gb:AP003863_1834472 Oryza sativa (japonica cultivar-group) genom...   169   5e-50   
pir|F85057|F85057 receptor-like protein kinase [imported] - Arab...   176   5e-50   Arabidopsis thaliana [mouse-ear cress]
gb:BT010572_1640518 Arabidopsis thaliana At4g23300 gene, complet...   163   7e-50   
pir|T04847|T04847 probable serine/threonine-specific protein kin...   163   7e-50   Arabidopsis thaliana [mouse-ear cress]
gb:AF224707_1778586 Arabidopsis thaliana receptor-like protein k...   198   9e-50   
gb:AY142496_1582925 Arabidopsis thaliana putative protein kinase...   198   9e-50   
pir|T04830|T04830 probable serine/threonine-specific protein kin...   198   9e-50   Arabidopsis thaliana [mouse-ear cress]
gb:AP003736_1832655 Oryza sativa (japonica cultivar-group) genom...   166   9e-50   
gb:AP003736_1832650 Oryza sativa (japonica cultivar-group) genom...   167   9e-50   
gb:AP004688_1843412 Oryza sativa (japonica cultivar-group) genom...   176   9e-50   
pir|C85057|C85057 probable receptor-like protein kinase [importe...   173   2e-49   Arabidopsis thaliana [mouse-ear cress]
pir|T04846|T04846 protein kinase homolog F21P8.180 - Arabidopsis...   159   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb:AP005810_1858256 Oryza sativa (japonica cultivar-group) genom...   156   3e-49   
gb:AP003863_1834475 Oryza sativa (japonica cultivar-group) genom...   161   5e-49   
gb:AP004260_1839289 Oryza sativa (japonica cultivar-group) genom...   166   6e-49   
gb:AP003863_1834478 Oryza sativa (japonica cultivar-group) genom...   157   4e-48   
gb:AJ704376_1813563 Senecio squalidus mRNA for S-receptor kinase...   191   1e-47   
gb:AP005786_1857838 Oryza sativa (japonica cultivar-group) genom...   164   1e-47   
pir|T01550|T01550 receptor kinase homolog A_TM018A10.18 - Arabid...   155   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb:LCO580824_1684039 Lotus corniculatus var. japonicus har1 gene...   159   2e-47   
gb:AP005156_1848351 Oryza sativa (japonica cultivar-group) genom...   171   7e-47   
gb:AP005774_1857664 Oryza sativa (japonica cultivar-group) genom...   157   7e-47   
gb:AC099774_1737232 Oryza sativa chromosome 10 BAC OSJNBa0073L20...   160   9e-47   
gb:AP003736_1832662 Oryza sativa (japonica cultivar-group) genom...   170   9e-47   
gb:AP003736_1832657 Oryza sativa (japonica cultivar-group) genom...   164   9e-47   
gb:ATF16G20_1548770 Arabidopsis thaliana DNA chromosome 4, BAC c...   153   9e-47   
gb:AE005172_890143 Arabidopsis thaliana chromosome 1, top arm co...   147   2e-46   
gb:AE005173_893819 Arabidopsis thaliana chromosome 1, bottom arm...   166   2e-46   
gb:AP003736_1832661 Oryza sativa (japonica cultivar-group) genom...   168   2e-46   
gb:AE016959_1021800 Oryza sativa (japonica cultivar-group) chrom...   164   3e-46   
gb:ATCHRIV12_1544293 Arabidopsis thaliana DNA chromosome 4, cont...   174   6e-46   
gb:AP003811_1833702 Oryza sativa (japonica cultivar-group) genom...   153   6e-46   
pir|T09349|T09349 S-receptor kinase (EC 2.7.1.-) T26M18.110 prec...   153   8e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AP003863_1834476 Oryza sativa (japonica cultivar-group) genom...   150   1e-45   
pir|G85056|G85056 probable receptor-like protein kinase [importe...   175   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AE005173_893805 Arabidopsis thaliana chromosome 1, bottom arm...   159   2e-45   
gb:AP004260_1839291 Oryza sativa (japonica cultivar-group) genom...   155   2e-45   
pir|H85056|H85056 probable receptor-like protein kinase [importe...   163   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AP003736_1832653 Oryza sativa (japonica cultivar-group) genom...   159   4e-45   
gb:AY074844_1567697 Arabidopsis thaliana AT4g21410/T6K22_140 mRN...   153   6e-45   
pir|G96640|G96640 hypothetical protein T25B24.10 [imported] - Ar...   161   8e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AP004274_1839611 Oryza sativa (japonica cultivar-group) genom...   152   8e-45   
pir|B96640|B96640 hypothetical protein T25B24.15 [imported] - Ar...   160   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1021829 Oryza sativa (japonica cultivar-group) chrom...   159   1e-44   
pir|T05148|T05148 protein kinase homolog F18E5.20 - Arabidopsis ...   148   2e-44   Arabidopsis thaliana [mouse-ear cress]
pir|D96639|D96639 protein T1F9.12 [imported] - Arabidopsis thali...   155   2e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AP003863_1834479 Oryza sativa (japonica cultivar-group) genom...   135   3e-44   
pir|T01551|T01551 receptor kinase homolog A_TM018A10.19 - Arabid...   147   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AY056250_1563570 Arabidopsis thaliana putative serine/threoni...   159   4e-44   
pir|G86246|G86246 hypothetical protein [imported] - Arabidopsis ...   159   4e-44   Arabidopsis thaliana [mouse-ear cress]
pir|C96639|C96639 protein T1F9.14 [imported] - Arabidopsis thali...   153   5e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AP003736_1832651 Oryza sativa (japonica cultivar-group) genom...   157   7e-44   
gb:AE005173_893813 Arabidopsis thaliana chromosome 1, bottom arm...   156   1e-43   
gb:AF083714_1766944 Arabidopsis thaliana clone sps280 unknown mRNA.   157   2e-43   
gb:AE016959_1021799 Oryza sativa (japonica cultivar-group) chrom...   148   4e-43   
gb:AE005173_893811 Arabidopsis thaliana chromosome 1, bottom arm...   150   1e-42   
gb:AE005173_893809 Arabidopsis thaliana chromosome 1, bottom arm...   153   1e-42   
gb:AP005156_1848353 Oryza sativa (japonica cultivar-group) genom...   154   4e-42   
gb:AE005173_893807 Arabidopsis thaliana chromosome 1, bottom arm...   157   8e-42   
pir|F96639|F96639 protein T1F9.8 [imported] - Arabidopsis thalia...   154   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AP003736_1832664 Oryza sativa (japonica cultivar-group) genom...   154   2e-41   
gb:AY085162_1570243 Arabidopsis thaliana clone 13461 mRNA, compl...   155   3e-41   
gb:AF088885_1767271 Nicotiana tabacum receptor-like kinase CHRK1...   142   3e-41   
gb:AP003935_1835510 Oryza sativa (japonica cultivar-group) genom...   139   1e-40   
gb:AP003770_1833321 Oryza sativa (japonica cultivar-group) genom...   142   1e-39   
gb:OSJN00082_1694555 Oryza sativa genomic DNA, chromosome 4, BAC...   138   5e-39   
pir|A96640|A96640 protein T1F9.2 [imported] - Arabidopsis thalia...   144   8e-39   Arabidopsis thaliana [mouse-ear cress]
pir|B96729|B96729 hypothetical protein F24J13.9 [imported] - Ara...   134   8e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AP005810_1858259 Oryza sativa (japonica cultivar-group) genom...   153   4e-38   
gb:AB092809_1525114 Lotus corniculatus var. japonicus HAR1 gene ...   159   4e-38   
gb:AP003863_1834463 Oryza sativa (japonica cultivar-group) genom...   159   7e-38   
pir|H96731|H96731 hypothetical protein F5A18.8 [imported] - Arab...   145   8e-38   Arabidopsis thaliana [mouse-ear cress]
pir|T04836|T04836 probable serine/threonine-specific protein kin...   157   3e-37   Arabidopsis thaliana [mouse-ear cress]
pir|T04844|T04844 probable serine/threonine-specific protein kin...   156   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AB006702_1509943 Arabidopsis thaliana genomic DNA, chromosome...   141   7e-37   
pir|T10570|T10570 probable serine/threonine-specific protein kin...   139   7e-37   Arabidopsis thaliana [mouse-ear cress]
pir|G85121|G85121 serine/threonine kinase-like protein (partial)...   139   7e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AP006529_1862252 Oryza sativa (japonica cultivar-group) genom...   132   3e-36   
gb:AE005172_890149 Arabidopsis thaliana chromosome 1, top arm co...   117   6e-36   
pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis tha...   140   6e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AF474072_1803107 Hordeum vulgare sp. vulgare cultivar Morex B...   134   1e-35   
gb:AP004553_1841485 Oryza sativa (japonica cultivar-group) genom...   124   2e-35   
gb:OSJN00082_1694565 Oryza sativa genomic DNA, chromosome 4, BAC...   125   2e-35   
gb:OSJN00093_1694775 Oryza sativa genomic DNA, chromosome 4, BAC...   134   3e-35   
gb:OSJN00153_1695778 Oryza sativa genomic DNA, chromosome 4, BAC...   134   5e-35   
gb:AC079357_1732541 Oryza sativa (japonica cultivar-group) chrom...   130   6e-35   
gb:OSJN00093_1694778 Oryza sativa genomic DNA, chromosome 4, BAC...   134   8e-35   
gb:AE005172_890869 Arabidopsis thaliana chromosome 1, top arm co...   127   1e-34   
gb:AP005679_1855873 Oryza sativa (japonica cultivar-group) genom...   148   1e-34   
gb:AP005442_1851834 Oryza sativa (japonica cultivar-group) genom...   138   1e-34   
pir|A86211|A86211 hypothetical protein [imported] - Arabidopsis ...   137   1e-34   Arabidopsis thaliana [mouse-ear cress]
pir|T04954|T04954 hypothetical protein F7J7.170 - Arabidopsis th...   147   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023140 Oryza sativa (japonica cultivar-group) chrom...   136   2e-34   
pir|T05149|T05149 protein kinase homolog F18E5.30 - Arabidopsis ...   147   2e-34   Arabidopsis thaliana [mouse-ear cress]
pir|D96574|D96574 hypothetical protein T3F20.24 [imported] - Ara...   136   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AC079288_1732514 Arabidopsis thaliana chromosome 1 BAC T3M22 ...   130   3e-34   
pir|C96574|C96574 hypothetical protein T3F20.25 [imported] - Ara...   134   3e-34   Arabidopsis thaliana [mouse-ear cress]
pir|H86420|H86420 probable receptor-like serine/threonine kinase...   130   3e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome...   133   4e-34   
gb:OSJN00165_1696020 Oryza sativa genomic DNA, chromosome 4, BAC...   134   5e-34   
gb:AP003935_1835507 Oryza sativa (japonica cultivar-group) genom...   127   7e-34   
pir|T04849|T04849 protein kinase homolog F16G20.20 - Arabidopsis...   145   1e-33   Arabidopsis thaliana [mouse-ear cress]
pir|G96602|G96602 probable receptor protein kinase F14G9.24 [imp...   137   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AC009894_1536870 Arabidopsis thaliana chromosome I BAC T6H22 ...   137   1e-33   
gb:OSJN00152_1695767 Oryza sativa genomic DNA, chromosome 4, BAC...   132   1e-33   
gb:AP005810_1858273 Oryza sativa (japonica cultivar-group) genom...   144   2e-33   
gb:AF024649_1762137 Arabidopsis thaliana receptor-like serine/th...   127   3e-33   
gb:OSJN00019_1693379 Oryza sativa genomic DNA, chromosome 4, BAC...   116   4e-33   
gb:AP003141_1824857 Oryza sativa (japonica cultivar-group) genom...   120   6e-33   
gb:OSJN00093_1694776 Oryza sativa genomic DNA, chromosome 4, BAC...   128   1e-32   
pir|G86420|G86420 probable receptor-like serine/threonine kinase...   129   1e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AC079288_1732515 Arabidopsis thaliana chromosome 1 BAC T3M22 ...   129   1e-32   
gb:AY738765_1626113 Carica papaya s-locus lectin protein kinase ...   141   1e-32   
gb:AY142503_1582932 Arabidopsis thaliana putative serine/threoni...   141   1e-32   
gb:AC136220_1743067 Oryza sativa (japonica cultivar-group) chrom...   126   2e-32   
pir|E96602|E96602 hypothetical protein T6H22.9 [imported] - Arab...   132   2e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AP003334_1828124 Oryza sativa (japonica cultivar-group) genom...   121   2e-32   
gb:OSJN00093_1694777 Oryza sativa genomic DNA, chromosome 4, BAC...   131   3e-32   
gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genom...   129   4e-32   
gb:AC009894_1536869 Arabidopsis thaliana chromosome I BAC T6H22 ...   129   4e-32   
gb:AE005173_893815 Arabidopsis thaliana chromosome 1, bottom arm...   114   6e-32   
gb:BOSRKRPC_1633900 B.oleracea encoding S-receptor kinase relate...   139   8e-32   
pir|S39911|S39911 S-receptor kinase K4 (EC 2.7.1.-) - wild cabba...   139   8e-32   Brassica oleracea
pir|S31413|S31413 S-receptor kinase-related protein 4 - Chinese ...   139   8e-32   Brassica oleracea
gb:AC137612_1743549 Oryza sativa (japonica cultivar-group) chrom...   128   1e-31   
gb:AC008030_1536482 Arabidopsis thaliana chromosome I BAC F1N18 ...   123   2e-31   
gb:AP003858_1834406 Oryza sativa (japonica cultivar-group) genom...   129   2e-31   
pir|F86420|F86420 probable receptor-like serine/threonine kinase...   123   2e-31   
gb:AY113170_1578244 Arabidopsis thaliana At1g29720/T3M22_6 mRNA,...   123   2e-31   
gb:OSJN00019_1693383 Oryza sativa genomic DNA, chromosome 4, BAC...   110   2e-31   
gb:AP004093_1837600 Oryza sativa (japonica cultivar-group) genom...   125   3e-31   
pir|F96602|F96602 hypothetical protein T6H22.8.2 [imported] - Ar...   130   8e-31   
gb:AC135916_1742802 Genomic sequence for Oryza sativa, Nipponbar...   125   8e-31   
gb:AP003858_1834408 Oryza sativa (japonica cultivar-group) genom...   121   1e-30   
gb:BT006243_1639135 Arabidopsis thaliana At4g11890 mRNA, complet...   124   1e-30   
pir|T09348|T09348 protein kinase homolog T26M18.100 - Arabidopsi...   124   1e-30   
gb:AC136220_1743061 Oryza sativa (japonica cultivar-group) chrom...   124   1e-30   
pir|C96729|C96729 hypothetical protein F24J13.10 [imported] - Ar...   126   3e-30   
gb:AP004768_1844703 Oryza sativa (japonica cultivar-group) genom...   124   3e-30   
pir|H86301|H86301 hypothetical protein F19K19.4 [imported] - Ara...   125   4e-30   
gb:AY059921_1564765 Arabidopsis thaliana Unknown protein (F19K19...   125   4e-30   
pir|T47694|T47694 probable serine/threonine-specific protein kin...   122   9e-30   
gb:AF480497_1803756 Oryza sativa clone BAC 24K23, complete seque...   115   3e-29   
gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genom...   130   3e-29   
gb:OSJN00174_1696190 Oryza sativa genomic DNA, chromosome 4, BAC...   124   6e-29   
gb:OSA243961_1692389 Oryza sativa chromosome 4 BAC l1332 genomic...   124   6e-29   
pir|T04455|T04455 hypothetical protein F4D11.90 - Arabidopsis th...   129   6e-29   
gb:AY358029_1601932 Medicago truncatula lectin-like receptor kin...   123   7e-29   
pir|T10661|T10661 serine/threonine-specific protein kinase homol...   108   1e-28   
gb:OSJN00093_1694779 Oryza sativa genomic DNA, chromosome 4, BAC...   127   2e-28   
gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genom...   126   2e-28   
gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genom...   126   2e-28   
pir|B86440|B86440 probable protein kinase [imported] - Arabidops...   113   2e-28   
gb:BOSRKRPA_1633898 B.oleracea encoding S-receptor kinase relate...   127   2e-28   
pir|S39909|S39909 S-receptor kinase K2 (EC 2.7.1.-) - wild cabba...   127   2e-28   
pir|S31396|S31396 S-receptor kinase-related protein 2 - Chinese ...   127   2e-28   
gb:OSJN00019_1693378 Oryza sativa genomic DNA, chromosome 4, BAC...   103   4e-28   
gb:AP003728_1832549 Oryza sativa (japonica cultivar-group) genom...   117   4e-28   
gb:AP005533_1853634 Oryza sativa (japonica cultivar-group) genom...   107   8e-28   
gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complet...   125   9e-28   
gb:BOSRKRPD_1633901 B.oleracea encoding S-receptor kinase protein.    125   9e-28   
gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome...   125   9e-28   
pir|S39912|S39912 S-receptor kinase K6 (EC 2.7.1.-) - wild cabba...   125   9e-28   
pir|S31397|S31397 S-receptor kinase-related protein 1 - Chinese ...   125   9e-28   
gb:AF462229_1801882 Narcissus pseudonarcissus receptor-like prot...    99   1e-27   
gb:AP002972_1824065 Oryza sativa (japonica cultivar-group) genom...   125   1e-27   
gb:AY536858_1612412 Arabidopsis thaliana putative protein kinase...   125   1e-27   
gb:AB090881_1524972 Aster tripolium mRNA for serine/threonine pr...   125   1e-27   
gb:AX088876_1461047 Sequence 1 from Patent WO0114563.>gb:AX82570...   125   1e-27   
gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09 (R2...   118   1e-27   
gb:AY062680_1565336 Arabidopsis thaliana Unknown protein (At1g09...   110   1e-27   
gb:AC135205_1742004 Oryza sativa (japonica cultivar-group) chrom...   110   2e-27   
gb:BT003881_1637008 Arabidopsis thaliana clone RAFL15-23-A08 (R2...   124   2e-27   
pir|B96609|B96609 probable protein kinase F25P12.84 [imported] -...   111   2e-27   
gb:BT008322_1639539 Arabidopsis thaliana At1g56720 gene, complet...   111   2e-27   
gb:AY087491_1572522 Arabidopsis thaliana clone 36000 mRNA, compl...   111   2e-27   
gb:AP005419_1851480 Oryza sativa (japonica cultivar-group) genom...   117   2e-27   
gb:AF024648_1762136 Arabidopsis thaliana receptor-like serine/th...   124   3e-27   
gb:AC079288_1732513 Arabidopsis thaliana chromosome 1 BAC T3M22 ...   124   3e-27   
gb:AY730335_1625407 Solanum tuberosum strain P6/210 clone BAC BA...   124   3e-27   
gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complet...   124   3e-27   
gb:AY091006_1574238 Arabidopsis thaliana putative receptor serin...   124   3e-27   
pir|A86421|A86421 Receptor-like serine/threonine kinase (RFK1) [...   124   3e-27   
gb:AC133334_1741356 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...   105   3e-27   
gb:AC133334_1741357 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...   105   3e-27   
gb:AP004744_1844232 Oryza sativa (japonica cultivar-group) genom...   119   3e-27   
gb:AP000382_1819890 Arabidopsis thaliana genomic DNA, chromosome...   123   3e-27   
gb:AC137001_1743353 Oryza sativa (japonica cultivar-group) chrom...   123   3e-27   
gb:AY224526_1590723 Oryza sativa (japonica cultivar-group) isola...   123   3e-27   
gb:AY091071_1574298 Arabidopsis thaliana putative protein kinase...   123   3e-27   
pir|A96529|A96529 hypothetical protein F13F21.28 [imported] - Ar...   123   3e-27   
pir|E84587|E84587 probable protein kinase [imported] - Arabidops...   123   3e-27   
gb:AP003300_1827660 Oryza sativa (japonica cultivar-group) genom...   123   5e-27   
gb:AP000410_1820018 Arabidopsis thaliana genomic DNA, chromosome...   123   5e-27   
gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA...   120   5e-27   
pir|T01502|T01502 probable serine/threonine-specific protein kin...   120   5e-27   
pir|H84770|H84770 probable receptor-like protein kinase [importe...   110   5e-27   
gb:AK176466_1818454 Arabidopsis thaliana mRNA, complete cds, clo...   122   6e-27   
gb:AE005172_891020 Arabidopsis thaliana chromosome 1, top arm co...   122   6e-27   
sp|Q9LQQ8|RCK7_ARATH|RCK7_ARATH Putative serine/threonine-protein kinase RL...   120   7e-27   
pir|G84686|G84686 probable protein kinase [imported] - Arabidops...   117   7e-27   
gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome...   122   8e-27   
gb:AP004082_1837433 Oryza sativa (japonica cultivar-group) genom...   122   9e-27   
pir|A96563|A96563 probable protein kinase 60711-62822 [imported]...   122   1e-26   
pir|D96711|D96711 hypothetical protein F24J5.8 [imported] - Arab...   122   1e-26   
gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genom...   111   1e-26   
gb:AB041503_1519669 Populus nigra PnPK1 mRNA for protein kinase ...   118   1e-26   
gb:AP005299_1850138 Oryza sativa (japonica cultivar-group) genom...   121   1e-26   
gb:AC133333_1741337 Oryza sativa chromosome 3 BAC OJ1785_A05 gen...   121   1e-26   
gb:AY358030_1601933 Medicago truncatula lectin-like receptor kin...   121   2e-26   
gb:AB099698_1526154 Arabidopsis thaliana CDG1 mRNA for protein k...   121   2e-26   
gb:AB028609_1517917 Arabidopsis thaliana genomic DNA, chromosome...   121   2e-26   
gb:AB026649_1517226 Arabidopsis thaliana genomic DNA, chromosome...   121   2e-26   
gb:AB026639_1517086 Arabidopsis thaliana genomic DNA, chromosome...   121   2e-26   
pir|T48301|T48301 protein kinase-like - Arabidopsis thaliana>gb:...   121   2e-26   
pir|T52400|T52400 receptor-like protein kinase [imported] - Arab...   106   2e-26   
gb:AC104473_1737662 Oryza sativa (japonica cultivar-group) chrom...   115   2e-26   
gb:AP005508_1853071 Oryza sativa (japonica cultivar-group) genom...   120   2e-26   
gb:AY395743_1604832 Vitis aestivalis protein kinase-like protein...   120   2e-26   
gb:OSJN00017_1693336 Oryza sativa genomic DNA, chromosome 4, BAC...   113   3e-26   
pir|T51453|T51453 serine/threonine specific protein kinase-like ...   120   3e-26   
gb:AY050535_1562263 Arabidopsis thaliana leucine-rich repeat rec...   106   3e-26   
pir|B86467|B86467 hypothetical protein F23M19.5 - Arabidopsis th...   112   3e-26   
gb:AY087034_1572070 Arabidopsis thaliana clone 30775 mRNA, compl...   120   4e-26   
gb:ATAC008261_1542788 Arabidopsis thaliana chromosome III BAC T4...   120   4e-26   
gb:AP002032_1821485 Arabidopsis thaliana genomic DNA, chromosome...   117   4e-26   
gb:AC079022_1541726 Oryza sativa chromosome 5 clone P0574H01, co...   115   4e-26   
gb:AY007545_1558031 Brassica napus protein serine/threonine kina...   116   4e-26   
pir|G96593|G96593 probable protein kinase, 86372-89112 [imported...   111   5e-26   
gb:AP002901_1823734 Oryza sativa (japonica cultivar-group) genom...   119   7e-26   
gb:AP002901_1823733 Oryza sativa (japonica cultivar-group) genom...   119   7e-26   
gb:AK118356_1816339 Arabidopsis thaliana At5g62710 mRNA for puta...   119   7e-26   
gb:BT005955_1638877 Arabidopsis thaliana At4g34440 gene, complet...   119   7e-26   
gb:AB009053_1510681 Arabidopsis thaliana genomic DNA, chromosome...   119   7e-26   
pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis tha...   112   7e-26   
gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,...   112   7e-26   
gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding ...   112   7e-26   
gb:AP003237_1825950 Oryza sativa (japonica cultivar-group) genom...   119   9e-26   
gb:AP002537_1822501 Oryza sativa (japonica cultivar-group) genom...   119   9e-26   
gb:AC135209_1742079 Oryza sativa (japonica cultivar-group) chrom...   119   9e-26   
gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genom...   115   9e-26   
gb:BT000971_1635226 Arabidopsis thaliana clone C104780 unknown p...   110   9e-26   
gb:AY056259_1563577 Arabidopsis thaliana unknown protein (At5g56...   110   9e-26   
gb:AP004030_1836608 Oryza sativa (japonica cultivar-group) genom...   118   1e-25   
gb:BT015370_1642198 Arabidopsis thaliana At5g01560 gene, complet...   118   1e-25   
pir|T48177|T48177 receptor like protein kinase - Arabidopsis tha...   118   1e-25   
gb:AY093029_1574983 Arabidopsis thaliana protein serine/threonin...   100   1e-25   
gb:AC125472_1740503 Oryza sativa (japonica cultivar-group) chrom...   115   1e-25   
gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genom...   118   1e-25   
gb:CQ768555_1451795 Sequence 50 from Patent WO2004007712.>gb:AX1...   100   2e-25   
pir|T50817|T50817 protein serine/threonine kinase-like protein -...   100   2e-25   
gb:AP005443_1851850 Oryza sativa (japonica cultivar-group) genom...   110   2e-25   
gb:AC098693_1736831 Oryza sativa (japonica cultivar-group) chrom...   117   2e-25   
gb:OSJN00054_1693976 Oryza sativa genomic DNA, chromosome 4, BAC...   117   2e-25   
sp|Q9FE20|PBS1_ARATH|PBS1_ARATH Serine/threonine-protein kinase PBS1 (EC 2....   117   2e-25   
sp|Q06548|APKA_ARATH|APKA_ARATH Protein kinase APK1A (EC 2.7.1.-).>pir|S286...   117   2e-25   
gb:CQ768545_1451790 Sequence 40 from Patent WO2004007712.>gb:AY0...   108   2e-25   
gb:AX138085_1462208 Sequence 31 from Patent EP1094113.                108   2e-25   
pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5....   108   2e-25   
gb:AP003277_1827082 Oryza sativa (japonica cultivar-group) genom...   114   2e-25   
gb:AP004314_1840053 Oryza sativa (japonica cultivar-group) genom...   117   2e-25   
pir|D96728|D96728 hypothetical protein F24J13.3 [imported] - Ara...   117   2e-25   
pir|F86387|F86387 probable Pto kinase interactor [imported] - Ar...   117   2e-25   
pir|T48175|T48175 receptor like protein kinase - Arabidopsis tha...   117   2e-25   
gb:AC118284_1739500 Oryza sativa (japonica cultivar-group) chrom...   114   3e-25   
gb:AP004791_1845157 Oryza sativa (japonica cultivar-group) genom...   108   3e-25   
gb:AP003219_1825460 Oryza sativa (japonica cultivar-group) genom...   106   3e-25   
gb:AC137999_1743922 Oryza sativa chromosome 3 BAC OSJNBa0020H02 ...    94   3e-25   
gb:AP003266_1826760 Oryza sativa (japonica cultivar-group) genom...   117   3e-25   
pir|F84564|F84564 probable protein kinase [imported] - Arabidops...   117   3e-25   
pir|T07699|T07699 hypothetical protein F17N18.80 - Arabidopsis t...   117   3e-25   
gb:AB041504_1519670 Populus nigra PnPK2 mRNA for protein kinase ...   114   3e-25   
gb:AP003864_1834495 Oryza sativa (japonica cultivar-group) genom...   116   4e-25   
gb:AC130603_1740791 Oryza sativa (japonica cultivar-group) chrom...   116   4e-25   
gb:AC091494_1734784 Oryza sativa chromosome 3 BAC OSJNBa0070N04 ...   116   4e-25   
gb:AP005394_1851023 Oryza sativa (japonica cultivar-group) genom...   115   4e-25   
sp|P43293|NAK_ARATH|NAK_ARATH Probable serine/threonine-protein kinase NAK...   114   5e-25   
gb:AP004254_1839184 Oryza sativa (japonica cultivar-group) genom...   116   6e-25   
gb:AP003280_1827145 Oryza sativa (japonica cultivar-group) genom...   116   6e-25   
pir|T52285|T52285 serine/threonine-specific protein kinase APK2a...   116   6e-25   
gb:AP001800_1821423 Oryza sativa (japonica cultivar-group) genom...   109   6e-25   
gb:AP001800_1821406 Oryza sativa (japonica cultivar-group) genom...   108   6e-25   
pir|T01309|T01309 probable serine/threonine-specific protein kin...   114   6e-25   
pir|C84922|C84922 probable protein kinase [imported] - Arabidops...   109   6e-25   
gb:SBRLK1_1704899 Sorghum bicolor mRNA for protein serine/threon...   102   6e-25   
gb:ATHPRKINA_1553318 Arabidopsis thaliana Columbia protein kinas...   113   6e-25   
gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome...   115   7e-25   
gb:AE016959_1021493 Oryza sativa (japonica cultivar-group) chrom...   115   7e-25   
pir|C96791|C96791 hypothetical protein F15M4.13 [imported] - Ara...   115   7e-25   
gb:AY091010_1574241 Arabidopsis thaliana putative S-receptor kin...   110   8e-25   
pir|T05341|T05341 S-receptor kinase homolog F10M6.60 - Arabidops...   110   8e-25   
gb:AB013395_1512172 Arabidopsis thaliana genomic DNA, chromosome...    99   8e-25   
gb:CQ768547_1451791 Sequence 42 from Patent WO2004007712.              99   8e-25   
gb:AX138087_1462209 Sequence 33 from Patent EP1094113.                 99   8e-25   
gb:AX120053_1461706 Sequence 36 from Patent WO0129240.                 99   8e-25   
pir|T14354|T14354 probable somatic embryogenesis receptor-like k...   103   8e-25   
gb:AC093018_1735842 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...   111   8e-25   
gb:AY085009_1570091 Arabidopsis thaliana clone 124301 mRNA, comp...   107   8e-25   
gb:ATAC009326_1542913 Arabidopsis thaliana chromosome III P1 MZB...   107   8e-25   
gb:AX038195_1457677 Sequence 10 from Patent WO0060086.                107   8e-25   
gb:AY059844_1564688 Arabidopsis thaliana receptor-like protein k...    99   8e-25   
gb:AP004570_1841747 Oryza sativa (japonica cultivar-group) genom...   115   9e-25   
gb:AC134886_1741831 Oryza sativa chromosome 3 BAC OSJNBa0002D18 ...   115   9e-25   
gb:AC084319_1733485 Oryza sativa chromosome 3 BAC OSJNBa0004B24 ...   115   9e-25   
gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryoge...   102   1e-24   
gb:AP004752_1844391 Oryza sativa (japonica cultivar-group) genom...   108   1e-24   
gb:AP004752_1844393 Oryza sativa (japonica cultivar-group) genom...   108   1e-24   
pir|C84473|C84473 probable protein kinase [imported] - Arabidops...   111   1e-24   
pir|T01711|T01711 probable serine/threonine-specific protein kin...   108   1e-24   
gb:AP005199_1849344 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP004744_1844245 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP004744_1844243 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP004014_1836380 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP003518_1830289 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
sp|P46573|APKB_ARATH|APKB_ARATH Protein kinase APK1B (EC 2.7.1.-).>pir|T027...   115   1e-24   
pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis ...   100   1e-24   
gb:AY332474_1600056 Oryza sativa (japonica cultivar-group) trans...   107   1e-24   
gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genom...   107   1e-24   
gb:AP002541_1822589 Oryza sativa (japonica cultivar-group) genom...   100   1e-24   
pir|T45878|T45878 receptor lectin kinase-like protein - Arabidop...   109   1e-24   
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...   101   1e-24   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...   101   1e-24   
gb:ATHAPK1B_1553001 A. thaliana APK1b gene for protein kinase, p...   114   2e-24   
sp|Q9LYN8|EXS_ARATH|EXS_ARATH Leucine-rich repeat receptor protein kinase ...   107   2e-24   
gb:AY064978_1566153 Arabidopsis thaliana At1g21590/F24J8_9 mRNA,...   110   2e-24   
pir|G86348|G86348 hypothetical protein F24J8.18 - Arabidopsis th...   110   2e-24   
gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.             102   2e-24   
gb:AY162176_1585779 Medicago truncatula somatic embryogenesis re...   101   2e-24   
gb:AY060554_1564862 Arabidopsis thaliana AT5g63710/MBK5_19 mRNA,...   101   2e-24   
gb:AX138089_1462210 Sequence 35 from Patent EP1094113.                101   2e-24   
pir|G84630|G84630 probable LRR receptor protein kinase [imported...   102   2e-24   
gb:CQ768549_1451792 Sequence 44 from Patent WO2004007712.>gb:AX1...   101   2e-24   
gb:AX120057_1461708 Sequence 40 from Patent WO0129240.                102   2e-24   
gb:AB121973_1528021 Brassica rapa MLPK mRNA for protein kinase, ...   114   2e-24   
gb:AP003981_1835888 Oryza sativa (japonica cultivar-group) genom...   114   2e-24   
gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for puta...   114   2e-24   
gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19...   114   2e-24   
gb:AC135288_1742197 Solanum demissum chromosome 5 BAC PGEC219 ge...   114   2e-24   
gb:AC113332_1738903 Oryza sativa (japonica cultivar-group) chrom...   114   2e-24   
gb:OSJN00068_1694248 Oryza sativa genomic DNA, chromosome 4, BAC...   114   2e-24   
gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporoge...   107   2e-24   
gb:AP004868_1846287 Oryza sativa (japonica cultivar-group) genom...   112   2e-24   
gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for puta...   114   3e-24   
gb:AC119289_1739641 Oryza sativa (japonica cultivar-group) chrom...   114   3e-24   


>gb:ITU20948_1683300 Ipomoea trifida receptor protein kinase (IRK1)
            mRNA, complete cds.
          Length = 853

 Score =  204 bits (518), Expect(2) = 1e-63
 Identities = 97/158 (61%), Positives = 123/158 (77%), Gaps = 1/158 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +F++ R  +  WQTRF I  GI+RGLLYLHQDSR +IIHRDLK SNILLD E+NPKI
Sbjct: 615  DSTLFNKQRSSLLNWQTRFNIICGIARGLLYLHQDSRFRIIHRDLKASNILLDKEMNPKI 674

Query: 617  SDFGLARIVEEDDGLAK-TKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRK 441
            SDFG+ARI   D+  A  TKRV+GTYGYMSPEY +DG FSVKSDVFS GV++LE+++G+K
Sbjct: 675  SDFGMARIFGGDETDANNTKRVVGTYGYMSPEYAMDGLFSVKSDVFSFGVLVLEIVTGKK 734

Query: 440  NRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
            NR F++ ++  NLLGHAW LW +    EL+D+ + +SY
Sbjct: 735  NRGFYNQNNQQNLLGHAWRLWRERRGSELLDSAIGESY 772



 Score = 62.8 bits (151), Expect(2) = 1e-63
 Identities = 32/77 (41%), Positives = 48/77 (62%), Gaps = 2/77 (2%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN--STEASSTDKE 137
            +RCI V LLCV +  EDRP MA+VV ML +E   LP+PK PGF +       ++S+++ +
Sbjct: 778  MRCIQVGLLCVQEQAEDRPNMATVVLMLGSESATLPQPKHPGFCLGSRPADMDSSTSNCD 837

Query: 136  RCCYEIAMITFSTLEGR 86
              C  +  +T + L+GR
Sbjct: 838  ESC-TVNQVTVTMLDGR 853



>gb:AP003406_1828888 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1070A12.
          Length = 846

 Score =  205 bits (521), Expect(2) = 4e-63
 Identities = 95/162 (58%), Positives = 121/162 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F++S   +  WQ R+ I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD E+ PKI
Sbjct: 609  DYFLFEKSNSVLLDWQARYRIIEGITRGLLYLHQDSRYRIIHRDLKASNVLLDKEMTPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+AR+   ++    T++V+GTYGYMSPEY +DG FSVKSDVFS GV+LLE+ISGR+N
Sbjct: 669  SDFGMARMFGSEETEINTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLLLEIISGRRN 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            R  +   +H NLLGHAW LWN+G   EL D  +  S+   +V
Sbjct: 729  RGVYSYSNHLNLLGHAWSLWNEGKSLELADETMNGSFDSDEV 770



 Score = 59.7 bits (143), Expect(2) = 4e-63
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFML-ENEEVALPKPKEPGFFVERNSTEASSTDKER 134
           L+CI V LLCV + P+DRP M+ V+ ML   +   LP PK+PGF   R   E  ++  + 
Sbjct: 771 LKCIRVGLLCVQENPDDRPLMSQVLLMLATTDATTLPTPKQPGFAARRILMETDTSSSKP 830

Query: 133 CCYEIAMITFSTLEGR 86
            C      T + LEGR
Sbjct: 831 DCSIFDSATVTILEGR 846



>gb:AC130597_1740689 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0017K09, complete sequence.
          Length = 837

 Score =  201 bits (510), Expect(2) = 5e-63
 Identities = 95/162 (58%), Positives = 121/162 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD+S+  +  WQTR+ I  GI+RGLLYLHQDSR +IIHRDLKTSNILLD E+ PKI
Sbjct: 601  DCFLFDKSKSKLLDWQTRYHIIEGIARGLLYLHQDSRYRIIHRDLKTSNILLDKEMTPKI 660

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+AR+   DD    T RV+GTYGYM+PEY +DG FSVKSDVFS GVI+LE+ISG++N
Sbjct: 661  SDFGMARMFGSDDTEINTVRVVGTYGYMAPEYAMDGVFSVKSDVFSFGVIVLEIISGKRN 720

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            R  +    H NLL  AW  W++GN  +L+D  +  S+ + +V
Sbjct: 721  RGVYSYSSHLNLLARAWSSWSEGNSLDLVDKTLNGSFNQEEV 762



 Score = 63.5 bits (153), Expect(2) = 5e-63
 Identities = 30/76 (39%), Positives = 50/76 (65%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLEN-EEVALPKPKEPGFFVERNSTEASSTDKER 134
           L+C+ V LLCV + P+DRP M+ V+ ML + +  +LP P++PGF   R +TE +S+ +  
Sbjct: 763 LKCLKVGLLCVQENPDDRPLMSQVLLMLASADATSLPDPRKPGFVARRAATEDTSSSRPD 822

Query: 133 CCYEIAMITFSTLEGR 86
           C + +  +T + +EGR
Sbjct: 823 CSF-VDSMTITMIEGR 837



>gb:AF403128_1796416 Oryza sativa S-locus receptor-like kinase RLK11
            (RLK11) mRNA, complete cds.
          Length = 820

 Score =  187 bits (476), Expect(2) = 7e-63
 Identities = 93/157 (59%), Positives = 113/157 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +R  +  W TRF I  GI++GLLYLHQDSRL IIHRDLK SNILLD E+NPKI
Sbjct: 586  DAFLFDATRKYVLDWPTRFKIIKGIAKGLLYLHQDSRLTIIHRDLKASNILLDTEMNPKI 645

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEYV+ G FSVKSD +S GV+LLE++SG K 
Sbjct: 646  SDFGIARIFHGNQQQANTTRVVGTYGYMSPEYVLGGAFSVKSDTYSFGVLLLEIVSGLKI 705

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
             +   + +  +L  +AW LW DGN  EL+D    DSY
Sbjct: 706  SSSKLTPNFFSLTAYAWRLWKDGNATELLDKFFVDSY 742



 Score = 76.3 bits (186), Expect(2) = 7e-63
 Identities = 38/74 (51%), Positives = 48/74 (64%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RCIHV LLCV   P DRP+M+SVVFMLENE   LP PK+P +F  +N     +T  E   
Sbjct: 749 RCIHVGLLCVQDHPNDRPSMSSVVFMLENESTLLPAPKQPVYFEMKNHGTQEAT--EESV 806

Query: 127 YEIAMITFSTLEGR 86
           Y +  ++ +TLEGR
Sbjct: 807 YSVNTMSTTTLEGR 820



>gb:AB092809_1525112 Lotus corniculatus var. japonicus HAR1 gene for
           LRR receptor-like kinase, hypothetical proteins,
           complete and partial cds, clone:BAC259.12D-2.
          Length = 686

 Score =  207 bits (528), Expect(2) = 9e-63
 Identities = 100/157 (63%), Positives = 120/157 (76%)
 Frame = -3

Query: 782 DESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGL 603
           D +R  +  W  R  I  GI+RGLLYLHQDSRL+IIHRDLKTSNILLD E+NPKISDFGL
Sbjct: 460 DSTRSKLLDWNKRLQIIDGIARGLLYLHQDSRLRIIHRDLKTSNILLDNEMNPKISDFGL 519

Query: 602 ARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHD 423
           ARI   D   A+TKRV+GTYGYM PEY V G+FS+KSDVFS GVI+LE+ISG+K R F+D
Sbjct: 520 ARIFIGDQVEARTKRVMGTYGYMPPEYAVHGSFSIKSDVFSFGVIVLEIISGKKIRKFYD 579

Query: 422 SDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             HH NLL HAW LW +G+P EL+D    DS + +++
Sbjct: 580 PHHHLNLLSHAWRLWIEGSPLELVDKLFEDSIIPTEI 616



 Score = 55.8 bits (133), Expect(2) = 9e-63
 Identities = 29/66 (43%), Positives = 37/66 (56%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LR IHVALLCV + PE RP M S+V ML N E  LPKP  P F+  ++      +   RC
Sbjct: 617 LRYIHVALLCVQRRPETRPDMLSIVLML-NGEKELPKPSLPAFYTGKHDPILLESPSRRC 675

Query: 130 CYEIAM 113
              + +
Sbjct: 676 STSVTI 681



>gb:AE005173_894228 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC007234_1535642 Genomic sequence
            for Arabidopsis thaliana BAC F1E22, complete sequence.
          Length = 1662

 Score =  192 bits (488), Expect(2) = 6e-62
 Identities = 91/156 (58%), Positives = 116/156 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD++R     WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD  + PKI
Sbjct: 601  DSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKI 660

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   ++  A T+RV+GTYGYMSPEY +DG FS+KSDVFS GV+LLE+ISG++N
Sbjct: 661  SDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRN 720

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++S+   NLLG  W  W +GN  E++D    DS
Sbjct: 721  KGFYNSNRDLNLLGFVWRHWKEGNELEIVDPINIDS 756



 Score =  189 bits (481), Expect(2) = 2e-61
 Identities = 88/150 (58%), Positives = 113/150 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD++R     WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD  + PKI
Sbjct: 1420 DSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKI 1479

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   ++  A T+RV+GTYGYMSPEY +DG FS+KSDVFS GV+LLE+ISG++N
Sbjct: 1480 SDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRN 1539

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
            + F++S+   NLLG  W  W +G   E++D
Sbjct: 1540 KGFYNSNRDLNLLGFVWRHWKEGKELEIVD 1569



 Score = 69.3 bits (168), Expect(2) = 2e-61
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE---ASSTDK 140
            LRCI + LLCV +  EDRP M+SV+ ML +E  A+P+PK PGF V R+S E   +SST +
Sbjct: 1586 LRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCVGRSSLEVDSSSSTQR 1645

Query: 139  ERCCYEIAMITFSTLEGR 86
            +  C  +  +T S ++ R
Sbjct: 1646 DDEC-TVNQVTLSVIDAR 1662



 Score = 68.6 bits (166), Expect(2) = 6e-62
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA---SSTDK 140
           LRCI + LLCV +  EDRP M+SV+ ML +E  A+P+PK PGF + R+  EA   SST +
Sbjct: 767 LRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCIGRSPLEADSSSSTQR 826

Query: 139 ERCCYEIAMITFSTLEGR 86
           +  C  +  IT S ++ R
Sbjct: 827 DDEC-TVNQITLSVIDAR 843



>pir|S70769|S70769 S-receptor kinase (EC 2.7.1.-) Ark1 precursor -
            Arabidopsis thaliana>gb:ATHDNA_1553150 Arabidopsis
            thaliana receptor kinase (Ark1) gene, exons 1-7.
          Length = 843

 Score =  192 bits (488), Expect(2) = 6e-62
 Identities = 91/156 (58%), Positives = 116/156 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD++R     WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD  + PKI
Sbjct: 601  DSHLFDQTRSSNLNWQKRFDIINGIARGLLYLHQDSRCRIIHRDLKASNVLLDKNMTPKI 660

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   ++  A T+RV+GTYGYMSPEY +DG FS+KSDVFS GV+LLE+ISG++N
Sbjct: 661  SDFGMARIFGREETEANTRRVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKRN 720

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++S+   NLLG  W  W +GN  E++D    DS
Sbjct: 721  KGFYNSNRDLNLLGFVWRHWKEGNELEIVDPINIDS 756



 Score = 68.6 bits (166), Expect(2) = 6e-62
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA---SSTDK 140
           LRCI + LLCV +  EDRP M+SV+ ML +E  A+P+PK PGF + R+  EA   SST +
Sbjct: 767 LRCIQIGLLCVQERAEDRPVMSSVMVMLGSETTAIPQPKRPGFCIGRSPLEADSSSSTQR 826

Query: 139 ERCCYEIAMITFSTLEGR 86
           +  C  +  IT S ++ R
Sbjct: 827 DDEC-TVNQITLSVIDAR 843



>pir|T05754|T05754 S-receptor kinase (EC 2.7.1.-) M4I22.110 precursor
            - Arabidopsis thaliana>gb:ATCHRIV66_1546611 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            66.>gb:ATM4I22_1553666 Arabidopsis thaliana DNA
            chromosome 4, P1 clone M4I22 (ESSA project).
          Length = 815

 Score =  188 bits (478), Expect(2) = 7e-62
 Identities = 85/148 (57%), Positives = 109/148 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+FDE R     W+ R  I  G++RG+LYLHQDSRL+IIHRDLK  N+LLD ++NPKI
Sbjct: 582  DFFIFDERRSTELDWKKRMNIINGVARGILYLHQDSRLRIIHRDLKAGNVLLDNDMNPKI 641

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLA+    D   + T RV+GTYGYM PEY +DG+FSVKSDVFS GV++LE+I+G+ N
Sbjct: 642  SDFGLAKSFGGDQSESSTNRVVGTYGYMPPEYAIDGHFSVKSDVFSFGVLVLEIITGKTN 701

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFEL 354
            R F  +DH  NLLGH W +W +    E+
Sbjct: 702  RGFRHADHDLNLLGHVWKMWVEDREIEV 729



 Score = 72.0 bits (175), Expect(2) = 7e-62
 Identities = 39/75 (52%), Positives = 51/75 (68%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LRCIHVALLCV + PEDRPTMASVV M  ++  +LP P +PGFF  RN  + SS+   R 
Sbjct: 745 LRCIHVALLCVQQKPEDRPTMASVVLMFGSDS-SLPHPTQPGFFTNRNVPDISSSLSLRS 803

Query: 130 CYEIAMITFSTLEGR 86
             E+++   + L+GR
Sbjct: 804 QNEVSI---TMLQGR 815



>gb:BOARLKGEN_1633734 B.oleraceae gene encoding serine/threonine
            kinase, ARLK.
          Length = 847

 Score =  197 bits (500), Expect(2) = 1e-61
 Identities = 92/156 (58%), Positives = 117/156 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD++R     WQ RFVI  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 604  DSHLFDKTRSCKLNWQKRFVITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 663

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY +DG FS KSDVFS GV+LLE+ISG++N
Sbjct: 664  SDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRN 723

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++SDH  NLLG  W  W  G   +++D  + DS
Sbjct: 724  KGFYNSDHDLNLLGCVWRNWKKGKGLDIVDPIILDS 759



 Score = 63.2 bits (152), Expect(2) = 1e-61
 Identities = 32/81 (39%), Positives = 51/81 (62%), Gaps = 3/81 (3%)
 Frame = -1

Query: 319  LK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASS 149
            L+ LRCI + LLCV +   DRPTM+SVV ML +E  A+P+P++PG+ V R   ++  +SS
Sbjct: 767  LEILRCIKIGLLCVQERANDRPTMSSVVMMLGSETAAIPQPEQPGYCVGRSPLDTDSSSS 826

Query: 148  TDKERCCYEIAMITFSTLEGR 86
              +    + +  +T S ++ R
Sbjct: 827  NQRHDESWSVNQMTVSVIDPR 847



>gb:AB097116_1525939 Brassica rapa SRK-60, SLG-60 genes for S receptor
            kinase, S-locus glycoprotein, partial cds.
          Length = 859

 Score =  197 bits (500), Expect(2) = 1e-61
 Identities = 92/156 (58%), Positives = 119/156 (76%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FDE+R  +  WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 616  DSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 675

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI  +D+  A T++V+GTYGYMSPEY ++G FS+KSDVFS GV+LLE+ISG++N
Sbjct: 676  SDFGMARIFGQDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRN 735

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F DSD + NLLG  W  W +G   E++D  + DS
Sbjct: 736  KGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDS 771



 Score = 62.8 bits (151), Expect(2) = 1e-61
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASST----- 146
            LRC+ + LLCV +  EDRP M+SVV ML +E   +P+PK+PG+ V ++S E  S+     
Sbjct: 782  LRCLQIGLLCVQERVEDRPMMSSVVLMLGSETALIPQPKQPGYCVSQSSLETYSSWSKLR 841

Query: 145  DKERCCYEIAMITFSTLEGR 86
            D E   + +  IT S ++ R
Sbjct: 842  DDEN--WTVNQITMSIIDAR 859



>gb:AB024416_1515946 Brassica oleracea SRK2-b mRNA, complete cds.
          Length = 854

 Score =  195 bits (496), Expect(2) = 2e-61
 Identities = 92/156 (58%), Positives = 117/156 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FDE+R  +  WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 615  DSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 674

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY ++G FS+KSDVFS GV+LLE+ISG++N
Sbjct: 675  SDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRN 734

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F DSD   NLLG  W  W +G   E++D  + DS
Sbjct: 735  KVFCDSDSSLNLLGCVWRNWKEGQGLEIVDKVIVDS 770



 Score = 63.5 bits (153), Expect(2) = 2e-61
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -1

Query: 307  RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA-SSTDKERC 131
            RC+ + LLCV +  EDRP M+S+V ML +E   +P+PK+PG+ V  +S E  S  D E C
Sbjct: 782  RCLQIGLLCVQERVEDRPMMSSIVLMLGSEAALIPQPKQPGYCVSGSSLETYSRRDDENC 841

Query: 130  CYEIAMITFSTLEGR 86
               +  IT S ++ R
Sbjct: 842  --TVNQITMSIIDAR 854



>gb:BOY18260_1633945 Brassica oleracea mRNA for SRK15 protein,
            partial.
          Length = 849

 Score =  196 bits (498), Expect(2) = 2e-61
 Identities = 92/156 (58%), Positives = 118/156 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FDE+R  +  WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 606  DSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 665

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY ++G FS+KSDVFS GV+LLE+ISG++N
Sbjct: 666  SDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRN 725

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F DSD + NLLG  W  W +G   E++D  + DS
Sbjct: 726  KGFCDSDSNLNLLGCVWRNWKEGQGLEIVDRVIIDS 761



 Score = 62.8 bits (151), Expect(2) = 2e-61
 Identities = 33/80 (41%), Positives = 49/80 (61%), Gaps = 5/80 (6%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASST----- 146
            LRC+ + LLCV +  EDRP M+SVV ML +E   +P+PK+PG+ V ++S E  S+     
Sbjct: 772  LRCLQIGLLCVQERVEDRPMMSSVVLMLGSETALIPQPKQPGYCVSQSSLETYSSWSKLR 831

Query: 145  DKERCCYEIAMITFSTLEGR 86
            D E   + +  IT S ++ R
Sbjct: 832  DDEN--WTVNQITMSIIDAR 849



>gb:AP004401_1841243 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0534A03.>gb:AP005126_1848233 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBb0041B22.
          Length = 860

 Score =  196 bits (499), Expect(2) = 3e-61
 Identities = 94/153 (61%), Positives = 114/153 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD++R     W  RF I  GI+RGLLYLHQDSR KIIHRDLK  NILLD ++NPKI
Sbjct: 620  DNFIFDKARSAQLNWSKRFNIILGIARGLLYLHQDSRFKIIHRDLKAGNILLDGDMNPKI 679

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI  +D   + T++V+GTYGYMSPEY +DG FSVKSDVFS GV++LEL+SGRKN
Sbjct: 680  SDFGVARIFGDDTD-SHTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLELVSGRKN 738

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCV 339
            R  + S    +LL HAW LW +GN   L+D  V
Sbjct: 739  RGMYSSGEQTSLLSHAWRLWREGNALALLDEAV 771



 Score = 62.0 bits (149), Expect(2) = 3e-61
 Identities = 30/75 (40%), Positives = 43/75 (57%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
            LRC+ V LLCV + PEDRP MA+V  ML N    +P+P+ PGF  +R     S+  +   
Sbjct: 786  LRCVQVGLLCVQERPEDRPHMAAVFMMLGNLSAVVPQPRHPGFCSDRGGGGGSTDGEWSS 845

Query: 130  CYEIAMITFSTLEGR 86
               +  +T + +EGR
Sbjct: 846  TCTVNDVTVTIVEGR 860



>gb:AB052756_1521238 Arabidopsis lyrata mRNA for SRKb, complete cds.
          Length = 853

 Score =  195 bits (495), Expect(2) = 4e-61
 Identities = 91/156 (58%), Positives = 119/156 (76%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +F++S      WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 609  DSHLFNKSLSCKLNWQMRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY +DG FSVKSDVFS GV++LE++SG+KN
Sbjct: 669  SDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGKKN 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F++S+  +NLLG+AW  W +G   E++D  + DS
Sbjct: 729  RGFYNSNQDNNLLGYAWRNWKEGKGLEILDPFIVDS 764



 Score = 63.2 bits (152), Expect(2) = 4e-61
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASST---DK 140
            LRCI + LLCV +  EDRP M+SVV ML +E   +P+PK PG+ V R+  E  S+    +
Sbjct: 777  LRCIQIGLLCVQERAEDRPVMSSVVVMLRSETETIPQPKPPGYCVGRSPFETDSSTHEQR 836

Query: 139  ERCCYEIAMITFSTLEGR 86
            +  C  +  IT S ++ R
Sbjct: 837  DESC-TVNQITISAIDPR 853



>pir|T05180|T05180 S-receptor kinase (EC 2.7.1.-) ARK3 precursor -
            Arabidopsis thaliana>gb:ATCHRIV55_1545975 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            55.>gb:ATT6K22_1556403 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T6K22 (ESSAII
            project).>gb:BT006032_1638926 Arabidopsis thaliana clone
            U51180 putative receptor serine/threonine protein kinase
            ARK3 (At4g21380) mRNA, complete cds.>gb:AK118895_1816848
            Arabidopsis thaliana At4g21380 mRNA for putative
            receptor-like serine/threonine protein kinase ARK3,
            complete cds, clone: RAFL21-23-A05.
          Length = 850

 Score =  192 bits (488), Expect(2) = 4e-61
 Identities = 92/156 (58%), Positives = 115/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD+SR     WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 608  DSHLFDKSRNSKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNILLDKYMTPKI 667

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY +DG FS+KSDVFS GV+LLE+IS ++N
Sbjct: 668  SDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISSKRN 727

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++SD   NLLG  W  W +G   E++D  + DS
Sbjct: 728  KGFYNSDRDLNLLGCVWRNWKEGKGLEIIDPIITDS 763



 Score = 65.9 bits (159), Expect(2) = 4e-61
 Identities = 32/78 (41%), Positives = 49/78 (62%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASSTDK 140
            LRCI + LLCV +  EDRPTM+ V+ ML +E   +P+PK PG+ +ER   ++  +SS  +
Sbjct: 773  LRCIQIGLLCVQERAEDRPTMSLVILMLGSESTTIPQPKAPGYCLERSLLDTDSSSSKQR 832

Query: 139  ERCCYEIAMITFSTLEGR 86
            +   + +  IT S L+ R
Sbjct: 833  DDESWTVNQITVSVLDAR 850



>pir|T14470|T14470 receptor-like kinase (EC 2.7.1.-) SFR2 - wild
            cabbage>gb:BOSFR2_1633884 B.oleracea mRNA for
            receptor-like kinase, SFR2.
          Length = 847

 Score =  194 bits (493), Expect(2) = 6e-61
 Identities = 91/156 (58%), Positives = 116/156 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD++R     WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 604  DSHLFDKTRSCKLNWQKRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 663

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY +DG FS KSDVFS GV+LLE+ISG++N
Sbjct: 664  SDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRN 723

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++SDH  NLLG  W  W  G   +++D  + DS
Sbjct: 724  KGFYNSDHDLNLLGCVWRNWKKGKGLDIVDPIILDS 759



 Score = 63.2 bits (152), Expect(2) = 6e-61
 Identities = 32/81 (39%), Positives = 51/81 (62%), Gaps = 3/81 (3%)
 Frame = -1

Query: 319  LK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASS 149
            L+ LRCI + LLCV +   DRPTM+SVV ML +E  A+P+P++PG+ V R   ++  +SS
Sbjct: 767  LEILRCIKIGLLCVQERANDRPTMSSVVMMLGSETAAIPQPEQPGYCVGRSPLDTDSSSS 826

Query: 148  TDKERCCYEIAMITFSTLEGR 86
              +    + +  +T S ++ R
Sbjct: 827  NQRHDESWSVNQMTVSVIDPR 847



>gb:BOY18259_1633944 Brassica oleracea mRNA for SRK5 protein, partial.
          Length = 848

 Score =  193 bits (490), Expect(2) = 8e-61
 Identities = 91/156 (58%), Positives = 116/156 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FDE+R  +  WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 609  DSHLFDETRSCMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY ++G FS+KSDVFS GV+LLE+ISG++N
Sbjct: 669  SDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRN 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            +   DSD   NLLG  W  W +G   E++D  + DS
Sbjct: 729  KGLCDSDSSLNLLGCVWRNWKEGQGLEIVDRVIIDS 764



 Score = 63.9 bits (154), Expect(2) = 8e-61
 Identities = 33/75 (44%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA-SSTDKERC 131
           RC+ + LLCV +  EDRP M+SVV ML +E   +P+PK+PG+ V  +S E  S  D E C
Sbjct: 776 RCLQIGLLCVQERVEDRPMMSSVVLMLGSEAALIPQPKQPGYCVSGSSLETYSRRDDENC 835

Query: 130 CYEIAMITFSTLEGR 86
              +  IT S ++ R
Sbjct: 836 --TVNQITMSIIDAR 848



>gb:OSJN00019_1693377 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 822

 Score =  191 bits (486), Expect(2) = 8e-61
 Identities = 91/161 (56%), Positives = 119/161 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+FD+S+  +  W+TRF I  G++RGL+YLHQDSR+ IIHRDLK SNILLD E++PKI
Sbjct: 588  DYFLFDDSKKSMLDWRTRFNIIKGVARGLVYLHQDSRMTIIHRDLKASNILLDEEMSPKI 647

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A TK V+GTYGYMSPEY ++G FSVKSD +S GV++LELISG K 
Sbjct: 648  SDFGMARIFGSNQHQANTKHVVGTYGYMSPEYAMEGIFSVKSDTYSFGVLVLELISGSKI 707

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
             + H +    NL+  AW LW DGN  + +D+ + +SY  S+
Sbjct: 708  SSPHLTMDFPNLIARAWSLWKDGNAEDFVDSIILESYAISE 748



 Score = 65.5 bits (158), Expect(2) = 8e-61
 Identities = 35/76 (46%), Positives = 47/76 (61%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN-STEASSTDKER 134
           L CIH+ LLCV + P  RP M+SVV MLENE  A P PK+P +FV RN   E +  D  +
Sbjct: 750 LLCIHLGLLCVQEDPSARPFMSSVVAMLENETTARPTPKQPAYFVPRNYMAEGTRQDANK 809

Query: 133 CCYEIAMITFSTLEGR 86
               +  ++ +TL+GR
Sbjct: 810 ---SVNSMSLTTLQGR 822



>pir|A85041|A85041 probable receptor kinase [imported] - Arabidopsis
            thaliana>gb:AC005275_1532354 Arabidopsis thaliana BAC
            F4C21 from chromosome IV, top arm, near 17 cM, complete
            sequence.>gb:ATCHRIV8_1547304 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 8.
          Length = 852

 Score =  190 bits (483), Expect(2) = 1e-60
 Identities = 92/156 (58%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+FD        W+ R  I  GI+RGLLYLHQDSRL+IIHRDLKTSNILLD E+NPKI
Sbjct: 614  DFFIFDRKLCQRLDWKMRCNIILGIARGLLYLHQDSRLRIIHRDLKTSNILLDEEMNPKI 673

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLARI    +  A T RV+GTYGYMSPEY ++G FS KSDVFS GV+++E ISG++N
Sbjct: 674  SDFGLARIFGGSETSANTNRVVGTYGYMSPEYALEGLFSFKSDVFSFGVVVIETISGKRN 733

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
              FH+ +   +LLGHAW LW      EL+D  +++S
Sbjct: 734  TGFHEPEKSLSLLGHAWDLWKAERGIELLDQALQES 769



 Score = 66.2 bits (160), Expect(2) = 1e-60
 Identities = 37/78 (47%), Positives = 53/78 (67%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVA-LPKPKEPGFFVER--NSTEASSTDK 140
            L+C++V LLCV + P DRPTM++VVFML + E A LP PK+P F + R  +S++ASS+ K
Sbjct: 776  LKCLNVGLLCVQEDPNDRPTMSNVVFMLGSSEAATLPTPKQPAFVLRRCPSSSKASSSTK 835

Query: 139  ERCCYEIAMITFSTLEGR 86
               C E   +T +  +GR
Sbjct: 836  PETCSE-NELTITLEDGR 852



>gb:AB041621_1519688 Brassica rapa BcRK5 gene for receptor kinase 5,
            complete cds.
          Length = 838

 Score =  194 bits (493), Expect(2) = 1e-60
 Identities = 91/156 (58%), Positives = 116/156 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD++R     WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 595  DSHLFDKTRSCKLNWQKRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 654

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY +DG FS KSDVFS GV+LLE+ISG++N
Sbjct: 655  SDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMDGIFSTKSDVFSFGVLLLEIISGKRN 714

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++SDH  NLLG  W  W  G   +++D  + DS
Sbjct: 715  KGFYNSDHDLNLLGCVWRNWKKGKGLDIVDPIILDS 750



 Score = 62.0 bits (149), Expect(2) = 1e-60
 Identities = 32/81 (39%), Positives = 50/81 (61%), Gaps = 3/81 (3%)
 Frame = -1

Query: 319  LK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASS 149
            L+ LRCI + LLCV +   DRPTM+SVV ML +E  A+P+P+ PG+ V R   ++  +SS
Sbjct: 758  LEILRCIKIGLLCVQERANDRPTMSSVVMMLGSETTAIPQPEPPGYCVGRSPLDTDSSSS 817

Query: 148  TDKERCCYEIAMITFSTLEGR 86
              +    + +  +T S ++ R
Sbjct: 818  NQRNDESWSVNQMTVSVIDPR 838



>gb:LCO580824_1684037 Lotus corniculatus var. japonicus har1 gene
           and genes for transcription factor homolog BTF3-like
           protein, S-receptor kinase-like protein 1, S-receptor
           kinase-like protein 2, S-receptor kinase-like protein 3
           and SAR DNA-binding protein-like protein.
          Length = 685

 Score =  200 bits (509), Expect(2) = 1e-60
 Identities = 99/157 (63%), Positives = 119/157 (75%)
 Frame = -3

Query: 782 DESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGL 603
           D +R  +  W  R  I  GI+RGLLYLHQDSRL+IIHRDLKTSNILLD E+NPKISDFGL
Sbjct: 460 DSTRSKLLDWNKRLQIIDGIARGLLYLHQDSRLRIIHRDLKTSNILLDNEMNPKISDFGL 519

Query: 602 ARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHD 423
           ARI   D   A+TKRV+GT GYM PEY V G+FS+KSDVFS GVI+LE+ISG+K R F+D
Sbjct: 520 ARIFIGDQVEARTKRVMGT-GYMPPEYAVHGSFSIKSDVFSFGVIVLEIISGKKIRKFYD 578

Query: 422 SDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             HH NLL HAW LW +G+P EL+D    DS + +++
Sbjct: 579 PHHHLNLLSHAWRLWIEGSPLELVDKLFEDSIIPTEI 615



 Score = 55.8 bits (133), Expect(2) = 1e-60
 Identities = 29/66 (43%), Positives = 37/66 (56%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LR IHVALLCV + PE RP M S+V ML N E  LPKP  P F+  ++      +   RC
Sbjct: 616 LRYIHVALLCVQRRPETRPDMLSIVLML-NGEKELPKPSLPAFYTGKHDPILLESPSRRC 674

Query: 130 CYEIAM 113
              + +
Sbjct: 675 STSVTI 680



>gb:LCO580824_1684038 Lotus corniculatus var. japonicus har1 gene and
            genes for transcription factor homolog BTF3-like protein,
            S-receptor kinase-like protein 1, S-receptor kinase-like
            protein 2, S-receptor kinase-like protein 3 and SAR
            DNA-binding protein-like protein.
          Length = 865

 Score =  200 bits (508), Expect(2) = 2e-60
 Identities = 97/159 (61%), Positives = 118/159 (74%)
 Frame = -3

Query: 788  VFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDF 609
            + D +R  +  W  R  I  GI+RGLLYLHQDSRL+IIHRDLKTSNILLD E+NPKISDF
Sbjct: 637  LLDSTRSKLVDWNKRLQIIDGIARGLLYLHQDSRLRIIHRDLKTSNILLDDEMNPKISDF 696

Query: 608  GLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAF 429
            GLARI   D   A+TKRV+GTYGYM PEY V G+FS+KSDVFS GVI+LE+ISG+K   F
Sbjct: 697  GLARIFIGDQVEARTKRVMGTYGYMPPEYAVHGSFSIKSDVFSFGVIVLEIISGKKIGRF 756

Query: 428  HDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +D  HH NLL HAW LW +  P EL+D  + D  + +++
Sbjct: 757  YDPHHHLNLLSHAWRLWIEERPLELVDELLDDPVIPTEI 795



 Score = 55.5 bits (132), Expect(2) = 2e-60
 Identities = 35/75 (46%), Positives = 43/75 (57%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
            LR IHVALLCV + PE+RP M S+V ML N E  LPKP+ P F+  ++      +   RC
Sbjct: 796  LRYIHVALLCVQRRPENRPDMLSIVLML-NGEKELPKPRLPAFYTGKHDPIWLGS-PSRC 853

Query: 130  CYEIAMITFSTLEGR 86
                  IT S LE R
Sbjct: 854  S---TSITISLLEAR 865



>gb:AB092809_1525113 Lotus corniculatus var. japonicus HAR1 gene for
            LRR receptor-like kinase, hypothetical proteins, complete
            and partial cds, clone:BAC259.12D-2.
          Length = 862

 Score =  200 bits (508), Expect(2) = 2e-60
 Identities = 97/159 (61%), Positives = 118/159 (74%)
 Frame = -3

Query: 788  VFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDF 609
            + D +R  +  W  R  I  GI+RGLLYLHQDSRL+IIHRDLKTSNILLD E+NPKISDF
Sbjct: 634  LLDSTRSKLVDWNKRLQIIDGIARGLLYLHQDSRLRIIHRDLKTSNILLDDEMNPKISDF 693

Query: 608  GLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAF 429
            GLARI   D   A+TKRV+GTYGYM PEY V G+FS+KSDVFS GVI+LE+ISG+K   F
Sbjct: 694  GLARIFIGDQVEARTKRVMGTYGYMPPEYAVHGSFSIKSDVFSFGVIVLEIISGKKVGRF 753

Query: 428  HDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +D  HH NLL HAW LW +  P EL+D  + D  + +++
Sbjct: 754  YDPHHHLNLLSHAWRLWIEERPLELVDELLDDPVIPTEI 792



 Score = 55.5 bits (132), Expect(2) = 2e-60
 Identities = 35/75 (46%), Positives = 43/75 (57%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
            LR IHVALLCV + PE+RP M S+V ML N E  LPKP+ P F+  ++      +   RC
Sbjct: 793  LRYIHVALLCVQRRPENRPDMLSIVLML-NGEKELPKPRLPAFYTGKHDPIWLGS-PSRC 850

Query: 130  CYEIAMITFSTLEGR 86
                  IT S LE R
Sbjct: 851  S---TSITISLLEAR 862



>gb:AY534539_1612232 Raphanus sativus haplotype S23 S-locus receptor
           kinase gene, partial cds.
          Length = 290

 Score =  196 bits (498), Expect(2) = 3e-60
 Identities = 91/156 (58%), Positives = 118/156 (75%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F E+R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 43  DSYLFGETRSSKLNWKERFDIINGVARGLLYLHQDSRFRIIHRDLKASNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI E D+  AKT++V+GTYGYMSPEYV+DG FS KSDVFS GVI+LE++SG+KN
Sbjct: 103 SDFGMARIFERDETEAKTRKVVGTYGYMSPEYVMDGIFSEKSDVFSFGVIVLEIVSGKKN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F++  + +NLL + W  W +G   E++D  + DS
Sbjct: 163 RGFYNMSNENNLLSYVWSHWKEGRALEIVDPVILDS 198



 Score = 58.9 bits (141), Expect(2) = 3e-60
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L CI + LLCV +  E+RP M+SVV+ML +E   +P+PK PG+ V R+  E   +  ++C
Sbjct: 212 LHCIQIGLLCVQEHAENRPMMSSVVWMLGSEATEIPQPKPPGYCVIRSPYELDPSSSKKC 271

Query: 130 ----CYEIAMITFSTLEGR 86
                + +   T S ++ R
Sbjct: 272 DDNESWTVNQYTCSVIDAR 290



>gb:AF403127_1796415 Oryza sativa S-locus receptor-like kinase RLK13
            (RLK13) mRNA, complete cds.
          Length = 813

 Score =  190 bits (483), Expect(2) = 4e-60
 Identities = 93/162 (57%), Positives = 117/162 (72%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD  R  +  W TRF+I  GI+RGLLYLHQDSRL IIHRDLK SNILLD  ++PKI
Sbjct: 579  DTFLFDAKRKSVLDWTTRFMIIKGIARGLLYLHQDSRLTIIHRDLKASNILLDTNMSPKI 638

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI E +     T RV+GTYGYMSPEY ++G+FSVKSD +S GV+LLEL+SG K 
Sbjct: 639  SDFGMARIFEGNKQQENTTRVVGTYGYMSPEYALEGSFSVKSDTYSFGVLLLELVSGLKI 698

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             + H      NL+  AW LW DGN  +L+D+ +R+S +  +V
Sbjct: 699  SSPHLIMDFQNLITFAWSLWKDGNAMDLVDSSIRESCLLHEV 740



 Score = 64.3 bits (155), Expect(2) = 4e-60
 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER-NSTEASSTDKER 134
           LRCI +AL CV   P  RP M+S+VFMLENE  ALP PKEP +       T+ +  +KER
Sbjct: 741 LRCIQIALSCVQDDPTARPLMSSIVFMLENETAALPTPKEPAYLTAMVYGTKDTRENKER 800

Query: 133 CCYEIAMITFSTLEGR 86
               +  ++ + LEGR
Sbjct: 801 ---SVNNVSITALEGR 813



>gb:OSJN00097_1694866 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0015D13, complete sequence.
          Length = 3307

 Score =  188 bits (478), Expect = 9e-47
 Identities = 97/185 (52%), Positives = 123/185 (66%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +R  +  W TRF I  GI++GLLYLHQDSRL IIHRDLK SNILLD E+NPKI
Sbjct: 586  DAFLFDATRKYVLDWPTRFKIIKGIAKGLLYLHQDSRLTIIHRDLKASNILLDTEMNPKI 645

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEYV+ G FSVKSD +S GV+LLE++SG K 
Sbjct: 646  SDFGIARIFHGNQQQANTTRVVGTYGYMSPEYVLGGAFSVKSDTYSFGVLLLEIVSGLKI 705

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSCSSSLRFETTRR* 258
             +   + +  +L  +AW LW DGN  EL+D    DSY       +H   S + ++     
Sbjct: 706  SSSKLTPNFFSLTAYAWRLWKDGNATELLDKFFVDSY------PLHEAFSDVIYDFKSLM 759

Query: 257  TNNGI 243
             N+G+
Sbjct: 760  ENSGV 764



 Score =  181 bits (458), Expect(2) = 5e-60
 Identities = 88/156 (56%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +R  +  W  RF I  G++RGLLYLHQDSRL IIHRDLK  NILLDAE++PKI
Sbjct: 3073 DAFLFDATRKTVLDWPNRFKIIKGVARGLLYLHQDSRLTIIHRDLKAGNILLDAEMSPKI 3132

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEY ++G FSVKSD++S G++LLE+ISG + 
Sbjct: 3133 SDFGMARIFGGNQQQANTTRVVGTYGYMSPEYAMEGIFSVKSDIYSFGILLLEIISGFRI 3192

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             + H      NL+ ++W LW DGN  +L+D+ V +S
Sbjct: 3193 SSPHLIMGFPNLIAYSWSLWKDGNARDLVDSSVVES 3228



 Score =  172 bits (436), Expect(2) = 2e-53
 Identities = 87/162 (53%), Positives = 108/162 (66%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD  R  +  W TRF+I  GI+RGLLYLHQDSRL IIHRDLK SNILLD  ++PKI
Sbjct: 2170 DTFLFDAKRKSVLDWTTRFMIIKGIARGLLYLHQDSRLTIIHRDLKASNILLDTNMSPKI 2229

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI E +     T RV+GTYGYMSPEY ++G+FSVKSD +S GV+LLEL      
Sbjct: 2230 SDFGMARIFEGNKQQENTTRVVGTYGYMSPEYALEGSFSVKSDTYSFGVLLLEL------ 2283

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                           AW LW DGN  +L+D+ +R+S +  +V
Sbjct: 2284 ---------------AWSLWKDGNAMDLVDSSIRESCLLHEV 2310



 Score =  167 bits (423), Expect = 2e-40
 Identities = 85/163 (52%), Positives = 108/163 (66%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +   +  WQTRF I  G++RGLLYLHQDSR+ IIHRDLKTSNILLDAE+NPKI
Sbjct: 1361 DKFLFDHAMKSVIDWQTRFNIIKGVARGLLYLHQDSRMMIIHRDLKTSNILLDAEMNPKI 1420

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI    +  A T+RV+GTYGYM+PEY ++G FSVKSD +S GV+LLE+      
Sbjct: 1421 SDFGMARIFGNSEQQASTRRVVGTYGYMAPEYAMEGIFSVKSDTYSFGVLLLEI------ 1474

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVA 309
                           AW LW DG     +D  V +S + ++V+
Sbjct: 1475 ---------------AWNLWKDGMAEAFVDKMVLESCLLNEVS 1502



 Score = 73.6 bits (179), Expect(2) = 5e-60
 Identities = 36/75 (48%), Positives = 49/75 (65%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
            LRCIH+ALLC+   P+DRP M+SVVFMLEN    LP+PK+P FFV +    A+   +E  
Sbjct: 3235 LRCIHIALLCIQDHPDDRPLMSSVVFMLENNTAPLPQPKQPIFFVHKK--RATEYARENM 3292

Query: 130  CYEIAMITFSTLEGR 86
               +  ++ + LEGR
Sbjct: 3293 ENSVNGVSITALEGR 3307



 Score = 59.7 bits (143), Expect(2) = 2e-53
 Identities = 31/60 (51%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER-NSTEASSTDKER 134
            LRCI +AL CV   P  RP M+S+VFMLENE  ALP PKE  +   R   T+ +  +KER
Sbjct: 2311 LRCIQIALSCVQDDPTARPLMSSIVFMLENETAALPTPKESAYLTARVYGTKDTRENKER 2370



>gb:AF403126_1796414 Oryza sativa S-locus receptor-like kinase RLK14
            (RLK14) mRNA, complete cds.
          Length = 813

 Score =  181 bits (458), Expect(2) = 5e-60
 Identities = 88/156 (56%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +R  +  W  RF I  G++RGLLYLHQDSRL IIHRDLK  NILLDAE++PKI
Sbjct: 579  DAFLFDATRKTVLDWPNRFKIIKGVARGLLYLHQDSRLTIIHRDLKAGNILLDAEMSPKI 638

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEY ++G FSVKSD++S G++LLE+ISG + 
Sbjct: 639  SDFGMARIFGGNQQQANTTRVVGTYGYMSPEYAMEGIFSVKSDIYSFGILLLEIISGFRI 698

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             + H      NL+ ++W LW DGN  +L+D+ V +S
Sbjct: 699  SSPHLIMGFPNLIAYSWSLWKDGNARDLVDSSVVES 734



 Score = 73.6 bits (179), Expect(2) = 5e-60
 Identities = 36/75 (48%), Positives = 49/75 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LRCIH+ALLC+   P+DRP M+SVVFMLEN    LP+PK+P FFV +    A+   +E  
Sbjct: 741 LRCIHIALLCIQDHPDDRPLMSSVVFMLENNTAPLPQPKQPIFFVHKK--RATEYARENM 798

Query: 130 CYEIAMITFSTLEGR 86
              +  ++ + LEGR
Sbjct: 799 ENSVNGVSITALEGR 813



>gb:AY534534_1612227 Raphanus sativus haplotype S15 S-locus receptor
           kinase gene, partial cds.
          Length = 290

 Score =  188 bits (477), Expect(2) = 5e-60
 Identities = 89/156 (57%), Positives = 117/156 (75%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F ++R     W+ RF I  GI+RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 43  DSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   D+  A TKRV+GTYGYMSPEY + G FS KSDVFS GVI+LE+++G++N
Sbjct: 103 SDFGMARIFARDETEANTKRVVGTYGYMSPEYAMKGIFSEKSDVFSFGVIVLEIVTGKRN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            AF++ ++ +NLLG+AW  W +G   E++D  + DS
Sbjct: 163 IAFNNLNYENNLLGYAWSNWKEGKALEIVDPDIVDS 198



 Score = 66.2 bits (160), Expect(2) = 5e-60
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + L+CV +L E RPTM+SVV+ML +E   +P+PK PG++V R+S E   +   +C
Sbjct: 212 LKCIQIGLVCVQELAEHRPTMSSVVWMLGSEAAEIPQPKPPGYWVRRSSYEIDPSSSRQC 271

Query: 130 ----CYEIAMITFSTLEGR 86
                + +   T S ++ R
Sbjct: 272 DDDDSWTVNQYTCSVIDAR 290



>pir|T14377|T14377 S-receptor kinase (EC 2.7.1.-) SRK29 -
            turnip>gb:AB008191_1510363 Brassica rapa mRNA for SRK29,
            complete cds.
          Length = 854

 Score =  192 bits (488), Expect(2) = 9e-60
 Identities = 92/156 (58%), Positives = 115/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD SR     WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 615  DSHLFDGSRSCKLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMTPKI 674

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY ++G FS+KSDVFS GV+LLE+ISG++N
Sbjct: 675  SDFGMARIFGRDETEADTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRN 734

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F DSD   NLLG  W  W +G   E++D  + DS
Sbjct: 735  KGFCDSDSSLNLLGCVWRNWKEGQGLEIVDRVIIDS 770



 Score = 61.2 bits (147), Expect(2) = 9e-60
 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = -1

Query: 307  RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA-SSTDKERC 131
            RC+ + LLCV +  EDRP M+SVV ML +E   +P+PK+PG+ V  +S E  S  D E  
Sbjct: 782  RCLQIGLLCVQERVEDRPMMSSVVLMLGSEAALIPQPKQPGYCVSGSSLETYSRRDDEN- 840

Query: 130  CYEIAMITFSTLEGR 86
             + +  IT S ++ R
Sbjct: 841  -WTVNQITMSIIDAR 854



>gb:OSJN00195_1696529 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0015G09, complete sequence.
          Length = 846

 Score =  188 bits (477), Expect(2) = 9e-60
 Identities = 92/156 (58%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +R     W TRF I  G++RGLLYLHQDSRL IIHRDLKTSNILLD E++PKI
Sbjct: 610  DAFLFDANRKNTLDWPTRFKIIKGVARGLLYLHQDSRLTIIHRDLKTSNILLDTEMSPKI 669

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   ++  A T RV+GTYGYMSPEY +DG FSVKSD +S GVILLE++SG K 
Sbjct: 670  SDFGMARIFGGNEQQANTTRVVGTYGYMSPEYALDGYFSVKSDTYSFGVILLEVVSGLKI 729

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             + H      NL+ +AW LW DGN  + +D+ + +S
Sbjct: 730  SSAHLKVDCSNLIAYAWSLWKDGNARDFVDSSIVES 765



 Score = 65.5 bits (158), Expect(2) = 9e-60
 Identities = 31/60 (51%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN-STEASSTDKER 134
           LRCIH+ LLC+   P  RP M+S+VFMLENE   LP PKEP +F  R   T+  + D  R
Sbjct: 772 LRCIHLGLLCIQDQPSARPLMSSIVFMLENETAVLPAPKEPIYFTRREYGTDEDTRDSMR 831



>gb:AF527808_1808433 Sorghum bicolor clone BAC SBTXS_0040L6 php200725
            orthologous region.
          Length = 839

 Score =  193 bits (490), Expect(2) = 9e-60
 Identities = 97/156 (62%), Positives = 117/156 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +R  +  W TRF I  GISRG+LYLHQDSRL I+HRDLKTSNILLDA++NPKI
Sbjct: 606  DSFIFDAARKNVLDWPTRFRIIKGISRGVLYLHQDSRLTIVHRDLKTSNILLDADMNPKI 665

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEY +DG FSV SD +SLGVILLE+ISG K 
Sbjct: 666  SDFGMARIFGGNQQEANTNRVVGTYGYMSPEYAMDGAFSVMSDTYSLGVILLEIISGLKI 725

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             + H S    +LL +AW LWNDG   +L+D+ V +S
Sbjct: 726  TSTH-STSFPSLLAYAWSLWNDGKAMDLVDSFVLES 760



 Score = 60.5 bits (145), Expect(2) = 9e-60
 Identities = 35/75 (46%), Positives = 44/75 (58%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LRCIH+ LLCV   P  RP M++VVFMLENE   L  PK+P +F  +   EA  T  E  
Sbjct: 767 LRCIHIGLLCVQDNPNSRPLMSTVVFMLENETTLLSVPKQPMYF-SQWYLEAQGTG-ENT 824

Query: 130 CYEIAMITFSTLEGR 86
              +  +T + LEGR
Sbjct: 825 NSSMNNMTVTVLEGR 839



>gb:BT005954_1638876 Arabidopsis thaliana At4g23180 gene, complete
           cds.>gb:AK117765_1815781 Arabidopsis thaliana At4g23180
           mRNA for putative receptor-like protein kinase 4 (RLK4),
           complete cds, clone: RAFL17-45-D12.
          Length = 669

 Score =  196 bits (497), Expect(2) = 1e-59
 Identities = 91/163 (55%), Positives = 122/163 (74%), Gaps = 5/163 (3%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  G++RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 430 DYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 489

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYMSPEY + G +S+KSDV+S GV++LE+ISG+KN
Sbjct: 490 ADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKN 549

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD-----NCVRDSYV 324
            +F+ +D  H+L+ +AW LW++G P EL+D     NC R+  V
Sbjct: 550 SSFYQTDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVV 592



 Score = 57.4 bits (137), Expect(2) = 1e-59
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPG-FFVERNSTEASSTD 143
           +RC+H+ LLCV + P +RPT++++V ML +  V LP P++PG FF  R   +   TD
Sbjct: 592 VRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIGKDPLDTD 648



>gb:AF083790_1767020 Arabidopsis thaliana clone sps866 unknown mRNA.
          Length = 658

 Score =  196 bits (497), Expect(2) = 1e-59
 Identities = 91/163 (55%), Positives = 122/163 (74%), Gaps = 5/163 (3%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  G++RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 419 DYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 478

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYMSPEY + G +S+KSDV+S GV++LE+ISG+KN
Sbjct: 479 ADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKN 538

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD-----NCVRDSYV 324
            +F+ +D  H+L+ +AW LW++G P EL+D     NC R+  V
Sbjct: 539 SSFYQTDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVV 581



 Score = 57.4 bits (137), Expect(2) = 1e-59
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPG-FFVERNSTEASSTD 143
           +RC+H+ LLCV + P +RPT++++V ML +  V LP P++PG FF  R   +   TD
Sbjct: 581 VRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIGKDPLDTD 637



>pir|T04835|T04835 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.70 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546155 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549620
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 633

 Score =  196 bits (497), Expect(2) = 1e-59
 Identities = 91/163 (55%), Positives = 122/163 (74%), Gaps = 5/163 (3%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  G++RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 394 DYFLFDPAKKGQLDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 453

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYMSPEY + G +S+KSDV+S GV++LE+ISG+KN
Sbjct: 454 ADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKN 513

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD-----NCVRDSYV 324
            +F+ +D  H+L+ +AW LW++G P EL+D     NC R+  V
Sbjct: 514 SSFYQTDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVV 556



 Score = 57.4 bits (137), Expect(2) = 1e-59
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPG-FFVERNSTEASSTD 143
           +RC+H+ LLCV + P +RPT++++V ML +  V LP P++PG FF  R   +   TD
Sbjct: 556 VRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIGKDPLDTD 612



>gb:AP003406_1828884 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1070A12.
          Length = 856

 Score =  191 bits (484), Expect(2) = 2e-59
 Identities = 87/162 (53%), Positives = 121/162 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FDE +  +  W  RF I  G++RGLLYLH+DSR +IIHRDLK SN+LLD  + PKI
Sbjct: 624  DTFIFDEGKRKLLRWSKRFEIIVGVARGLLYLHEDSRFRIIHRDLKASNVLLDRNMVPKI 683

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+AR+   D   A T++VIGTYGYMSPEY +DG FS+KSDV+S GV++LE+++GR+N
Sbjct: 684  SDFGIARMFGGDQTTAYTRKVIGTYGYMSPEYAMDGVFSMKSDVYSFGVLVLEIVTGRRN 743

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            R F++++   NLL ++WLLW +G   +L+D  +  S+  S+V
Sbjct: 744  RGFYEAELDLNLLRYSWLLWKEGRSVDLLDQLLGGSFDYSEV 785



 Score = 62.0 bits (149), Expect(2) = 2e-59
 Identities = 28/56 (50%), Positives = 39/56 (69%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           LRCI VALLCV   P +RP M+SVV ML +E   LP+P EPG  + R++++  S++
Sbjct: 786 LRCIQVALLCVEVQPRNRPLMSSVVMMLASENATLPEPNEPGVNIGRHASDTESSE 841



>gb:AB052755_1521237 Arabidopsis lyrata mRNA for SRKa, partial cds.
          Length = 847

 Score =  187 bits (475), Expect(2) = 2e-59
 Identities = 87/150 (58%), Positives = 113/150 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +F + +     WQ RF I  GI+RGLLYLHQDSR KIIHRDLK SN+LLD ++ PKI
Sbjct: 603  DSHLFKKVQSSKLNWQKRFNIINGIARGLLYLHQDSRFKIIHRDLKASNVLLDKDMTPKI 662

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI E ++  A TK+V+GTYGYMSPEY +DG FSVKSDVFS GV++LE++SG++N
Sbjct: 663  SDFGMARIFEREETEASTKKVVGTYGYMSPEYAMDGIFSVKSDVFSFGVLVLEIVSGKRN 722

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
            R F++S+  +NLL + W  W +G   E+ D
Sbjct: 723  RGFYNSNQDNNLLSYTWDHWKEGKWLEIAD 752



 Score = 65.5 bits (158), Expect(2) = 2e-59
 Identities = 33/77 (42%), Positives = 48/77 (62%), Gaps = 2/77 (2%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN--STEASSTDKE 137
            LRC+ + LLCV +  EDRP M+SVVFML NE+  +P+PK PG+ + R+   T++SS+ + 
Sbjct: 771  LRCLQIGLLCVQERAEDRPKMSSVVFMLGNEKGEIPQPKPPGYCIGRSFLETDSSSSTQR 830

Query: 136  RCCYEIAMITFSTLEGR 86
                 I   T S +  R
Sbjct: 831  NESSTINQFTVSVINAR 847



>pir|T14375|T14375 S-receptor kinase (EC 2.7.1.-) 1 -
            turnip>gb:AB000970_1508445 Brassica campestris gene for
            receptor kinase 1, complete cds.
          Length = 847

 Score =  186 bits (473), Expect(2) = 2e-59
 Identities = 85/156 (54%), Positives = 116/156 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD+ R    +W  RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD  + PKI
Sbjct: 605  DSHLFDKIRRSNLSWPKRFDITNGIARGLLYLHQDSRFRIIHRDLKASNVLLDKNMTPKI 664

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   ++  A T++V+GTYGYM+PEY +DG FS+KSDVFS GV+LLE+I+G+++
Sbjct: 665  SDFGMARIFGREETEANTRKVVGTYGYMAPEYAMDGIFSMKSDVFSFGVLLLEIITGKRS 724

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++S+  +NLLG  W  W +G   E++D  + DS
Sbjct: 725  KGFYNSNRDNNLLGFVWRYWKEGKGIEIVDPIIMDS 760



 Score = 66.2 bits (160), Expect(2) = 2e-59
 Identities = 34/77 (44%), Positives = 49/77 (63%), Gaps = 2/77 (2%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN--STEASSTDKE 137
            LRCI + LLCV +  EDRP M++V+ ML +E  A+P+PK PGF V R+   TE+SS+ + 
Sbjct: 771  LRCIQIGLLCVQERAEDRPVMSTVMVMLGSETTAIPQPKPPGFCVGRSLFETESSSSTQR 830

Query: 136  RCCYEIAMITFSTLEGR 86
                 +  IT S ++ R
Sbjct: 831  DDELSVNQITLSVIDAR 847



>pir|T05179|T05179 S-receptor kinase (EC 2.7.1.-) T6K22.100 precursor
            - Arabidopsis thaliana>gb:ATCHRIV54_1545974 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            54.>gb:ATT6K22_1556402 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T6K22 (ESSAII project).
          Length = 844

 Score =  196 bits (497), Expect(2) = 2e-59
 Identities = 89/142 (62%), Positives = 113/142 (79%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            WQTRF I  GI+RGLLYLHQDSR KIIHRDLK SN+LLD  + PKISDFG+ARI E D+ 
Sbjct: 613  WQTRFSIINGIARGLLYLHQDSRFKIIHRDLKASNVLLDKNMTPKISDFGMARIFERDET 672

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
             A T++V+GTYGYMSPEY ++G FSVKSDVFS GV++LE++SG++NR FH+S   +NLLG
Sbjct: 673  EANTRKVVGTYGYMSPEYAMEGIFSVKSDVFSFGVLVLEIVSGKRNRGFHNSGQDNNLLG 732

Query: 395  HAWLLWNDGNPFELMDNCVRDS 330
            + W  W +G   E++D+ + DS
Sbjct: 733  YTWENWKEGKGLEIVDSIIVDS 754



 Score = 57.0 bits (136), Expect(2) = 2e-59
 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 2/61 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNS--TEASSTDKE 137
           LRCI + LLCV +  EDRP M+SVV ML +E+     P+ PG+ V R+S  T+ SS+  E
Sbjct: 767 LRCIQIGLLCVQERAEDRPKMSSVVLMLGSEKGEYFSPRRPGYCVRRSSLDTDDSSSSTE 826

Query: 136 R 134
           R
Sbjct: 827 R 827



>gb:AP003368_1828580 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:B1100D10.
          Length = 827

 Score =  196 bits (497), Expect(2) = 2e-59
 Identities = 94/162 (58%), Positives = 118/162 (72%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+F++SR  +  W+ R  I  GI+ GLLYLH+ SRL+IIHRDLK SNILLD ++NPKI
Sbjct: 594  DFFLFEKSRSVVLDWRKRIHIIEGIAHGLLYLHKHSRLRIIHRDLKASNILLDIDMNPKI 653

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLARI    +  A T RV+GTYGYM+PEY + G FSVKSDVFS GV+LLE++SG +N
Sbjct: 654  SDFGLARIFGSKETQANTNRVVGTYGYMAPEYAMQGIFSVKSDVFSFGVLLLEIVSGMRN 713

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
               H      NLLGHAW LW +G  F+L+D   RD+Y E +V
Sbjct: 714  AGSHRRGRSLNLLGHAWELWREGRWFDLVDPSTRDAYPEHRV 755



 Score = 57.0 bits (136), Expect(2) = 2e-59
 Identities = 29/75 (38%), Positives = 42/75 (56%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LRC+HV L+CV +   DRPTM+ V+ ML +E + LP P++P F       E  + D    
Sbjct: 756 LRCVHVGLMCVQENAVDRPTMSDVISMLTSESITLPDPRQPAFLSIVLPAEMDAHDGS-- 813

Query: 130 CYEIAMITFSTLEGR 86
            +    +T + LEGR
Sbjct: 814 -FSQNAMTITDLEGR 827



>gb:AF084036_1767053 Arabidopsis thaliana receptor-like protein kinase
            (RKS2) gene, complete cds.
          Length = 830

 Score =  189 bits (481), Expect(2) = 3e-59
 Identities = 91/162 (56%), Positives = 118/162 (72%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++FD  +  +  W+TRF I  GI RGL+YLH+DSRLKIIHRDLK SNILLD  LNPKI
Sbjct: 594  DAYLFDPVKQRLLDWKTRFNIIDGICRGLMYLHRDSRLKIIHRDLKASNILLDENLNPKI 653

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLARI + ++    T RV+GTYGYM+PEY + G FS KSDVFSLGVILLE++SGR+N
Sbjct: 654  SDFGLARIFQGNEDEVSTVRVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIVSGRRN 713

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             +F++   + NL  +AW LWN G    L+D  + +   E+++
Sbjct: 714  SSFYNDGQNPNLSAYAWKLWNTGEDIALVDPVIFEECFENEI 755



 Score = 62.0 bits (149), Expect(2) = 3e-59
 Identities = 28/74 (37%), Positives = 45/74 (60%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC+HV LLCV     DRP++A+V++ML +E   LP+PK+P F   R ++E  S+ +    
Sbjct: 757 RCVHVGLLCVQDHANDRPSVATVIWMLSSENSNLPEPKQPAFIPRRGTSEVESSGQSDPR 816

Query: 127 YEIAMITFSTLEGR 86
             I  ++ + + GR
Sbjct: 817 ASINNVSLTKITGR 830



>pir|T14520|T14520 probable S-receptor kinase (EC 2.7.1.-) SFR3
            precursor - wild cabbage>gb:BOY14286_1633937 Brassica
            oleracea SFR3 gene, partial.
          Length = 841

 Score =  187 bits (475), Expect(2) = 6e-59
 Identities = 89/156 (57%), Positives = 112/156 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD +R     WQ RF I  GI+RGL+YLH+DSR  IIHRDLK SN+LLD  + PKI
Sbjct: 599  DSHIFDITRRSNLNWQMRFDITNGIARGLVYLHRDSRFMIIHRDLKASNVLLDKNMTPKI 658

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   DD  A T++V+GTYGYMSPEY +DG FS+KSDVFS GV+LLE+ISG+KN
Sbjct: 659  SDFGMARIFGRDDAEANTRKVVGTYGYMSPEYAMDGIFSMKSDVFSFGVLLLEIISGKKN 718

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
              F++S+   NLL   W  W +G   E++D  + DS
Sbjct: 719  NGFYNSNQDLNLLALVWRKWKEGKWLEILDPIIIDS 754



 Score = 63.5 bits (153), Expect(2) = 6e-59
 Identities = 35/78 (44%), Positives = 47/78 (60%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE---ASSTDK 140
           LRCI + LLCV +  EDRP MASV+ M+ +E +A+P  K PGF V RN  E   +SST  
Sbjct: 765 LRCIQIGLLCVQERAEDRPVMASVMVMIGSETMAIPDRKRPGFCVGRNPLEIDSSSSTQG 824

Query: 139 ERCCYEIAMITFSTLEGR 86
              C  +  +T S ++ R
Sbjct: 825 NDEC-TVNQVTLSVIDAR 841



>gb:AF224705_1778584 Arabidopsis thaliana receptor-like protein
           kinase 4 (RLK4) mRNA, complete cds.
          Length = 658

 Score =  193 bits (491), Expect(2) = 6e-59
 Identities = 91/163 (55%), Positives = 122/163 (74%), Gaps = 5/163 (3%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  G++RG+LYLHQDSRL IIHRDLK S ILLDA++NPKI
Sbjct: 419 DYFLFDPAKKGQXDWTRRYKIIGGVARGILYLHQDSRLTIIHRDLKASTILLDADMNPKI 478

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYMSPEY + G +S+KSDV+S GV++LE+ISG+KN
Sbjct: 479 ADFGMARIFGLDQTEENTSRIVGTYGYMSPEYAMHGQYSMKSDVYSFGVLVLEIISGKKN 538

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD-----NCVRDSYV 324
            +F+ +D  H+L+ +AW LW++G P EL+D     NC R+  V
Sbjct: 539 SSFYQTDGAHDLVSYAWGLWSNGRPLELVDPAIVENCQRNEVV 581



 Score = 57.4 bits (137), Expect(2) = 6e-59
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPG-FFVERNSTEASSTD 143
           +RC+H+ LLCV + P +RPT++++V ML +  V LP P++PG FF  R   +   TD
Sbjct: 581 VRCVHIGLLCVQEDPAERPTLSTIVLMLTSNTVTLPVPRQPGLFFQSRIGKDPLDTD 637



>pir|T14519|T14519 probable S-receptor kinase (EC 2.7.1.-) SFR1 - wild
            cabbage>gb:BOY14285_1633936 Brassica oleracea mRNA for
            SFR1 protein.
          Length = 849

 Score =  183 bits (464), Expect(2) = 1e-58
 Identities = 89/156 (57%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD+SR     WQ RF IA GI+RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 609  DSHLFDKSRRSNLNWQLRFDIANGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY ++G FSVKSDVFS GV+LLE+ISG+++
Sbjct: 669  SDFGMARIFRRDETEANTRKVVGTYGYMSPEYAMNGIFSVKSDVFSFGVLLLEIISGKRS 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
              F++S    +LLG  W  W +    +++D  + DS
Sbjct: 729  TGFYNSSGDLSLLGCVWRNWKERKGLDIIDPIIIDS 764



 Score = 66.6 bits (161), Expect(2) = 1e-58
 Identities = 33/75 (44%), Positives = 45/75 (60%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LRCIH+ LLCV +  EDRP M+SV+ ML +E   LP+PK+P F V R   EA  +     
Sbjct: 775 LRCIHIGLLCVQERAEDRPAMSSVMVMLGSETTTLPEPKQPAFCVGRGPLEAELSKLGDD 834

Query: 130 CYEIAMITFSTLEGR 86
            + +  IT S ++ R
Sbjct: 835 EWTVNQITLSVIDAR 849



>gb:AF403129_1796417 Oryza sativa S-locus receptor-like kinase RLK10
            (RLK10) mRNA, complete cds.
          Length = 825

 Score =  185 bits (470), Expect(2) = 1e-58
 Identities = 89/157 (56%), Positives = 115/157 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+FD+S+  I  WQTRF I  G++RGL+YLHQDSR+++IHRDLK SNILLD E++PKI
Sbjct: 591  DYFLFDDSKKPILDWQTRFNIIKGVARGLVYLHQDSRMRVIHRDLKASNILLDEEMSPKI 650

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A TK V+GTYGYMSPEY ++G FSVKSD +S GV++LELISG K 
Sbjct: 651  SDFGMARIFGGNQHQANTKHVVGTYGYMSPEYAMEGIFSVKSDTYSFGVLVLELISGCKI 710

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
             + H      NL+  AW LW DG   + +D+ + + Y
Sbjct: 711  SSTHLIMDFPNLIACAWSLWKDGKAEKFVDSIILECY 747



 Score = 64.3 bits (155), Expect(2) = 1e-58
 Identities = 34/75 (45%), Positives = 44/75 (58%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L CIHV LLCV + P  RP M+SVV M ENE   LP  K+P +FV RN     +  +E  
Sbjct: 753 LLCIHVGLLCVQEDPNARPLMSSVVAMFENEATTLPTSKQPAYFVPRNCMAEGA--REDA 810

Query: 130 CYEIAMITFSTLEGR 86
              +  I+ +TL+GR
Sbjct: 811 NKSVNSISLTTLQGR 825



>gb:AY052581_1562777 Raphanus sativus haplotype S6 S-locus receptor
           kinase (SRK) gene, partial cds.
          Length = 291

 Score =  187 bits (476), Expect(2) = 1e-58
 Identities = 86/156 (55%), Positives = 116/156 (74%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRD+K SNILLD  + PKI
Sbjct: 44  DSFLFGKKRSSNLNWKDRFDITNGVARGLLYLHQDSRFRIIHRDMKVSNILLDKNMIPKI 103

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   ++  A TK+V+GTYGYMSPEY ++G FS KSDVFS GVI+LE++SG+++
Sbjct: 104 SDFGMARIFAREETEANTKKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVSGKRS 163

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F++ +H +NLL +AW  W +G   E++D  + DS
Sbjct: 164 RGFYNLNHENNLLSYAWSHWTEGTALEIVDPIIIDS 199



 Score = 62.0 bits (149), Expect(2) = 1e-58
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + LLCV +  E RPTM+SVV+ML +E   +PKP  PG++V R S E + +    C
Sbjct: 213 LKCIQIGLLCVQERAEHRPTMSSVVWMLGSEATEIPKPNPPGYYVGRCSYENNPSSSRLC 272

Query: 130 ----CYEIAMITFSTLEGR 86
                + +   T S ++ R
Sbjct: 273 DDYESWTVNQYTCSVIDAR 291



>pir|T04837|T04837 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.90 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546157 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549622
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 648

 Score =  189 bits (479), Expect(2) = 2e-58
 Identities = 89/163 (54%), Positives = 121/163 (74%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++ PKI
Sbjct: 407 DYFLFDPTKQGQLDWTKRYNIIGGITRGILYLHQDSRLTIIHRDLKASNILLDADMIPKI 466

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D  +A TKR+ GT+GYM PEYV+ G FS+KSDV+S GV++LE+I G+KN
Sbjct: 467 ADFGMARISGIDQSVANTKRIAGTFGYMPPEYVIHGQFSMKSDVYSFGVLILEIICGKKN 526

Query: 437 RAFHDSD-HHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
           R+F+ +D    NL+ + W LW +G+P EL+D  + ++    +V
Sbjct: 527 RSFYQADTKAENLVTYVWRLWTNGSPLELVDLTISENCQTEEV 569



 Score = 60.5 bits (145), Expect(2) = 2e-58
 Identities = 25/53 (47%), Positives = 37/53 (69%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS 152
           +RCIH+ALLCV + P+DRP +++++ ML N  + L  P+ PGFFV +N    S
Sbjct: 570 IRCIHIALLCVQEDPKDRPNLSTIMMMLTNSSLILSVPQPPGFFVPQNKERDS 622



>gb:AB041620_1519687 Brassica rapa BcRL3 gene for receptor kinase 3,
            complete cds.
          Length = 847

 Score =  181 bits (458), Expect(2) = 3e-58
 Identities = 84/156 (53%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +F  +R  +  WQ RF I  GI+RG+LYLH+DS ++IIHRDLK SNILLD ++ PKI
Sbjct: 608  DSHLFGLTRSSMLNWQMRFDIINGIARGILYLHRDSSIRIIHRDLKASNILLDKDMTPKI 667

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY ++G FS+KSDVFS GV+LLE+ISG++N
Sbjct: 668  SDFGMARIFGRDETEANTRKVVGTYGYMSPEYAMEGIFSMKSDVFSFGVLLLEIISGKRN 727

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            + F++    +NLL   W  W +G   E++D  + DS
Sbjct: 728  KGFNNLGRDNNLLDCVWRNWKEGQGLEIVDTVIIDS 763



 Score = 67.8 bits (164), Expect(2) = 3e-58
 Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN-STEASSTDKERC 131
           RC+ + LLCV   P+DRP M++VVFMLE+E   +P+PK PG+ V  N ST +   D+E C
Sbjct: 775 RCLQIGLLCVQARPDDRPIMSAVVFMLESEAADIPQPKPPGYCVIGNYSTWSKQRDRESC 834

Query: 130 CYEIAMITFSTLEGR 86
              +  IT S ++ R
Sbjct: 835 --TVNQITMSIIDAR 847



>gb:AY327041_1599682 Oryza sativa (japonica cultivar-group)
            receptor-like protein kinase ARK1 mRNA, complete cds.
          Length = 835

 Score =  189 bits (479), Expect(2) = 3e-58
 Identities = 92/162 (56%), Positives = 115/162 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F            R+ I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD E+ PKI
Sbjct: 609  DYFLF-----------ARYRIIEGITRGLLYLHQDSRYRIIHRDLKASNVLLDKEMTPKI 657

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+AR+   ++    T++V+GTYGYMSPEY +DG FSVKSDVFS GV+LLE+ISGR+N
Sbjct: 658  SDFGMARMFGSEETEINTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLLLEIISGRRN 717

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            R  +   +H NLLGHAW LWN+G   EL D  +  S+   +V
Sbjct: 718  RGVYSYSNHLNLLGHAWSLWNEGKSLELADETMNGSFDSDEV 759



 Score = 59.7 bits (143), Expect(2) = 3e-58
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFML-ENEEVALPKPKEPGFFVERNSTEASSTDKER 134
           L+CI V LLCV + P+DRP M+ V+ ML   +   LP PK+PGF   R   E  ++  + 
Sbjct: 760 LKCIRVGLLCVQENPDDRPLMSQVLLMLATTDATTLPTPKQPGFAARRILMETDTSSSKP 819

Query: 133 CCYEIAMITFSTLEGR 86
            C      T + LEGR
Sbjct: 820 DCSIFDSATVTILEGR 835



>gb:OSJN00019_1693374 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 814

 Score =  184 bits (467), Expect(2) = 3e-58
 Identities = 93/162 (57%), Positives = 118/162 (72%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+FD +   I  W TRF I  G++RGLLYLHQDSRL IIHRDLKTSNILLDA+++PKI
Sbjct: 581  DHFLFDPASKFILDWPTRFKIIKGVARGLLYLHQDSRLTIIHRDLKTSNILLDADMSPKI 640

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEY +DG FSVKSD++S GVILLE++SG K 
Sbjct: 641  SDFGMARIFGGNQQEANTNRVVGTYGYMSPEYAMDGVFSVKSDIYSFGVILLEIVSGLKI 700

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                  D   NLL +AW LW D    +L+D+ + +S  +++V
Sbjct: 701  SLPQLMD-FPNLLAYAWRLWKDDKTMDLVDSSIAESCSKNEV 741



 Score = 64.3 bits (155), Expect(2) = 3e-58
 Identities = 35/75 (46%), Positives = 45/75 (60%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L CIH+ LLCV   P  RP M+SVVFMLENE+ ALP P +P +F  R ++E   T +   
Sbjct: 742 LLCIHIGLLCVQDNPNSRPLMSSVVFMLENEQAALPAPIQPVYFAHR-ASETKQTGENTS 800

Query: 130 CYEIAMITFSTLEGR 86
                M + + LEGR
Sbjct: 801 SSNNNM-SLTVLEGR 814



>pir|T10573|T10573 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F25E4.150 - Arabidopsis thaliana (fragment)
          Length = 664

 Score =  198 bits (503), Expect(2) = 3e-58
 Identities = 93/162 (57%), Positives = 124/162 (76%), Gaps = 1/162 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 422 DYFLFDPAKQGELDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 481

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A T+R+ GT+GYMSPEY + G+FS+KSDV+S GV++LE+ISG+KN
Sbjct: 482 ADFGMARIFGVDQSQANTRRIAGTFGYMSPEYAMRGHFSMKSDVYSFGVLVLEIISGKKN 541

Query: 437 RAFHD-SDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
            +F++  D   NL+ HAW LW +G+P EL+D  + +SY  S+
Sbjct: 542 SSFYNIDDSGSNLVTHAWRLWRNGSPLELVDPTIGESYQSSE 583



 Score = 50.4 bits (119), Expect(2) = 3e-58
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           RCIH+ALLCV + P DRP + +++ ML +    L  P+ PGF +     E    +
Sbjct: 586 RCIHIALLCVQEDPADRPLLPAIIMMLTSSTTTLHVPRAPGFCLSGRDLEQDGVE 640



>pir|B85122|B85122 serine/threonine kinase-like protein (partial)
           [imported] - Arabidopsis thaliana>gb:ATCHRIV32_1544918
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 32.>gb:ATF25E4_1549990 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F25E4 (ESSA project).
          Length = 664

 Score =  198 bits (503), Expect(2) = 3e-58
 Identities = 93/162 (57%), Positives = 124/162 (76%), Gaps = 1/162 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 422 DYFLFDPAKQGELDWTRRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 481

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A T+R+ GT+GYMSPEY + G+FS+KSDV+S GV++LE+ISG+KN
Sbjct: 482 ADFGMARIFGVDQSQANTRRIAGTFGYMSPEYAMRGHFSMKSDVYSFGVLVLEIISGKKN 541

Query: 437 RAFHD-SDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
            +F++  D   NL+ HAW LW +G+P EL+D  + +SY  S+
Sbjct: 542 SSFYNIDDSGSNLVTHAWRLWRNGSPLELVDPTIGESYQSSE 583



 Score = 50.4 bits (119), Expect(2) = 3e-58
 Identities = 21/55 (38%), Positives = 31/55 (56%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           RCIH+ALLCV + P DRP + +++ ML +    L  P+ PGF +     E    +
Sbjct: 586 RCIHIALLCVQEDPADRPLLPAIIMMLTSSTTTLHVPRAPGFCLSGRDLEQDGVE 640



>gb:AY062569_1565225 Arabidopsis thaliana putative protein
           (At4g23230; F21P8.120) mRNA, complete
           cds.>gb:AY128796_1580876 Arabidopsis thaliana putative
           protein (At4g23230) mRNA, complete cds.
          Length = 507

 Score =  197 bits (500), Expect(2) = 3e-58
 Identities = 90/169 (53%), Positives = 126/169 (74%), Gaps = 1/169 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++     W  R+ +  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPK+
Sbjct: 299 DYFLFDPAKQNQLDWTRRYKVIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKL 358

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLARI   D     T R++GT+GYM+PEY + G FSVKSDV+S GV++LE+ISG+KN
Sbjct: 359 ADFGLARIFGMDQTQENTSRIVGTFGYMAPEYAIHGQFSVKSDVYSFGVLVLEIISGKKN 418

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVA-TMHSC 294
            +F+++D  H+L+ HAW LW++G   +L+D  + D+  +S+V   +H C
Sbjct: 419 NSFYETDGAHDLVTHAWRLWSNGTALDLVDPIIIDNCQKSEVVRCIHIC 467



 Score = 51.6 bits (122), Expect(2) = 3e-58
 Identities = 21/46 (45%), Positives = 32/46 (69%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
           +RCIH+ LLCV + P +RP ++++  ML +  V LP P +PGF V+
Sbjct: 461 VRCIHICLLCVQEDPAERPILSTIFMMLTSNTVTLPVPLQPGFPVQ 506



>gb:AY052582_1562778 Raphanus sativus haplotype S7 S-locus receptor
           kinase (SRK) gene, partial cds.
          Length = 291

 Score =  185 bits (470), Expect(2) = 3e-58
 Identities = 85/157 (54%), Positives = 116/157 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F E+R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 44  DSYLFGENRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKI 103

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   ++  A T +V+GTYGYMSPEY + G FS KSDVFS GVI+LE+I+G++N
Sbjct: 104 SDFGMARIFAREETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIILEIITGKRN 163

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
           R F++ ++ ++LL +AW  W +G   E++D  + DS+
Sbjct: 164 RGFYNLNYENDLLSYAWSNWKEGRALEIVDPVIIDSF 200



 Score = 63.2 bits (152), Expect(2) = 3e-58
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + LLCV  L E+RPTM+ VV+ML NE   +P+PK PG+ V R+  E   +   +C
Sbjct: 213 LKCIQIGLLCVQDLAENRPTMSFVVWMLGNEATEIPQPKWPGYCVRRSPYELDPSSSRQC 272

Query: 130 ----CYEIAMITFSTLEGR 86
                + +   T S ++ R
Sbjct: 273 DDDESWTVNQYTCSVIDAR 291



>pir|JQ1677|JQ1677 S-receptor kinase (EC 2.7.1.-) precursor -
            rape>gb:BNA245479_1633290 Brassica napus subsp. napus
            Sll3, slk, srk, CePP, Fmt, SIAH1, AtPP, SIAH2, & ClpP
            genes.>gb:BNASTKR_1633495 Brassica napus ssp. oleifera
            serine/threonine kinase receptor mRNA, complete cds.
          Length = 858

 Score =  191 bits (484), Expect(2) = 5e-58
 Identities = 86/156 (55%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F   R     W+ RF I  G++RGLLYLHQDSR +IIHRD+K SNILLD  + PKI
Sbjct: 611  DSYLFGNKRSSTLNWKDRFNITNGVARGLLYLHQDSRFRIIHRDMKVSNILLDKNMTPKI 670

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T++V+GTYGYMSPEY +DG FS KSDVFS GVI+LE++SG++N
Sbjct: 671  SDFGMARIFARDETEANTRKVVGTYGYMSPEYAMDGVFSEKSDVFSFGVIVLEIVSGKRN 730

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F++ +H +NLL + W  W +G   E++D  + DS
Sbjct: 731  RGFYNLNHENNLLSYVWSHWTEGRALEIVDPVIVDS 766



 Score = 57.0 bits (136), Expect(2) = 5e-58
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + LLCV +  E RPTM+SVV+ML +E   +P+P  PG+ + R+  E + +    C
Sbjct: 780 LKCIQIGLLCVQERAEHRPTMSSVVWMLGSEATEIPQPTPPGYSLGRSPYENNPSSSRHC 839



>gb:AP004231_1839010 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC
            clone:OSJNBa0026J14.>gb:AP004232_1839055 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:OSJNBa0051H17.
          Length = 848

 Score =  189 bits (480), Expect(2) = 5e-58
 Identities = 89/168 (52%), Positives = 116/168 (69%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+FDE+R  +  W  R  I  GI++GLLYLH+ SRL+IIHRDLK  NILLD E+NPKI
Sbjct: 614  DFFIFDETRRALVDWNKRLAIINGIAQGLLYLHKHSRLRIIHRDLKAGNILLDHEMNPKI 673

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLA+I   +D    TKR++GTYGYM+PEY  +G FS+KSDVFS GV++LE +SG++ 
Sbjct: 674  SDFGLAKIFSTNDTEGNTKRIVGTYGYMAPEYASEGLFSIKSDVFSFGVLILETVSGKRT 733

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSC 294
             +FH      NLLGHAW +W D    +L+D  +    +ES    M  C
Sbjct: 734  SSFHRHGDFINLLGHAWQMWKDETWLQLVDTSL---VIESHTPEMARC 778



 Score = 58.5 bits (140), Expect(2) = 5e-58
 Identities = 28/54 (51%), Positives = 37/54 (68%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASST 146
           RCI++ALLCV +   DRPTM+ VV ML +E + LP+PK P F+  R + E  ST
Sbjct: 777 RCINIALLCVQENAADRPTMSEVVAMLTSESMTLPEPKYPAFYHMRVTKEEPST 830



>gb:OSJN00097_1694867 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0015D13, complete sequence.
          Length = 718

 Score =  185 bits (470), Expect(2) = 5e-58
 Identities = 89/157 (56%), Positives = 115/157 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD+S+  I  WQTRF I  G++RGL+YLHQDSR+++IHRDLK SNILLD E++PKI
Sbjct: 484 DYFLFDDSKKPILDWQTRFNIIKGVARGLVYLHQDSRMRVIHRDLKASNILLDEEMSPKI 543

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   +   A TK V+GTYGYMSPEY ++G FSVKSD +S GV++LELISG K 
Sbjct: 544 SDFGMARIFGGNQHQANTKHVVGTYGYMSPEYAMEGIFSVKSDTYSFGVLVLELISGCKI 603

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
            + H      NL+  AW LW DG   + +D+ + + Y
Sbjct: 604 SSTHLIMDFPNLIACAWSLWKDGKAEKFVDSIILECY 640



 Score = 62.4 bits (150), Expect(2) = 5e-58
 Identities = 33/75 (44%), Positives = 43/75 (57%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L CIHV LLCV + P  RP M+SVV M ENE   LP  K+P +FV RN     +  +E  
Sbjct: 646 LLCIHVGLLCVQEDPNARPLMSSVVAMFENEATTLPTSKQPAYFVPRNCMAEGA--REDA 703

Query: 130 CYEIAMITFSTLEGR 86
              +   + +TL+GR
Sbjct: 704 NKSVNSTSLTTLQGR 718



>gb:AC091233_1734637 Oryza sativa chromosome 3 BAC OSJNBa0053G10
            genomic sequence, complete sequence.
          Length = 868

 Score =  191 bits (486), Expect(2) = 6e-58
 Identities = 89/151 (58%), Positives = 114/151 (75%)
 Frame = -3

Query: 791  FVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISD 612
            F+F+E +  I  W  RF I  GI+RG+LYLHQDS L+IIHRDLK SNILLD ++NPKISD
Sbjct: 636  FLFNEEKQSILNWSKRFNIINGIARGILYLHQDSALRIIHRDLKASNILLDRDMNPKISD 695

Query: 611  FGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRA 432
            FG+ARI   D   A TK+V+GTYGYMSPEY +DG FS+KSDVFS GV++LE++SG+KNR 
Sbjct: 696  FGVARIFGTDQTSAYTKKVVGTYGYMSPEYAMDGVFSMKSDVFSFGVLVLEIVSGKKNRG 755

Query: 431  FHDSDHHHNLLGHAWLLWNDGNPFELMDNCV 339
            F+ ++   NLL +AW LW +G   E +D  +
Sbjct: 756  FYHNELDLNLLRYAWRLWKEGRSLEFLDQSI 786



 Score = 55.8 bits (133), Expect(2) = 6e-58
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASSTDK 140
            LRCI + LLCV + P  RPTM++V  ML +E  AL +P EP F   R   + TEAS ++ 
Sbjct: 797  LRCIQIGLLCVQEQPRHRPTMSAVTMMLSSESPALLEPCEPAFCTGRSLSDDTEASRSNS 856

Query: 139  ERCCYEIAMITFSTLEGR 86
             R        T + +EGR
Sbjct: 857  ARSW------TVTVVEGR 868



>gb:AC091234_1734688 Oryza sativa chromosome 3 BAC OSJNBa0057E11
           genomic sequence, complete sequence.
          Length = 312

 Score =  191 bits (486), Expect(2) = 6e-58
 Identities = 89/151 (58%), Positives = 114/151 (75%)
 Frame = -3

Query: 791 FVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISD 612
           F+F+E +  I  W  RF I  GI+RG+LYLHQDS L+IIHRDLK SNILLD ++NPKISD
Sbjct: 80  FLFNEEKQSILNWSKRFNIINGIARGILYLHQDSALRIIHRDLKASNILLDRDMNPKISD 139

Query: 611 FGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRA 432
           FG+ARI   D   A TK+V+GTYGYMSPEY +DG FS+KSDVFS GV++LE++SG+KNR 
Sbjct: 140 FGVARIFGTDQTSAYTKKVVGTYGYMSPEYAMDGVFSMKSDVFSFGVLVLEIVSGKKNRG 199

Query: 431 FHDSDHHHNLLGHAWLLWNDGNPFELMDNCV 339
           F+ ++   NLL +AW LW +G   E +D  +
Sbjct: 200 FYHNELDLNLLRYAWRLWKEGRSLEFLDQSI 230



 Score = 55.8 bits (133), Expect(2) = 6e-58
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASSTDK 140
           LRCI + LLCV + P  RPTM++V  ML +E  AL +P EP F   R   + TEAS ++ 
Sbjct: 241 LRCIQIGLLCVQEQPRHRPTMSAVTMMLSSESPALLEPCEPAFCTGRSLSDDTEASRSNS 300

Query: 139 ERCCYEIAMITFSTLEGR 86
            R        T + +EGR
Sbjct: 301 ARSW------TVTVVEGR 312



>gb:AY133720_1581540 Arabidopsis thaliana clone C103370 putative
           serine/threonine kinase (At4g23150) mRNA, complete cds.
          Length = 659

 Score =  192 bits (487), Expect(2) = 8e-58
 Identities = 91/162 (56%), Positives = 120/162 (74%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD ++ G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 418 DNFLFDPAKKGQLYWTQRYHIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 477

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYMSPEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 478 ADFGMARIFGMDQTQQNTSRIVGTYGYMSPEYAMRGQFSMKSDVYSFGVLVLEIISGRKN 537

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F ++D   +L+ HAW LW +G   +L+D  + DS  +S+V
Sbjct: 538 NSFIETDDAQDLVTHAWRLWRNGTALDLVDPFIADSCRKSEV 579



 Score = 55.1 bits (131), Expect(2) = 8e-58
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 6/63 (9%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFV------ERNSTEASS 149
           +RC H+ LLCV + P  RP M+++  ML +  +ALP P++PGFFV       R  ++ S+
Sbjct: 580 VRCTHIGLLCVQEDPVKRPAMSTISVMLTSNTMALPAPQQPGFFVRSRPGTNRLDSDQST 639

Query: 148 TDK 140
           T+K
Sbjct: 640 TNK 642



>pir|A41369|A41369 S-receptor kinase (EC 2.7.1.-) 6 precursor - wild
            cabbage>gb:BNASKR6A_1633481 Brassica oleracea receptor
            protein kinase (SKR6) mRNA, complete cds.
          Length = 857

 Score =  186 bits (473), Expect(2) = 1e-57
 Identities = 87/156 (55%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F ++R     W  RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 610  DSYLFGKTRRSKLNWNERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 669

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI E D+  A T +V+GTYGYMSPEY + G FS KSDVFS GVI+LE++SG+KN
Sbjct: 670  SDFGMARIFERDETEANTMKVVGTYGYMSPEYAMYGIFSEKSDVFSFGVIVLEIVSGKKN 729

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F++ D+ ++LL + W  W +G   E++D  + DS
Sbjct: 730  RGFYNLDYENDLLSYVWSRWKEGRALEIVDPVIVDS 765



 Score = 59.7 bits (143), Expect(2) = 1e-57
 Identities = 29/79 (36%), Positives = 45/79 (56%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
            L+CI + LLCV +L E RP M+SVV+M  +E   +P+PK PG+ V R+  E   +   +C
Sbjct: 779  LKCIQIGLLCVQELAEHRPAMSSVVWMFGSEATEIPQPKPPGYCVRRSPYELDPSSSWQC 838

Query: 130  ----CYEIAMITFSTLEGR 86
                 + +   T S ++ R
Sbjct: 839  DENESWTVNQYTCSVIDAR 857



>pir|T05753|T05753 S-receptor kinase (EC 2.7.1.-) M4I22.100 precursor
            - Arabidopsis thaliana>gb:ATCHRIV66_1546610 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            66.>gb:ATM4I22_1553665 Arabidopsis thaliana DNA
            chromosome 4, P1 clone M4I22 (ESSA project).
          Length = 772

 Score =  191 bits (484), Expect(2) = 1e-57
 Identities = 89/156 (57%), Positives = 117/156 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD+ R     W  R  I  GI+RG+LYLH+DSRL+IIHRDLK SN+LLD+++N KI
Sbjct: 536  DSFIFDKERRRELDWPKRVEIIKGIARGMLYLHEDSRLRIIHRDLKASNVLLDSDMNAKI 595

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR +  D+  A T RV+GTYGYMSPEY +DG FS+KSDVFS GV++LE++SGR+N
Sbjct: 596  SDFGLARTLGGDETEANTTRVVGTYGYMSPEYQIDGYFSLKSDVFSFGVLVLEIVSGRRN 655

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F + +H  NLLGHAW  + +   +E++D  V +S
Sbjct: 656  RGFRNEEHKLNLLGHAWRQFLEDKAYEIIDEAVNES 691



 Score = 55.5 bits (132), Expect(2) = 1e-57
 Identities = 27/48 (56%), Positives = 35/48 (72%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN 167
           LR IH+ LLCV + P+DRP M+ VV ML +E + L  P++PGFF ERN
Sbjct: 699 LRVIHIGLLCVQQDPKDRPNMSVVVLMLSSEMLLL-DPRQPGFFNERN 745



>sp|Q09092|SRK6_BRAOL Putative serine/threonine-protein kinase
            receptor precursor (EC 2.7.1.37) (S-receptor kinase)
            (SRK).
          Length = 849

 Score =  186 bits (473), Expect(2) = 2e-57
 Identities = 87/156 (55%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F ++R     W  RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 610  DSYLFGKTRRSKLNWNERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 669

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI E D+  A T +V+GTYGYMSPEY + G FS KSDVFS GVI+LE++SG+KN
Sbjct: 670  SDFGMARIFERDETEANTMKVVGTYGYMSPEYAMYGIFSEKSDVFSFGVIVLEIVSGKKN 729

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F++ D+ ++LL + W  W +G   E++D  + DS
Sbjct: 730  RGFYNLDYENDLLSYVWSRWKEGRALEIVDPVIVDS 765



 Score = 59.3 bits (142), Expect(2) = 2e-57
 Identities = 26/60 (43%), Positives = 38/60 (63%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + LLCV +L E RP M+SVV+M  +E   +P+PK PG+ V R+  E   +   +C
Sbjct: 779 LKCIQIGLLCVQELAEHRPAMSSVVWMFGSEATEIPQPKPPGYCVRRSPYELDPSSSWQC 838



>gb:BOLSRKA_1633859 Turnip mRNA for S-receptor kinase SRK9, partial
            cds.
          Length = 839

 Score =  180 bits (456), Expect(2) = 3e-57
 Identities = 87/156 (55%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F ++R     W+ RF I  GI+RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 597  DSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 656

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T RV+GTYGYMSPEY ++G FS KSDVFS GVI+LE+++G++N
Sbjct: 657  SDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRN 716

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F   ++ +NLL +AW  W +G   E++D  + DS
Sbjct: 717  REF---NNENNLLSYAWSNWKEGRALEIVDPDIVDS 749



 Score = 65.1 bits (157), Expect(2) = 3e-57
 Identities = 33/77 (42%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE--ASSTDKE 137
           L+CI + LLCV +L E RPTM+SVV+ML +E   +P+PK PG++V R+S E   SS+  +
Sbjct: 763 LKCIQIGLLCVQELAEHRPTMSSVVWMLGSEATEIPQPKPPGYWVRRSSYELDPSSSKCD 822

Query: 136 RCCYEIAMITFSTLEGR 86
              + +   T S ++ R
Sbjct: 823 DDSWTVNQYTCSVIDAR 839



>pir|T14398|T14398 S-receptor kinase (EC 2.7.1.-) -
            turnip>gb:D88193_1675095 Brassica rapa DNA for S-receptor
            kinase, complete cds.
          Length = 841

 Score =  180 bits (456), Expect(2) = 3e-57
 Identities = 87/156 (55%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F ++R     W+ RF I  GI+RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 599  DSYLFGKTRSSKLNWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 658

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T RV+GTYGYMSPEY ++G FS KSDVFS GVI+LE+++G++N
Sbjct: 659  SDFGMARIFARDETEANTMRVVGTYGYMSPEYAMEGIFSEKSDVFSFGVIVLEIVTGKRN 718

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F   ++ +NLL +AW  W +G   E++D  + DS
Sbjct: 719  REF---NNENNLLSYAWSNWKEGRALEIVDPDIVDS 751



 Score = 65.1 bits (157), Expect(2) = 3e-57
 Identities = 33/77 (42%), Positives = 50/77 (64%), Gaps = 2/77 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE--ASSTDKE 137
           L+CI + LLCV +L E RPTM+SVV+ML +E   +P+PK PG++V R+S E   SS+  +
Sbjct: 765 LKCIQIGLLCVQELAEHRPTMSSVVWMLGSEATEIPQPKPPGYWVRRSSYELDPSSSKCD 824

Query: 136 RCCYEIAMITFSTLEGR 86
              + +   T S ++ R
Sbjct: 825 DDSWTVNQYTCSVIDAR 841



>gb:AP004348_1840627 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0683C09.>gb:AP005515_1853255 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0064M11.>gb:AP005515_1853266 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0064M11.
          Length = 687

 Score =  191 bits (486), Expect(2) = 4e-57
 Identities = 90/150 (60%), Positives = 114/150 (76%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  R  +  W+TR  I  GI++GLLYLH+ SRL IIHRDLK SNILLD ++NPKI
Sbjct: 454 DFFIFDLKRAALLNWKTRLNIIEGITQGLLYLHKHSRLCIIHRDLKASNILLDRDMNPKI 513

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA+I + +D    TKRV+GTYGYM+PEY  +G FS+KSDVFS GV++LE+ISG++N
Sbjct: 514 SDFGLAKIFDSNDVQRNTKRVVGTYGYMAPEYASEGCFSLKSDVFSFGVLVLEIISGKRN 573

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
             FH      NLLG+AW LW DG+  EL+D
Sbjct: 574 AGFHQYGDFFNLLGYAWQLWKDGSWHELVD 603



 Score = 53.1 bits (126), Expect(2) = 4e-57
 Identities = 36/88 (40%), Positives = 50/88 (56%), Gaps = 1/88 (1%)
 Frame = -1

Query: 346 IV*ETLMWNLK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF-VER 170
           +V E  M  +K  +C+ VALLCV +   DRPTM++VV ML +E   LP+PK+P FF V  
Sbjct: 606 LVSEGQMMEIK--KCMKVALLCVQENAVDRPTMSAVVKMLSSELKILPEPKQPAFFNVRV 663

Query: 169 NSTEASSTDKERCCYEIAMITFSTLEGR 86
              E S+T        I  +T + + GR
Sbjct: 664 KHGELSNTAPS----SINDVTITIVNGR 687



>pir|T04845|T04845 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.170 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546165 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549630
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 656

 Score =  186 bits (471), Expect(2) = 4e-57
 Identities = 88/163 (53%), Positives = 118/163 (72%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD +  G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK  NILLDA++NPK+
Sbjct: 416 DYFLFDPTMQGQLDWSRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKV 475

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A T+RV+GTYGYM+PEY + G FS+KSDV+S GV++LE++SG KN
Sbjct: 476 ADFGMARIFGMDQTEANTRRVVGTYGYMAPEYAMYGKFSMKSDVYSFGVLVLEIVSGMKN 535

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +    D    NL+ + W LW++G+P EL+D    D+Y  S++
Sbjct: 536 SSLDQMDGSISNLVTYTWRLWSNGSPSELVDPSFGDNYQTSEI 578



 Score = 58.9 bits (141), Expect(2) = 4e-57
 Identities = 28/60 (46%), Positives = 37/60 (61%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RCIH+ALLCV +   DRPTM+++V ML    +AL  P+ PGFF+     +A     ER C
Sbjct: 580 RCIHIALLCVQEDANDRPTMSAIVQMLTTSSIALAVPRPPGFFLRSKQEQA-----ERAC 634



>gb:AY534540_1612233 Raphanus sativus haplotype S27 S-locus receptor
           kinase gene, partial cds.
          Length = 289

 Score =  186 bits (472), Expect(2) = 4e-57
 Identities = 85/156 (54%), Positives = 115/156 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F + R     W+ RF I +G++RGLLYLHQDSR ++IHRD+K SNILLD  + PKI
Sbjct: 43  DSYLFGKKRSFKLNWKDRFAITSGVARGLLYLHQDSRFRVIHRDMKVSNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   ++  A T +V+GTYGYMSPEY ++G FS KSDVFS GVI+LE++SGR++
Sbjct: 103 SDFGMARIFAREETEANTSKVVGTYGYMSPEYALNGVFSEKSDVFSFGVIVLEIVSGRRS 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+  DH +NLL +AW  W  G+  E++D  + DS
Sbjct: 163 RGFYHLDHENNLLSYAWSHWTGGSALEIVDPVIVDS 198



 Score = 58.5 bits (140), Expect(2) = 4e-57
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE---ASSTDK 140
           L+CI + LLCV +  E RPTM+SVV+ML +E   +P+P  PG++V R+  E   +SS   
Sbjct: 212 LKCIQIGLLCVQERAEHRPTMSSVVWMLGSEATEIPRPNPPGYYVGRSPYENNPSSSGPG 271

Query: 139 ERCCYEIAMITFSTLEGR 86
           +   + +   T S ++ R
Sbjct: 272 DDESWTVNQYTCSVIDAR 289



>pir|E96641|E96641 hypothetical protein T25B24.4 [imported] -
            Arabidopsis thaliana>gb:AE005173_893831 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC005850_1533092 Arabidopsis thaliana
            chromosome I BAC T25B24 genomic sequence, complete
            sequence.
          Length = 842

 Score =  191 bits (486), Expect(2) = 5e-57
 Identities = 92/156 (58%), Positives = 120/156 (76%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FDES+ G   W+ R+ +  GI+RGLLYLH+DSRLKIIHRDLK SNILLD E+NPKI
Sbjct: 607  DRFLFDESKQGSLDWRKRWEVIGGIARGLLYLHRDSRLKIIHRDLKASNILLDTEMNPKI 666

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI       A T RV+GTYGYM+PEY ++G FS KSDV+S GV++LE++SGRKN
Sbjct: 667  SDFGMARIFNYRQDHANTIRVVGTYGYMAPEYAMEGIFSEKSDVYSFGVLILEIVSGRKN 726

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             +F  +D H +L+G+AW LW+ G   E++D  V+D+
Sbjct: 727  VSFRGTD-HGSLIGYAWHLWSQGKTKEMIDPIVKDT 761



 Score = 52.8 bits (125), Expect(2) = 5e-57
 Identities = 27/75 (36%), Positives = 39/75 (52%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           +RCIHV +LC       RP M SV+ MLE++   LP P++P F    NS +         
Sbjct: 768 MRCIHVGMLCTQDSVIHRPNMGSVLLMLESQTSQLPPPRQPTFHSFLNSGDIELNFDGHD 827

Query: 130 CYEIAMITFSTLEGR 86
              +  +TF+T+ GR
Sbjct: 828 VASVNDVTFTTIVGR 842



>pir|D85065|D85065 receptor protein kinase-like protein [imported] -
           Arabidopsis thaliana>gb:ATCHRIV15_1544364 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 15.
          Length = 675

 Score =  196 bits (498), Expect(2) = 5e-57
 Identities = 89/162 (54%), Positives = 123/162 (75%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD  +  +  WQ R+ I  GI+RG+LYLH+DSRL IIHRDLK SNILLDA+++PKI
Sbjct: 429 DYFLFDNEKRRVLDWQRRYKIIEGIARGILYLHRDSRLTIIHRDLKASNILLDADMHPKI 488

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   D   A TKR++GTYGYMSPEY + G +SVKSDV+S GV++LELI+G+KN
Sbjct: 489 SDFGMARIFGVDQTQANTKRIVGTYGYMSPEYAIHGKYSVKSDVYSFGVLVLELITGKKN 548

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F++ D   +L+ + W LW + +P EL+D  +R ++  ++V
Sbjct: 549 SSFYEEDGLGDLVTYVWKLWVENSPLELVDEAMRGNFQTNEV 590



 Score = 48.1 bits (113), Expect(2) = 5e-57
 Identities = 20/45 (44%), Positives = 30/45 (66%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFV 176
           +RCIH+ALLCV +   +RP+M  ++ M+ +  V LP PK  GF +
Sbjct: 591 IRCIHIALLCVQEDSSERPSMDDILVMMNSFTVTLPIPKRSGFLL 635



>gb:AY534543_1612236 Raphanus sativus haplotype S31 S-locus receptor
           kinase gene, partial cds.
          Length = 290

 Score =  185 bits (469), Expect(2) = 5e-57
 Identities = 86/156 (55%), Positives = 116/156 (74%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F ++     +W+ RF I  GI+RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 43  DSYLFGKTGKSKLSWKERFDITNGIARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   D+  A T +V+GTYGYMSPEYV+ G FS KSDVFS GVI+LE+++G++N
Sbjct: 103 SDFGMARIFARDETEANTMKVVGTYGYMSPEYVMHGTFSEKSDVFSFGVIVLEIVTGKRN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F++ D+ +NLL +AW+ W +    E++D  + DS
Sbjct: 163 RGFNNLDNENNLLSYAWVNWKEARALEIVDPVIVDS 198



 Score = 59.3 bits (142), Expect(2) = 5e-57
 Identities = 27/51 (52%), Positives = 36/51 (70%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE 158
           ++CI V LLCV +L E RPTM+SVV+ML +E   +P+PK PG+ V R   E
Sbjct: 212 IKCIQVGLLCVQELAEHRPTMSSVVWMLGSEATDIPQPKPPGYCVRRTPYE 262



>gb:AY534538_1612231 Raphanus sativus haplotype S22 S-locus receptor
           kinase gene, partial cds.
          Length = 290

 Score =  185 bits (469), Expect(2) = 5e-57
 Identities = 86/156 (55%), Positives = 113/156 (72%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +F E R     W+ RF I  G++RGLLYLHQDSRL+IIHRD+K SNILLD  + PKI
Sbjct: 43  DSHLFGEKRSSKLNWKDRFDITNGVARGLLYLHQDSRLRIIHRDVKVSNILLDKSMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+A I   ++  A T+ V+GTYGYMSPEY +DG FS KSDVFS GVI+LE++SG+++
Sbjct: 103 SDFGMAIIFAREETEANTRNVVGTYGYMSPEYALDGVFSEKSDVFSFGVIVLEIVSGKRS 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+  +H +NLL +AW  W +G   E++D  + DS
Sbjct: 163 RGFYSLNHENNLLSYAWSHWTEGKALEIVDPVITDS 198



 Score = 59.3 bits (142), Expect(2) = 5e-57
 Identities = 29/79 (36%), Positives = 46/79 (58%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + LLCV +  E RPTM+SVV+ML +E   +P+P  PG++V R   E + + +  C
Sbjct: 212 LKCIQIGLLCVQERAEHRPTMSSVVWMLGSEATEIPQPNPPGYYVGRCPYENNPSSRRLC 271

Query: 130 ----CYEIAMITFSTLEGR 86
                + +   T S ++ R
Sbjct: 272 DDYESWTVNQYTCSVIDAR 290



>pir|T05181|T05181 S-receptor kinase (EC 2.7.1.-) T6K22.120 precursor
            - Arabidopsis thaliana>gb:ATCHRIV55_1545976 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            55.>gb:ATT6K22_1556404 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T6K22 (ESSAII project).
          Length = 849

 Score =  190 bits (483), Expect(2) = 7e-57
 Identities = 90/154 (58%), Positives = 120/154 (77%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+FDE++  +  W+ RF I  GI+RGLLYLH+DSRL+IIHRDLK SN+LLDAE+NPKI
Sbjct: 611  DFFLFDETKQALIDWKLRFSIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDAEMNPKI 670

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEY ++G FSVKSDV+S GV+LLE++SG++N
Sbjct: 671  SDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIVSGKRN 730

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVR 336
             +   S+ H +L+G+AW L+  G   EL+D  +R
Sbjct: 731  TSLRSSE-HGSLIGYAWYLYTHGRSEELVDPKIR 763



 Score = 53.5 bits (127), Expect(2) = 7e-57
 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF-FVERNSTEAS 152
           LRCIHVA+LCV     +RP MASV+ MLE++   L  P++P F    RNS + +
Sbjct: 772 LRCIHVAMLCVQDSAAERPNMASVLLMLESDTATLAAPRQPTFTSTRRNSIDVN 825



>pir|T14450|T14450 serine/threonine kinase (EC 2.7.1.-) BRLK - wild
            cabbage>gb:BOBRLKGEN_1633746 B.oleraceae gene encoding
            serine/threonine kinase, BRLK.
          Length = 850

 Score =  189 bits (479), Expect(2) = 7e-57
 Identities = 90/154 (58%), Positives = 118/154 (76%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+FDE +  +  W+ RF I  GI+RGLLYLH+DSRL+IIHRDLK SN+LLD E+NPKI
Sbjct: 611  DFFIFDEMKQELVDWKLRFAIIEGIARGLLYLHRDSRLRIIHRDLKVSNVLLDGEMNPKI 670

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEY ++G FSVKSDV+S GV+LLE+ISG++N
Sbjct: 671  SDFGMARIFGGNQNEANTVRVVGTYGYMSPEYAMEGLFSVKSDVYSFGVLLLEIISGKRN 730

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVR 336
             +   S+ H +L+G+AW L+  G   EL+D  +R
Sbjct: 731  TSLRASE-HGSLIGYAWFLYTHGRSEELVDPKIR 763



 Score = 55.1 bits (131), Expect(2) = 7e-57
 Identities = 27/56 (48%), Positives = 36/56 (64%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           LRCIHVA+LCV     +RP MA+V+ MLE++   LP P++P F     ST  +S D
Sbjct: 772 LRCIHVAMLCVQDSAAERPNMAAVLLMLESDTATLPVPRQPTF---TTSTRRNSMD 824



>gb:AY303171_1597401 Solanum bulbocastanum chromosome 8 clone
           177O13, complete sequence.
          Length = 711

 Score =  185 bits (470), Expect(2) = 1e-56
 Identities = 85/161 (52%), Positives = 119/161 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  R  +  WQ RF I  GI++GLLYLH+ SR+++IHRDLK SN+LLD  +NPKI
Sbjct: 475 DFFLFDPERKKLLDWQKRFEIIEGIAQGLLYLHKYSRMRVIHRDLKASNVLLDENMNPKI 534

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLARI ++++  A T+RV+GTYGYM+PE+ ++G FS+KSDVFS GV++LE++SGR+N
Sbjct: 535 ADFGLARIFKQNETEAVTRRVVGTYGYMAPEFAMEGAFSIKSDVFSFGVLMLEILSGRRN 594

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
            +    +   NL+G+AW LW +G   EL D  + D Y   Q
Sbjct: 595 ASLQQFNRPLNLIGYAWELWKEGCGLELKDPDLEDLYDTEQ 635



 Score = 57.8 bits (138), Expect(2) = 1e-56
 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 2/70 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE--ASSTDKE 137
           LR IHV LLCV +   DRPTM+ V+ ML N  ++LP  K+P FF  R+  E  +SS   E
Sbjct: 637 LRVIHVGLLCVQEGATDRPTMSDVISMLCNGSMSLPIAKQPAFFTGRDEIESYSSSNKTE 696

Query: 136 RCCYEIAMIT 107
           +C      IT
Sbjct: 697 QCSINDCSIT 706



>pir|T14471|T14471 probable S-receptor kinase (EC 2.7.1.-) srk29 -
            wild cabbage>gb:BOSRK29G_1633895 B.oleracea (alboglabra)
            srk29 gene.
          Length = 857

 Score =  183 bits (464), Expect(2) = 2e-56
 Identities = 84/156 (53%), Positives = 114/156 (73%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F ++R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 610  DSYLFGKTRSSKLNWKERFEITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 669

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   ++  A T +V+GTYGYMSPEY + G FS KSDVFS GVI+LE+++G++N
Sbjct: 670  SDFGMARIFAREETEANTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTGKRN 729

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F++ ++  NLL +AW  W +G   E++D  + DS
Sbjct: 730  RVFYNLNYEDNLLNYAWNNWKEGRALEIVDPAILDS 765



 Score = 59.3 bits (142), Expect(2) = 2e-56
 Identities = 28/60 (46%), Positives = 43/60 (71%), Gaps = 1/60 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS-STDKER 134
           L+CI + LLCV  L E+RPTM+SVV+ML +E   +P+PK PG+ + R+  E   S++++R
Sbjct: 779 LKCIQIGLLCVQDLAENRPTMSSVVWMLGSEATEIPQPKPPGYCLVRSPYEPDPSSNRQR 838



>gb:AY534536_1612229 Raphanus sativus haplotype S18 S-locus receptor
           kinase gene, partial cds.
          Length = 290

 Score =  187 bits (474), Expect(2) = 2e-56
 Identities = 86/156 (55%), Positives = 117/156 (75%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F ++R    +W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 43  DSFLFGKTRSSKLSWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI E D+  A T +V+GTYGYMSPEY ++G FS KSDVFS GVI+LE+++G++N
Sbjct: 103 SDFGMARIFERDETEASTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTGQRN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F++ ++ +N L +AW  W +G   E++D  + DS
Sbjct: 163 RGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIIDS 198



 Score = 55.5 bits (132), Expect(2) = 2e-56
 Identities = 25/51 (49%), Positives = 36/51 (70%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE 158
           L+ I + LLCV +  EDRPTM++VV+ML +EE  +P+P  PG+ V R+  E
Sbjct: 212 LKSIKIGLLCVQEHAEDRPTMSTVVWMLGSEETEIPQPNPPGYCVRRSPHE 262



>pir|H86246|H86246 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890135 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007259_1535685 Arabidopsis thaliana
            chromosome I BAC T28P6 genomic sequence, complete
            sequence.
          Length = 820

 Score =  182 bits (462), Expect(2) = 3e-56
 Identities = 94/168 (55%), Positives = 116/168 (69%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DY++FD  R  +  W+TRF I  GI RGLLYLH+DSRL+IIHRDLK SNILLD  L PKI
Sbjct: 591  DYYLFDSRRAKLLDWKTRFNIINGICRGLLYLHRDSRLRIIHRDLKASNILLDENLIPKI 650

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLARI   ++  A T+RV+GTYGYM+PEY + G FS KSDVFSLGVILLE+ISGR+N
Sbjct: 651  SDFGLARIFPGNEDEANTRRVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIISGRRN 710

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSC 294
                    +  LL + W +WN+G    L+D  + D   E ++   H C
Sbjct: 711  -------SNSTLLAYVWSIWNEGEINSLVDPEIFDLLFEKEI---HKC 748



 Score = 59.7 bits (143), Expect(2) = 3e-56
 Identities = 27/74 (36%), Positives = 43/74 (58%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           +CIH+ LLCV +   DRP++++V  ML +E   +P+PK+P F    N  EA S++     
Sbjct: 747 KCIHIGLLCVQEAANDRPSVSTVCSMLSSEIADIPEPKQPAFISRNNVPEAESSENSDLK 806

Query: 127 YEIAMITFSTLEGR 86
             I  +T + + GR
Sbjct: 807 DSINNVTITDVTGR 820



>gb:STU306626_1723037 Solanum tuberosum mRNA for putative
           receptor-like serine-threonine protein kinase (prk-1
           gene).
          Length = 676

 Score =  184 bits (466), Expect(2) = 3e-56
 Identities = 83/156 (53%), Positives = 115/156 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  +     W+ R  I  GI++G+LYLH+DSRL+IIHRDLK SN+LLDAE+NPKI
Sbjct: 424 DHFLFDSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKI 483

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+AR+ E D+    T R++GTYGYM+PEY + G FSVKSDVFS GV++LE++SG+KN
Sbjct: 484 SDFGMARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEILSGQKN 543

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             F + +   +LL  AWL W +G   + +D  +++S
Sbjct: 544 TCFRNGESVEDLLSFAWLSWRNGTTIDFVDPMLKES 579



 Score = 58.2 bits (139), Expect(2) = 3e-56
 Identities = 28/58 (48%), Positives = 38/58 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKE 137
           +R IH+ALLCV +   DRPTMA+VV ML +  ++LP P  P F++  N T  +S  KE
Sbjct: 587 MRNIHIALLCVQESVADRPTMAAVVLMLSSFSLSLPMPSGPAFYMHSNITAETSLIKE 644



>gb:AP004401_1841245 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0534A03.>gb:AP005126_1848235 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBb0041B22.
          Length = 865

 Score =  191 bits (485), Expect(2) = 4e-56
 Identities = 86/154 (55%), Positives = 116/154 (75%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD  R G+  W+TRF I  G++RGLLYLH+DSRL+++HRDLK SNILLD ++NPKI
Sbjct: 626  DAFLFDPERRGLLDWRTRFQIIEGVARGLLYLHRDSRLRVVHRDLKASNILLDRDMNPKI 685

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D     T RV+GT GYMSPEY ++G FSV+SDV+S G+++LE+I+G+KN
Sbjct: 686  SDFGMARIFGGDQNQVNTNRVVGTLGYMSPEYAMEGLFSVRSDVYSFGILILEIITGQKN 745

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVR 336
             +FH  +   N++G+AW LWN     EL+D  +R
Sbjct: 746  SSFHHMEGSLNIVGYAWQLWNGDRGQELIDPAIR 779



 Score = 50.1 bits (118), Expect(2) = 4e-56
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS----TD 143
            LRC+H+ALLCV     DRP +  VV  L ++   LP P+ P F ++  S+ +       D
Sbjct: 788  LRCVHMALLCVQDHAHDRPDIPYVVLTLGSDSSVLPTPRPPTFTLQCTSSSSGRDMYYRD 847

Query: 142  KERCCYEIAMITFSTLEGR 86
            KE   Y    +T + L+GR
Sbjct: 848  KEE-SYSANDLTVTMLQGR 865



>pir|T02053|T02053 S-receptor kinase (EC 2.7.1.-) KIK1 precursor -
            maize>gb:ZMU82481_1732238 Zea mays KI domain interacting
            kinase 1 (KIK1) mRNA, complete cds.
          Length = 848

 Score =  179 bits (454), Expect(2) = 4e-56
 Identities = 84/162 (51%), Positives = 116/162 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+F+  +  +  W+ RF I  GI+RGLLYLH+DSRL+++HRDLK SNILLDA++ PKI
Sbjct: 612  DAFLFNPEKQRLLDWKKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDADMKPKI 671

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+AR+   D     T RV+GT+GYMSPEY ++G FSVKSDV+  GV++LE+I+G++ 
Sbjct: 672  SDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDVYGFGVLILEIITGKRA 731

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             +FH  +   N+ G+AW  WN+ N  EL+D  +R S    QV
Sbjct: 732  VSFHCHEDSLNIAGYAWRQWNEDNAAELIDPVIRASCSVRQV 773



 Score = 62.0 bits (149), Expect(2) = 4e-56
 Identities = 27/75 (36%), Positives = 44/75 (58%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LRCIH+ALLCV    ++RP + +V+ ML N+  +LP P+ P   +     E+S + ++  
Sbjct: 774 LRCIHIALLCVQDHADERPDIPTVILMLSNDSSSLPNPRPPTLMLRGREIESSKSSEKDR 833

Query: 130 CYEIAMITFSTLEGR 86
            + I  +T + L GR
Sbjct: 834 SHSIGTVTMTQLHGR 848



>pir|T10567|T10567 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F25E4.90 - Arabidopsis
           thaliana>gb:ATCHRIV32_1544912 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 32.>gb:ATF25E4_1549984
           Arabidopsis thaliana DNA chromosome 4, BAC clone F25E4
           (ESSA project).
          Length = 666

 Score =  183 bits (465), Expect(2) = 4e-56
 Identities = 86/163 (52%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD        W+ R+ I  G++RGLLYLHQDSRL IIHRD+K SNILLDA++NPKI
Sbjct: 421 DYFLFDPKMKSQLDWKRRYNIIGGVTRGLLYLHQDSRLTIIHRDIKASNILLDADMNPKI 480

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+AR    D    +T RV+GT+GYM PEYV  G FS KSDV+S GV++LE++ G+KN
Sbjct: 481 ADFGMARNFRVDQTEDQTGRVVGTFGYMPPEYVTHGQFSTKSDVYSFGVLILEIVCGKKN 540

Query: 437 RAFHD-SDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F    D   NL+ H W LWN+ +P +L+D  +++SY   +V
Sbjct: 541 SSFFQMDDSGGNLVTHVWRLWNNDSPLDLIDPAIKESYDNDEV 583



 Score = 57.8 bits (138), Expect(2) = 4e-56
 Identities = 22/44 (50%), Positives = 31/44 (70%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           +RCIH+ +LCV + P DRP M+++  ML N  + LP P+ PGFF
Sbjct: 584 IRCIHIGILCVQETPADRPEMSTIFQMLTNSSITLPVPRPPGFF 627



>gb:AE016959_1020856 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074283_1541321
           Oryza sativa chromosome 10 clone OSJNBa0087H07, complete
           sequence.>gb:AE017054_1750675 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 8 of 77 of the
           complete sequence.
          Length = 655

 Score =  181 bits (459), Expect(2) = 4e-56
 Identities = 91/173 (52%), Positives = 116/173 (67%), Gaps = 1/173 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FDE++  +  W  R  I  GI+ GLLYLH+ SRL +IHRDLK SNILLD+E+NPKI
Sbjct: 418 DLFIFDENKRALLDWYKRLEIIEGIAHGLLYLHKHSRLSVIHRDLKPSNILLDSEMNPKI 477

Query: 617 SDFGLARIVEEDDGLAKT-KRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRK 441
           SDFGLARI   ++    T +RV+GTYGYM+PEY   G FS+KSDVFS GV+ LE+ISG+K
Sbjct: 478 SDFGLARIFSSNNTEGNTTRRVVGTYGYMAPEYASVGLFSIKSDVFSFGVLFLEIISGKK 537

Query: 440 NRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSCSSSL 282
           N   H S    NLLG AW LW +G   EL+D  +   Y  ++   M   + +L
Sbjct: 538 NSGSHHSGDFINLLGFAWSLWGEGRWLELIDESLVSKYPPAENEIMRCINIAL 590



 Score = 60.1 bits (144), Expect(2) = 4e-56
 Identities = 31/75 (41%), Positives = 45/75 (60%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           +RCI++ALLCV +   DRPTM+ VV ML ++ + L +PK PG+F  R + E  S   E C
Sbjct: 583 MRCINIALLCVQENAADRPTMSDVVAMLSSKTMVLAEPKHPGYFNVRVANEEQSVLTEPC 642

Query: 130 CYEIAMITFSTLEGR 86
              +  +T S +  R
Sbjct: 643 --SVNDMTISAISAR 655



>gb:AY052583_1562779 Raphanus sativus haplotype S8 S-locus receptor
           kinase (SRK) gene, partial cds.
          Length = 289

 Score =  182 bits (463), Expect(2) = 6e-56
 Identities = 85/156 (54%), Positives = 114/156 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F ++R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 44  DSYLFGKTRRPKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 103

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   ++  A T  V+GTYGYMSPEY + G FS KSDVFS GVI+LE+++G++N
Sbjct: 104 SDFGMARIFAREETEANTMNVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTGKRN 163

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F++ ++ HNLL +AW  W +G   E++D  + DS
Sbjct: 164 RGFNNLNYEHNLLNYAWSNWKEGRAIEIVDPDIVDS 199



 Score = 58.2 bits (139), Expect(2) = 6e-56
 Identities = 30/79 (37%), Positives = 47/79 (59%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           ++CI + LLCV +  E RPTM+SVV+ML +E   +P+PK PG+ V R+S E   +   +C
Sbjct: 212 IKCIQIGLLCVQERAEHRPTMSSVVWMLGSEVTEIPQPKPPGYCV-RSSYELDPSSSRQC 270

Query: 130 ----CYEIAMITFSTLEGR 86
                + +   T S ++ R
Sbjct: 271 DDDQSWTVNQYTCSVIDAR 289



>pir|T47526|T47526 protein kinase-like - Arabidopsis
           thaliana>gb:ATF16L2_1548823 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F16L2.
          Length = 676

 Score =  181 bits (460), Expect(2) = 7e-56
 Identities = 87/165 (52%), Positives = 118/165 (71%), Gaps = 2/165 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD +   +  W  R+ I  GI+RG+LYLHQDSRL IIHRDLK  NILL  ++N KI
Sbjct: 433 DYFIFDSTMQSLLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLGDDMNAKI 492

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A T+R++GTYGYMSPEY + G FS+KSDV+S GV++LE+ISG+KN
Sbjct: 493 ADFGMARIFGMDQTEANTRRIVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGKKN 552

Query: 437 RAFH--DSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVA 309
              +  D     NL+ + W LW++G+P EL+D   RD+Y  ++V+
Sbjct: 553 SNVYQMDGTSAGNLVTYTWRLWSNGSPLELVDPSFRDNYRINEVS 597



 Score = 58.9 bits (141), Expect(2) = 7e-56
 Identities = 26/50 (52%), Positives = 34/50 (68%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE 158
           RCIH+ALLCV +  EDRPTM+++V ML    +AL  P+ PGFF   +  E
Sbjct: 598 RCIHIALLCVQEEAEDRPTMSAIVQMLTTSSIALAVPQRPGFFFRSSKHE 647



>gb:AB032473_1518696 Brassica oleracea SRK18 mRNA for S18 S-locus
            receptor kinase, complete cds.
          Length = 856

 Score =  184 bits (466), Expect(2) = 1e-55
 Identities = 84/156 (53%), Positives = 116/156 (74%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F ++R    +W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 609  DSYLFGKTRSSKLSWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T +V+GTYGYMSPEY ++G FS KSDVFS GVI+LE+++G++N
Sbjct: 669  SDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTGKRN 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F++ ++ +N L +AW  W +G   E++D  + DS
Sbjct: 729  RGFYNLNYKNNFLSYAWSNWKEGRALEIVDPVIVDS 764



 Score = 56.2 bits (134), Expect(2) = 1e-55
 Identities = 24/45 (53%), Positives = 34/45 (75%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFV 176
           L+CI + LLCV +L E RPTM++VV+ML +E   +P+PK PG+ V
Sbjct: 778 LKCIQIGLLCVQELAEHRPTMSTVVWMLGSEATEIPQPKPPGYCV 822



>pir|T04841|T04841 protein kinase homolog F21P8.130 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546161 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549626
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 352

 Score =  184 bits (466), Expect(2) = 1e-55
 Identities = 88/163 (53%), Positives = 119/163 (73%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD  R G   W+TR+ I  G++RG+LYLHQDSRL IIHRDLK  NILLD ++NPKI
Sbjct: 107 DYFLFDHRRRGQLDWRTRYNIIRGVTRGILYLHQDSRLTIIHRDLKAGNILLDVDMNPKI 166

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+AR    D   A T RV+GT+GYM PEYV +G FS+KSDV+S GV++LE+I G+K+
Sbjct: 167 ADFGVARNFRVDQTEATTGRVVGTFGYMPPEYVANGQFSMKSDVYSFGVLILEIIVGKKS 226

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +FH+ D    NL+ + W LWN+ +  EL+D  + +SY + +V
Sbjct: 227 SSFHEIDGSVGNLVTYVWRLWNNESFLELVDPAMGESYDKDEV 269



 Score = 56.2 bits (134), Expect(2) = 1e-55
 Identities = 32/78 (41%), Positives = 42/78 (53%), Gaps = 10/78 (12%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF----------FVERNST 161
           +RCIH++LLCV + P DRPTM++V  ML N  + LP P+ PGF            ER   
Sbjct: 270 IRCIHISLLCVQENPADRPTMSTVFQMLTNTFLTLPVPQLPGFVFRVRSEPNPLAERLEP 329

Query: 160 EASSTDKERCCYEIAMIT 107
             S+T    C  + A IT
Sbjct: 330 GPSTTMSFACSIDDASIT 347



>gb:AY052579_1562775 Raphanus sativus haplotype S1 S-locus receptor
           kinase (SRK) gene, partial cds.
          Length = 288

 Score =  181 bits (458), Expect(2) = 1e-55
 Identities = 83/156 (53%), Positives = 115/156 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F +++     W+ RF I +G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 44  DSYLFGKTQSPKLNWKERFDITSGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 103

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   D+  A T +V+GTYGYMSPEY ++G FS KSDVFS GVI+LE+++G +N
Sbjct: 104 SDFGMARIFARDETEASTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTGTRN 163

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F++ ++ +N L +AW  W +G   E++D  + DS
Sbjct: 164 RGFYNLNYKNNFLSYAWSNWREGRALEIVDPVILDS 199



 Score = 59.3 bits (142), Expect(2) = 1e-55
 Identities = 26/54 (48%), Positives = 39/54 (72%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS 149
           L+CI + LLCV +L EDRPTM++VV+ML +E   +P+PK P + V ++  E +S
Sbjct: 213 LKCIQIGLLCVQELAEDRPTMSTVVWMLGSEATEIPQPKPPDYCVGKSPYETAS 266



>pir|T04833|T04833 hypothetical protein F21P8.50 - Arabidopsis
            thaliana>gb:ATCHRIV58_1546153 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549618
            Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
            (ESSA project).
          Length = 1240

 Score =  181 bits (458), Expect(2) = 1e-55
 Identities = 86/162 (53%), Positives = 115/162 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD ++     W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 999  DCLLFDPTKQTQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKI 1058

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            +DFG+ARI   D     T R++GTYGYM+PEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 1059 ADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRKN 1118

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             +F +SD   +LL H W LW +    +L+D  + ++   S+V
Sbjct: 1119 SSFDESDGAQDLLTHTWRLWTNRTALDLVDPLIANNCQNSEV 1160



 Score = 58.9 bits (141), Expect(2) = 1e-55
 Identities = 27/63 (42%), Positives = 42/63 (66%)
 Frame = -1

Query: 322  NLK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
            N + +RCIH+ LLCV + P  RPT+++V  ML +  V LP P++PGFF++ +S     TD
Sbjct: 1157 NSEVVRCIHIGLLCVQEDPAKRPTISTVFMMLTSNTVTLPVPRQPGFFIQ-SSPVKDPTD 1215

Query: 142  KER 134
             ++
Sbjct: 1216 SDQ 1218



>gb:AP004401_1841247 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC
            clone:P0534A03.>gb:AP005126_1848237 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBb0041B22.
          Length = 853

 Score =  180 bits (456), Expect(2) = 1e-55
 Identities = 84/162 (51%), Positives = 115/162 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+F+  + G+  W+ RF I  GI+RGLLYLH+DSRL+++HRDLK SNILLD ++NPKI
Sbjct: 617  DAFLFNPEKQGLLDWRKRFDIIEGIARGLLYLHRDSRLRVVHRDLKASNILLDKDMNPKI 676

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+AR+   D     T RV+GT+GYMSPEY ++G FSVKSD++S GV++LE+I+G++ 
Sbjct: 677  SDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDIYSFGVLMLEIITGKRA 736

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             +FH      N+ G AW  WN+    EL+D  +R S    QV
Sbjct: 737  LSFHGQQDSLNIAGFAWRQWNEDKGEELIDPLIRASCSLRQV 778



 Score = 59.7 bits (143), Expect(2) = 1e-55
 Identities = 26/75 (34%), Positives = 44/75 (58%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
            LRCIH+ALLCV    ++RP + +V+ ML ++  +LP P+ P   +   S E S + ++  
Sbjct: 779  LRCIHIALLCVQDHAQERPDIPAVILMLSSDSSSLPMPRPPTLMLHGRSAETSKSSEKDQ 838

Query: 130  CYEIAMITFSTLEGR 86
             + I  ++ + L GR
Sbjct: 839  SHSIGTVSMTQLHGR 853



>gb:AF078082_1766256 Phaseolus vulgaris receptor-like protein kinase
           homolog RK20-1 mRNA, complete cds.
          Length = 666

 Score =  184 bits (467), Expect(2) = 1e-55
 Identities = 85/166 (51%), Positives = 116/166 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD  +     W+ R+ I  GI+RGLLYLH+DS L+IIHRDLK SNILLD E+NPKI
Sbjct: 421 DYFIFDPVKKAQLDWEMRYKIIRGIARGLLYLHEDSLLRIIHRDLKASNILLDEEMNPKI 480

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+AR+V  D+  A T RV+GTYGYM+PEY++ G FSVKSD+FS GV+LLE++SG+KN
Sbjct: 481 ADFGMARLVLLDETHANTNRVVGTYGYMAPEYIMQGQFSVKSDIFSFGVLLLEIVSGQKN 540

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMH 300
             F   ++  +LL   W  W DG    ++D  + ++     +  +H
Sbjct: 541 SGFRHGENVEDLLSFTWRNWRDGTAVNIVDPSLENNSRNEVMRCIH 586



 Score = 55.5 bits (132), Expect(2) = 1e-55
 Identities = 26/53 (49%), Positives = 35/53 (66%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS 152
           +RCIH+ LLCV +   DRPTMA+++ ML +  + LP P EP F+   NST  S
Sbjct: 582 MRCIHIGLLCVQENLTDRPTMATIMLMLSSYSLGLPIPSEPAFYA--NSTARS 632



>pir|T04839|T04839 protein kinase homolog F21P8.110 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546159 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549624
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 900

 Score =  182 bits (462), Expect(2) = 2e-55
 Identities = 89/163 (54%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 493 DYFLFDPTKQGQLDWTKRYNIIRGITRGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 552

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A TK++ GT GYM PEYV  G FS +SDV+S GV++LE+I GR N
Sbjct: 553 ADFGMARIFGIDQSGANTKKIAGTRGYMPPEYVRQGQFSTRSDVYSFGVLVLEIICGRNN 612

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
           R  H SD    NL+ +AW LW + +P EL+D  + ++    +V
Sbjct: 613 RFIHQSDTTVENLVTYAWRLWRNDSPLELVDPTISENCETEEV 655



 Score = 82.8 bits (203), Expect = 7e-15
 Identities = 35/67 (52%), Positives = 51/67 (76%)
 Frame = -3

Query: 584 DDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHN 405
           D     T R++GT+GYM+PEY + G FSVKSDV+S GV++LE+ISG+KN +F+++D  H+
Sbjct: 2   DQTQENTSRIVGTFGYMAPEYAIHGQFSVKSDVYSFGVLVLEIISGKKNNSFYETDGAHD 61

Query: 404 LLGHAWL 384
           L+ H  L
Sbjct: 62  LVTHVSL 68



 Score = 56.6 bits (135), Expect(2) = 2e-55
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           RCIH+ALLCV   P DRP+++++  ML N    LP P++PGFF
Sbjct: 657 RCIHIALLCVQHNPTDRPSLSTINMMLINNSYVLPDPQQPGFF 699



>pir|T04832|T04832 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.40 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546152 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549617
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 678

 Score =  184 bits (466), Expect(2) = 2e-55
 Identities = 91/172 (52%), Positives = 120/172 (69%), Gaps = 10/172 (5%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD ++ G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 427 DNFLFDPAKKGQLYWTQRYHIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 486

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYMSPEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 487 ADFGMARIFGMDQTQQNTSRIVGTYGYMSPEYAMRGQFSMKSDVYSFGVLVLEIISGRKN 546

Query: 437 RAFHDSDHHHNLLGH----------AWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F ++D   +L+ H          AW LW +G   +L+D  + DS  +S+V
Sbjct: 547 NSFIETDDAQDLVTHVSLKERSYIYAWRLWRNGTALDLVDPFIADSCRKSEV 598



 Score = 55.1 bits (131), Expect(2) = 2e-55
 Identities = 26/63 (41%), Positives = 40/63 (63%), Gaps = 6/63 (9%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFV------ERNSTEASS 149
           +RC H+ LLCV + P  RP M+++  ML +  +ALP P++PGFFV       R  ++ S+
Sbjct: 599 VRCTHIGLLCVQEDPVKRPAMSTISVMLTSNTMALPAPQQPGFFVRSRPGTNRLDSDQST 658

Query: 148 TDK 140
           T+K
Sbjct: 659 TNK 661



>gb:AY090250_1574003 Arabidopsis thaliana AT4g23250/F21P8_140 mRNA,
           complete cds.>gb:BT001060_1635315 Arabidopsis thaliana
           At4g23250/F21P8_140 mRNA, complete cds.
          Length = 579

 Score =  184 bits (466), Expect(2) = 2e-55
 Identities = 89/163 (54%), Positives = 118/163 (72%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++     W  R  I  GI+RG+LYLHQDSRLKIIHRDLK SNILLDA++NPKI
Sbjct: 341 DYFLFDPTKRNQLDWTMRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKI 400

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D  +A T RV+GT+GYMSPEYV  G FS+KSDV+S GV++LE+ISG+KN
Sbjct: 401 ADFGMARIFGVDQTVANTGRVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKN 460

Query: 437 RAFHDSDH-HHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F+  D   +NL+ + W LW + +  EL+D  +   +   +V
Sbjct: 461 SSFYQMDGLVNNLVTYVWKLWENKSLHELLDPFINQDFTSEEV 503



 Score = 55.1 bits (131), Expect(2) = 2e-55
 Identities = 27/63 (42%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER--NSTEASSTDKE 137
           +R IH+ LLCV + P DRPTM+++  ML N  + LP P  PGFF      S    S  K 
Sbjct: 504 IRYIHIGLLCVQENPADRPTMSTIHQMLTNSSITLPVPLPPGFFFRNGPGSNPGQSNSKS 563

Query: 136 RCC 128
             C
Sbjct: 564 FAC 566



>gb:BT000052_1634330 Arabidopsis thaliana serine/threonine kinase -
           like protein (At4g23220) mRNA, complete cds.
          Length = 467

 Score =  182 bits (462), Expect(2) = 2e-55
 Identities = 89/163 (54%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++ G   W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 227 DYFLFDPTKQGQLDWTKRYNIIRGITRGILYLHQDSRLTIIHRDLKASNILLDADMNPKI 286

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A TK++ GT GYM PEYV  G FS +SDV+S GV++LE+I GR N
Sbjct: 287 ADFGMARIFGIDQSGANTKKIAGTRGYMPPEYVRQGQFSTRSDVYSFGVLVLEIICGRNN 346

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
           R  H SD    NL+ +AW LW + +P EL+D  + ++    +V
Sbjct: 347 RFIHQSDTTVENLVTYAWRLWRNDSPLELVDPTISENCETEEV 389



 Score = 56.6 bits (135), Expect(2) = 2e-55
 Identities = 23/43 (53%), Positives = 31/43 (72%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           RCIH+ALLCV   P DRP+++++  ML N    LP P++PGFF
Sbjct: 391 RCIHIALLCVQHNPTDRPSLSTINMMLINNSYVLPDPQQPGFF 433



>pir|A86247|A86247 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890136 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007259_1535684 Arabidopsis thaliana
            chromosome I BAC T28P6 genomic sequence, complete
            sequence.
          Length = 820

 Score =  182 bits (462), Expect(2) = 3e-55
 Identities = 91/162 (56%), Positives = 112/162 (69%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+++FD     +  W TRF I  GI RGLLYLH+DSRL+IIHRDLK SNILLD  L PKI
Sbjct: 591  DFYIFDPREAKLLDWNTRFEIINGICRGLLYLHRDSRLRIIHRDLKASNILLDENLIPKI 650

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLARI   ++  A T+RV+GTYGYM+PEY + G FS KSDVFSLGVILLE+ISGR+N
Sbjct: 651  SDFGLARIFPGNEDEANTRRVVGTYGYMAPEYAMGGLFSEKSDVFSLGVILLEIISGRRN 710

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                    H  LL H W +WN+G    ++D  + D   E ++
Sbjct: 711  -------SHSTLLAHVWSIWNEGEINGMVDPEIFDQLFEKEI 745



 Score = 56.2 bits (134), Expect(2) = 3e-55
 Identities = 25/74 (33%), Positives = 41/74 (55%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           +C+H+ALLCV     DRP++++V  ML +E   +P+PK+P F       EA  ++     
Sbjct: 747 KCVHIALLCVQDAANDRPSVSTVCMMLSSEVADIPEPKQPAFMPRNVGLEAEFSESIALK 806

Query: 127 YEIAMITFSTLEGR 86
             I  +T + + GR
Sbjct: 807 ASINNVTITDVSGR 820



>gb:AB013720_1512253 Brassica oleracea mRNA for SRK23Bol, partial cds.
          Length = 846

 Score =  181 bits (460), Expect(2) = 4e-55
 Identities = 84/156 (53%), Positives = 113/156 (72%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F   R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 599  DSYIFGNPRSTKLNWKERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 658

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T +V+GTYGYMSPEY + G FS KSDVFS GVI+LE+++G++N
Sbjct: 659  SDFGMARIFARDETEANTMKVVGTYGYMSPEYAMGGIFSEKSDVFSFGVIVLEIVTGKRN 718

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F++  + ++LL +AW  W +G   E++D+ + DS
Sbjct: 719  RGFYNLSYEYSLLSYAWSNWKEGRALEIVDSVLVDS 754



 Score = 56.6 bits (135), Expect(2) = 4e-55
 Identities = 27/51 (52%), Positives = 35/51 (68%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE 158
           L+CI + LLCV +L E RPTM+SVV+ML +E   +P PK PG  V R+  E
Sbjct: 768 LKCIQIGLLCVQELAEHRPTMSSVVWMLGSEATEIPHPKPPGNCVGRSPYE 818



>pir|S31429|S31429 S-receptor kinase (EC 2.7.1.-) precursor - wild
            cabbage>gb:BOSRKL_1633897 B.oleracea gene for S-receptor
            kinase-like protein.
          Length = 857

 Score =  185 bits (469), Expect(2) = 5e-55
 Identities = 85/157 (54%), Positives = 113/157 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRD+K SNILLD  + PKI
Sbjct: 610  DYFLFGKKRSSNLNWKDRFAIINGVARGLLYLHQDSRFRIIHRDMKPSNILLDKYMIPKI 669

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T+  +GTYGYMSPEY +DG  S K+DVFS GVI+LE++SG++N
Sbjct: 670  SDFGMARIFARDETEANTENAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRN 729

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
            R F+  +  +NLL +AW  W +G   E++D  + DS+
Sbjct: 730  RGFYQLNPENNLLSYAWSHWAEGRALEIVDPVIVDSF 766



 Score = 52.8 bits (125), Expect(2) = 5e-55
 Identities = 22/41 (53%), Positives = 31/41 (75%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           L+CI + LLC+ +  EDRPTM+SVV+ML +E   +P+PK P
Sbjct: 779 LKCIQIGLLCIQERAEDRPTMSSVVWMLGSEATDIPQPKPP 819



>pir|T14472|T14472 S-receptor kinase (EC 2.7.1.-) - wild
            cabbage>gb:BOSRK3_1633896 B.oleracea SRK3 gene.
          Length = 850

 Score =  176 bits (446), Expect(2) = 5e-55
 Identities = 82/156 (52%), Positives = 112/156 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+F ++R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 607  DSFLFGKTRRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 666

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+AR+   ++  A T +V+GTYGYMSPEY + G FS KSDVFS GVI+LE+++G++N
Sbjct: 667  SDFGMARMFAREETEASTMKVVGTYGYMSPEYAMHGIFSEKSDVFSFGVIVLEIVTGKRN 726

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
              F++ ++  +LL +AW  W +G   E++D    DS
Sbjct: 727  SGFNNLNYEDHLLNYAWSHWKEGKALEIVDPVTVDS 762



 Score = 61.6 bits (148), Expect(2) = 5e-55
 Identities = 31/78 (39%), Positives = 49/78 (62%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE---ASSTDK 140
            L+CI + LLCV +L E+RPTM+SVV+ML +E   +P+PK PG+ + R+  E   +SS   
Sbjct: 773  LKCIQIGLLCVQELAENRPTMSSVVWMLGSEATEIPQPKPPGYCIRRSPYELDPSSSRQY 832

Query: 139  ERCCYEIAMITFSTLEGR 86
            +   + +   T S ++ R
Sbjct: 833  DNDEWTVNQYTCSFIDAR 850



>gb:AF224706_1778585 Arabidopsis thaliana receptor-like protein
           kinase 5 (RLK5) mRNA, complete cds.
          Length = 674

 Score =  181 bits (460), Expect(2) = 5e-55
 Identities = 87/162 (53%), Positives = 116/162 (71%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD ++     W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 433 DCLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKI 492

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYM+PEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 493 ADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRKN 552

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F +SD   +LL HAW LW +    +L+D  + ++   S+V
Sbjct: 553 SSFGESDGAQDLLTHAWRLWTNKKALDLVDPLIAENCQNSEV 594



 Score = 56.2 bits (134), Expect(2) = 5e-55
 Identities = 23/50 (46%), Positives = 35/50 (70%)
 Frame = -1

Query: 322 NLK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
           N + +RCIH+ LLCV + P  RP +++V  ML +  V LP P++PGFF++
Sbjct: 591 NSEVVRCIHIGLLCVQEDPAKRPAISTVFMMLTSNTVTLPVPRQPGFFIQ 640



>gb:STU306629_1723040 Solanum tuberosum mRNA for putative
           receptor-like serine-threonine protein kinase (prk-4
           gene).
          Length = 676

 Score =  181 bits (458), Expect(2) = 5e-55
 Identities = 82/156 (52%), Positives = 113/156 (72%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  +     W+ R  I  GI++G+LYLH+DSRL+IIHRDLK SN+LLDAE+NPKI
Sbjct: 424 DHFLFDSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKI 483

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+AR+ E D+    T R++GTYGYM+PEY + G FSVKSDVFS GV++LE++SG+KN
Sbjct: 484 SDFGMARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEILSGQKN 543

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             F + +   +LL  AW  W +G     +D  +++S
Sbjct: 544 TCFRNGESVEDLLSFAWSSWRNGTTINFVDPMLKES 579



 Score = 57.0 bits (136), Expect(2) = 5e-55
 Identities = 27/58 (46%), Positives = 38/58 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKE 137
           +R IH+ALLCV +   DRPTMA+VV ML +  ++LP P  P F++  N T  +S  +E
Sbjct: 587 MRNIHIALLCVQESVADRPTMAAVVLMLSSFSLSLPMPSGPAFYMHSNITAGTSLIQE 644



>gb:STU306627_1723038 Solanum tuberosum mRNA for putative
           receptor-like serine-threonine protein kinase (prk-2
           gene).
          Length = 676

 Score =  181 bits (458), Expect(2) = 5e-55
 Identities = 82/156 (52%), Positives = 113/156 (72%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  +     W+ R  I  GI++G+LYLH+DSRL+IIHRDLK SN+LLDAE+NPKI
Sbjct: 424 DHFLFDSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKI 483

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+AR+ E D+    T R++GTYGYM+PEY + G FSVKSDVFS GV++LE++SG+KN
Sbjct: 484 SDFGMARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEILSGQKN 543

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             F + +   +LL  AW  W +G     +D  +++S
Sbjct: 544 TCFRNGESVEDLLSFAWSSWRNGTTINFVDPMLKES 579



 Score = 57.0 bits (136), Expect(2) = 5e-55
 Identities = 27/58 (46%), Positives = 38/58 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKE 137
           +R IH+ALLCV +   DRPTMA+VV ML +  ++LP P  P F++  N T  +S  +E
Sbjct: 587 MRNIHIALLCVQESVADRPTMAAVVLMLSSFSLSLPMPSGPAFYMHSNITAGTSLIQE 644



>pir|T04831|T04831 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.30 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546151 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549616
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).>gb:ATF7H19_1550957 Arabidopsis thaliana
           DNA chromosome 4, BAC clone F7H19 (ESSA project).
          Length = 658

 Score =  181 bits (460), Expect(2) = 5e-55
 Identities = 87/162 (53%), Positives = 116/162 (71%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD ++     W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 417 DCLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKI 476

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D     T R++GTYGYM+PEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 477 ADFGMARIFGLDQTQDNTSRIVGTYGYMAPEYAMHGQFSMKSDVYSFGVLVLEIISGRKN 536

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F +SD   +LL HAW LW +    +L+D  + ++   S+V
Sbjct: 537 SSFGESDGAQDLLTHAWRLWTNKKALDLVDPLIAENCQNSEV 578



 Score = 56.2 bits (134), Expect(2) = 5e-55
 Identities = 23/50 (46%), Positives = 35/50 (70%)
 Frame = -1

Query: 322 NLK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
           N + +RCIH+ LLCV + P  RP +++V  ML +  V LP P++PGFF++
Sbjct: 575 NSEVVRCIHIGLLCVQEDPAKRPAISTVFMMLTSNTVTLPVPRQPGFFIQ 624



>gb:STU306628_1723039 Solanum tuberosum mRNA for putative
           receptor-like serine-threonine protein kinase (prk-3
           gene).
          Length = 651

 Score =  181 bits (458), Expect(2) = 5e-55
 Identities = 82/156 (52%), Positives = 113/156 (72%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  +     W+ R  I  GI++G+LYLH+DSRL+IIHRDLK SN+LLDAE+NPKI
Sbjct: 399 DHFLFDSVKRRQLDWERRSKIIGGIAKGILYLHEDSRLRIIHRDLKASNVLLDAEMNPKI 458

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+AR+ E D+    T R++GTYGYM+PEY + G FSVKSDVFS GV++LE++SG+KN
Sbjct: 459 SDFGMARLFELDETQGSTNRIVGTYGYMAPEYAMHGQFSVKSDVFSFGVLVLEILSGQKN 518

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             F + +   +LL  AW  W +G     +D  +++S
Sbjct: 519 TCFRNGESVEDLLSFAWSSWRNGTTINFVDPMLKES 554



 Score = 57.0 bits (136), Expect(2) = 5e-55
 Identities = 27/58 (46%), Positives = 38/58 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKE 137
           +R IH+ALLCV +   DRPTMA+VV ML +  ++LP P  P F++  N T  +S  +E
Sbjct: 562 MRNIHIALLCVQESVADRPTMAAVVLMLSSFSLSLPMPSGPAFYMHSNITAGTSLIQE 619



>gb:AY099582_1576608 Arabidopsis thaliana serine/threonine
           kinase-like protein (At4g23290) mRNA, complete
           cds.>gb:BT000241_1634519 Arabidopsis thaliana
           serine/threonine kinase-like protein (At4g23290) mRNA,
           complete cds.
          Length = 600

 Score =  178 bits (451), Expect(2) = 5e-55
 Identities = 89/163 (54%), Positives = 115/163 (70%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  +     W  R  I  GI+RG+LYLHQDSRL IIHRDLK SNILLDAE+NPKI
Sbjct: 355 DHFLFDPIKRVQLDWPRRHNIIEGITRGILYLHQDSRLTIIHRDLKASNILLDAEMNPKI 414

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLAR    +   A T RV+GT+GYM PEYV +G FS KSDV+S GV++LE+I G+KN
Sbjct: 415 ADFGLARNFRVNQTEANTGRVVGTFGYMPPEYVANGQFSTKSDVYSFGVLILEIIGGKKN 474

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +FH  D    NL+ H W L N+G+  EL+D  + ++Y + +V
Sbjct: 475 SSFHQIDGSVSNLVTHVWRLRNNGSLLELVDPAIGENYDKDEV 517



 Score = 59.7 bits (143), Expect(2) = 5e-55
 Identities = 24/49 (48%), Positives = 34/49 (69%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNS 164
           +RCIH+ LLCV + P+DRP+M+++  ML N  + LP P+ PGFF    S
Sbjct: 518 IRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGFFFRERS 566



>gb:AP003983_1835897 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1038_A06.>gb:AP004161_1838418 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1311_H06.
          Length = 426

 Score =  178 bits (452), Expect(2) = 5e-55
 Identities = 84/161 (52%), Positives = 114/161 (70%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +     W+TR  I  GI+RGLLYLH+DS LK+IHRDLK SN+LLD ++NPKI
Sbjct: 183 DAFLFDSRKRAQLDWKTRQSIILGIARGLLYLHEDSCLKVIHRDLKASNVLLDNKMNPKI 242

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+A+I EE+     T  V+GTYGYM+PEY ++G FSVKSDVFSLGV++LE++SG++N
Sbjct: 243 SDFGMAKIFEEESNEVNTGHVVGTYGYMAPEYAMEGVFSVKSDVFSLGVLVLEILSGQRN 302

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
            A +  ++   L+  AW LWN+    E MD  +   Y + +
Sbjct: 303 GAMYLQNNQQTLIQDAWKLWNEDKAAEFMDASLAGDYSKEE 343



 Score = 59.3 bits (142), Expect(2) = 5e-55
 Identities = 29/70 (41%), Positives = 45/70 (64%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC HV LLCV + PE RPTM++VV ML ++++ LP+P +P  F  R   + S+++     
Sbjct: 346 RCFHVGLLCVQESPELRPTMSNVVLMLISDQMQLPEPAQPPLFAAREMKKVSASE----- 400

Query: 127 YEIAMITFST 98
           + +AM T +T
Sbjct: 401 FSLAMKTETT 410



>gb:OSJN00019_1693373 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 838

 Score =  175 bits (443), Expect(2) = 6e-55
 Identities = 89/160 (55%), Positives = 112/160 (70%)
 Frame = -3

Query: 791  FVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISD 612
            F+FD +      W TRF I  G++RGLLYLHQDSRL IIHRDLK+SNILLD +++PKISD
Sbjct: 607  FIFDPASKYALDWPTRFKIIKGVARGLLYLHQDSRLTIIHRDLKSSNILLDVDMSPKISD 666

Query: 611  FGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRA 432
            FG+ARI   +   A T RV+GTYGYMSPEY +DG FSVKSD +S GVILLE++SG K   
Sbjct: 667  FGMARIFGGNQQEANTNRVVGTYGYMSPEYAMDGAFSVKSDTYSYGVILLEIVSGLKISL 726

Query: 431  FHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                D   NLL +AW LW D    +L+D+ + +S  + +V
Sbjct: 727  PRLMD-FPNLLAYAWSLWKDDKAMDLVDSSIAESCSKMEV 765



 Score = 62.4 bits (150), Expect(2) = 6e-55
 Identities = 29/49 (59%), Positives = 34/49 (69%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNS 164
           L CIH+ LLCV   P +RP M+SVVFMLENE  ALP P +P +F  R S
Sbjct: 766 LLCIHIGLLCVQDNPNNRPPMSSVVFMLENEAAALPAPIQPVYFAHRAS 814



>gb:AF084035_1767052 Arabidopsis thaliana receptor-like protein kinase
            (RKS1) gene, complete cds.
          Length = 829

 Score =  186 bits (471), Expect(2) = 6e-55
 Identities = 89/163 (54%), Positives = 120/163 (73%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F E +     W  R  I  GI+RG+LYLHQDSRL+IIHRDLK SNILLD+E+ PKI
Sbjct: 593  DYFIFHEEQRAELDWPKRMEIVRGIARGILYLHQDSRLRIIHRDLKASNILLDSEMIPKI 652

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +     T RV+GT+GYM+PEY ++G FS+KSDV+S GV++LE+I+G+KN
Sbjct: 653  SDFGMARIFGGNQMEGCTSRVVGTFGYMAPEYAMEGQFSIKSDVYSFGVLMLEIITGKKN 712

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCV-RDSYVESQV 312
             AFH+     NL+GH W LW +G   E++DN + +++Y E +V
Sbjct: 713  SAFHEES--SNLVGHIWDLWENGEATEIIDNLMDQETYDEREV 753



 Score = 51.6 bits (122), Expect(2) = 6e-55
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF-FVERNSTEASSTDKER 134
           ++CI + LLCV +   DR  M+SVV ML +    LP PK P F    R   E  +  K +
Sbjct: 754 MKCIQIGLLCVQENASDRVDMSSVVIMLGHNATNLPNPKHPAFTSARRRGGENGACLKGQ 813

Query: 133 CCYEIAMITFSTLEGR 86
               +  +TFS ++GR
Sbjct: 814 TGISVNDVTFSDIQGR 829



>pir|T10569|T10569 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F25E4.110 - Arabidopsis
           thaliana>gb:ATCHRIV32_1544914 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 32.>gb:ATF25E4_1549986
           Arabidopsis thaliana DNA chromosome 4, BAC clone F25E4
           (ESSA project).
          Length = 636

 Score =  185 bits (470), Expect(2) = 1e-54
 Identities = 86/163 (52%), Positives = 121/163 (74%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F+ ++ G   W  R+ I  G +RG+LYLH DS LKIIHRDLK SNILLDAE+ PK+
Sbjct: 403 DQFLFEPTKKGQLDWAKRYKIIVGTARGILYLHHDSPLKIIHRDLKASNILLDAEMEPKV 462

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A T+RV+GT+GY+SPEY++ G FSVKSDV+S GV++LE+ISG++N
Sbjct: 463 ADFGMARIFRVDQSRADTRRVVGTHGYISPEYLMHGQFSVKSDVYSFGVLVLEIISGKRN 522

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             FH++D    NL+ +AW  W +G+P EL+D+ +  +Y  ++V
Sbjct: 523 SNFHETDESGKNLVTYAWRHWRNGSPLELVDSELEKNYQSNEV 565



 Score = 50.8 bits (120), Expect(2) = 1e-54
 Identities = 19/40 (47%), Positives = 28/40 (70%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           RCIH+ALLCV   PE RP +++++ ML +  + LP P+ P
Sbjct: 567 RCIHIALLCVQNDPEQRPNLSTIIMMLTSNSITLPVPQSP 606



>gb:OSJN00019_1693376 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 827

 Score =  178 bits (451), Expect(2) = 3e-54
 Identities = 89/167 (53%), Positives = 115/167 (68%), Gaps = 5/167 (2%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+F+ +      W TRF I  G++RGLLYLHQDSR+KIIHRDLK SNILLD E+NPKI
Sbjct: 592  DKFLFNHTTEATLDWLTRFNIIKGVARGLLYLHQDSRMKIIHRDLKASNILLDGEMNPKI 651

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   ++    T+RV+GTYGYMSPEY ++G FSVKSD +S G++LLE++SG K 
Sbjct: 652  SDFGMARIFGGNEQQESTRRVVGTYGYMSPEYAMEGTFSVKSDTYSFGILLLEIVSGLK- 710

Query: 437  RAFHDSDHH-----HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                 S HH      NL+ +AW LW DG   + +D  + +S   S+V
Sbjct: 711  ---ISSPHHLVMDFPNLIAYAWNLWKDGRQRDFVDKSILESCSLSEV 754



 Score = 57.0 bits (136), Expect(2) = 3e-54
 Identities = 29/74 (39%), Positives = 44/74 (59%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           +CIH+ L+CV   P  RP M+ VV MLENE++  P P +P +FV+R+    S   +E   
Sbjct: 756 KCIHIGLMCVQDSPNARPLMSFVVSMLENEDMPHPIPTQPIYFVQRH--YESEEPREYSD 813

Query: 127 YEIAMITFSTLEGR 86
             +  ++ + LEGR
Sbjct: 814 KSVNNVSLTILEGR 827



>gb:AE016959_1020855 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC074283_1541320
           Oryza sativa chromosome 10 clone OSJNBa0087H07, complete
           sequence.>gb:AE017054_1750674 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 8 of 77 of the
           complete sequence.
          Length = 640

 Score =  180 bits (457), Expect(2) = 3e-54
 Identities = 84/150 (56%), Positives = 112/150 (74%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+++FDE +  +  W  R VI  GI++GLLYLH+ SRL++IHRDLK SNILLD+E+NPKI
Sbjct: 428 DFYIFDERKKDLLDWNKRLVIIEGIAQGLLYLHKHSRLRVIHRDLKPSNILLDSEMNPKI 487

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA+I   +     T+RV+GTYGYM+PEY  +G FS KSDVFS GVI+LE+ISG++N
Sbjct: 488 SDFGLAKIFGSNSNEGTTRRVVGTYGYMAPEYSSEGLFSPKSDVFSFGVIILEIISGKRN 547

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
            +    +   NLLG+AW LW++    EL+D
Sbjct: 548 ASLDQCEDFINLLGYAWKLWSEERWLELLD 577



 Score = 54.7 bits (130), Expect(2) = 3e-54
 Identities = 24/44 (54%), Positives = 33/44 (75%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           LRCI++ALLCV +   DRPTM++VV ML +E + L +PK P +F
Sbjct: 590 LRCINIALLCVQENAVDRPTMSNVVAMLSSESMVLDEPKHPAYF 633



>pir|S51527|S51527 S-receptor kinase (EC 2.7.1.-) A14 precursor -
            rape>gb:BNU00443_1633646 Brassica napus cultivar T2
            S-receptor kinase mRNA, complete cds.
          Length = 849

 Score =  174 bits (441), Expect(2) = 4e-54
 Identities = 84/156 (53%), Positives = 112/156 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F ++R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 607  DSYLFGKTRRSKLNWKERFDIINGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKI 666

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T +V+GTYGYMSPEY +   FS KSDVFS GVI+LE++SG+KN
Sbjct: 667  SDFGMARIFARDETEANTVKVVGTYGYMSPEYAMHEIFSEKSDVFSFGVIVLEIVSGKKN 726

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
               ++ ++ +NLL +AW  W +G   E++D  + DS
Sbjct: 727  S--YNLNYKNNLLSYAWSQWEEGRALEIIDPVIVDS 760



 Score = 60.5 bits (145), Expect(2) = 4e-54
 Identities = 26/60 (43%), Positives = 40/60 (66%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + LLCV +L E RPTM+SVV+ML +E   +P+PK+PG  + R+  +   +   +C
Sbjct: 771 LKCIQIGLLCVQELAEHRPTMSSVVWMLGSEAKEIPQPKQPGHCIGRSPYDLDPSSSSQC 830



>gb:AY052580_1562776 Raphanus sativus haplotype S2 S-locus receptor
           kinase (SRK) gene, partial cds.
          Length = 288

 Score =  174 bits (442), Expect(2) = 4e-54
 Identities = 84/156 (53%), Positives = 111/156 (71%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F +++     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 44  DSYLFGKTQRPKLNWKERFNITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMTPKI 103

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+AR    D+  A T +V+GTYGYMSPEY + G FS KSDVFS GVI+LE++SG+KN
Sbjct: 104 SDFGMARTFTRDETEANTMKVVGTYGYMSPEYAMYGKFSEKSDVFSFGVIVLEIVSGKKN 163

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F   ++ +NLL +AW  W +G    ++D  + DS
Sbjct: 164 RGF---NYGNNLLSYAWSHWKEGRALGIVDPVIIDS 196



 Score = 60.1 bits (144), Expect(2) = 4e-54
 Identities = 28/60 (46%), Positives = 39/60 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+CI + LLCV +L EDRPTM+SVV+ML +E   +P+PK P    ER+  E   +   +C
Sbjct: 210 LKCIQIGLLCVQELAEDRPTMSSVVWMLGSEATEIPQPKPPCHCFERSPYELDPSLSRQC 269



>gb:AP005742_1856983 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0489D11.
          Length = 804

 Score =  174 bits (442), Expect(2) = 5e-54
 Identities = 84/162 (51%), Positives = 116/162 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +F+ SR  +  W TRF I  G++RGLLYLHQDSRL IIHRDLK  NILLDAE+ PKI
Sbjct: 567  DATLFNGSRKLLLDWTTRFNIIKGVARGLLYLHQDSRLTIIHRDLKAGNILLDAEMKPKI 626

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            +DFG+ARI  ++   A T+RV+GTYGYM+PEY ++G FS KSDV+S GV+LLE+I+G + 
Sbjct: 627  ADFGMARIFGDNQQNANTQRVVGTYGYMAPEYAMEGIFSTKSDVYSFGVLLLEVITGMRR 686

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             +  +     NL+ +AW +W +G   +L D+ + DS ++ +V
Sbjct: 687  NSVSNIMGFPNLIVYAWNMWKEGKTEDLADSSIMDSCLQDEV 728



 Score = 59.7 bits (143), Expect(2) = 5e-54
 Identities = 31/76 (40%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLEN-EEVALPKPKEPGFFVERNSTEASSTDKER 134
           L CIH+ALLCV + P+DRP M  VVF+LEN    ALP P  P +F +R+        +  
Sbjct: 729 LLCIHLALLCVQENPDDRPLMPFVVFILENGSSTALPTPSRPTYFAQRSDKMEMDQLRHN 788

Query: 133 CCYEIAMITFSTLEGR 86
               +  +T + +EGR
Sbjct: 789 IENSMYTLTLTDVEGR 804



>gb:AB012106_1511634 Brassica rapa mRNA for SRK45, complete cds.
          Length = 846

 Score =  173 bits (439), Expect(2) = 7e-54
 Identities = 84/160 (52%), Positives = 112/160 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++F +++     W+ RF I  G++RGLLYLHQDSR +IIHRDLK SNILLD  + PKI
Sbjct: 608  DSYLFGKTQRSKLNWKERFDITNGVARGLLYLHQDSRFRIIHRDLKVSNILLDKNMIPKI 667

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T +V+GTYGYMSPEY ++G FS KSDVFS GVI+LE+++G++N
Sbjct: 668  SDFGMARIFARDETEANTMKVVGTYGYMSPEYAMNGIFSEKSDVFSFGVIVLEIVTGKRN 727

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVES 318
            R +       N L +AW  W +G   EL+D  + DS + S
Sbjct: 728  RGY-------NFLSYAWSHWKEGRTLELVDPVIVDSSLPS 760



 Score = 60.5 bits (145), Expect(2) = 7e-54
 Identities = 30/79 (37%), Positives = 45/79 (56%), Gaps = 4/79 (5%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
            L+CI + LLCV +L E RPTM+SVV+ML +E   +P PK PG  + R+  E   +   +C
Sbjct: 768  LKCIQIGLLCVQELAEHRPTMSSVVWMLGSEATEIPHPKPPGCCIGRSPYELEPSSSRQC 827

Query: 130  ----CYEIAMITFSTLEGR 86
                 + +   T S ++ R
Sbjct: 828  DEDESWTVNQYTCSVIDAR 846



>gb:AC129718_1740653 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088I06, complete sequence.
          Length = 680

 Score =  180 bits (457), Expect(2) = 7e-54
 Identities = 87/152 (57%), Positives = 108/152 (71%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD SR     W+ RF I  GI RGLLYLH+DSRLKIIHRDLK SNILLD ++NPKI
Sbjct: 445 DTILFDTSRQQDLNWEQRFKIIEGIGRGLLYLHEDSRLKIIHRDLKASNILLDVDMNPKI 504

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA++   +  +A T R+ GTYGYM+PEY + G FS KSDVFS GV+LLE+++GR+N
Sbjct: 505 SDFGLAKLFNMEASVANTSRIAGTYGYMAPEYALHGIFSAKSDVFSYGVLLLEIVTGRRN 564

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNC 342
              HDS+   +LL   W  W+ G   EL+D C
Sbjct: 565 TCLHDSE---DLLAFVWRHWSRGGAGELLDGC 593



 Score = 53.5 bits (127), Expect(2) = 7e-54
 Identities = 25/43 (58%), Positives = 29/43 (67%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF 182
           LRCIHV LLCV + P+ RP MA+VV ML +  V LP P  P F
Sbjct: 604 LRCIHVGLLCVQEDPQLRPGMAAVVVMLNSRSVTLPAPSAPAF 646



>pir|T10568|T10568 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F25E4.100 - Arabidopsis
           thaliana>gb:ATCHRIV32_1544913 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 32.>gb:ATF25E4_1549985
           Arabidopsis thaliana DNA chromosome 4, BAC clone F25E4
           (ESSA project).
          Length = 656

 Score =  173 bits (439), Expect(2) = 7e-54
 Identities = 84/165 (50%), Positives = 114/165 (69%), Gaps = 9/165 (5%)
 Frame = -3

Query: 797 DYFVF--------DESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILL 642
           +YF+F        D ++     W+ R+ I  GI+RGLLYLHQDSRL IIHRD+K SNILL
Sbjct: 403 NYFLFGNKQKHLLDPTKKSQLDWKRRYNIIGGITRGLLYLHQDSRLTIIHRDIKASNILL 462

Query: 641 DAELNPKISDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILL 462
           DA++NPKI+DFG+AR    D     T+RV+GT+GYM PEYV  G FS KSDV+S GV++L
Sbjct: 463 DADMNPKIADFGMARNFRVDQTEDNTRRVVGTFGYMPPEYVTHGQFSTKSDVYSFGVLIL 522

Query: 461 ELISGRKNRAFHD-SDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           E++ G+KN +F+   D   NL+ H W LWN+ +P +L+D  + +S
Sbjct: 523 EIVCGKKNSSFYKIDDSGGNLVTHVWRLWNNDSPLDLIDPAIEES 567



 Score = 60.5 bits (145), Expect(2) = 7e-54
 Identities = 26/53 (49%), Positives = 34/53 (64%)
 Frame = -1

Query: 322 NLK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNS 164
           N K +RCIH+ LLCV + P DRP M+++  ML N  + LP P+ PGFF    S
Sbjct: 570 NDKVIRCIHIGLLCVQETPVDRPEMSTIFQMLTNSSITLPVPRPPGFFFRNRS 622



>pir|T04842|T04842 protein kinase AK4 (EC 2.7.1.-) - Arabidopsis
           thaliana>gb:ATCHRIV59_1546162 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549627
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 998

 Score =  183 bits (464), Expect(2) = 9e-54
 Identities = 89/163 (54%), Positives = 118/163 (72%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++     W  R  I  GI+RG+LYLHQDSRLKIIHRDLK SNILLDA++NPKI
Sbjct: 422 DYFLFDPNKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKI 481

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D  +A T RV+GT+GYMSPEYV  G FS+KSDV+S GV++LE+ISG+KN
Sbjct: 482 ADFGMARIFGVDQTVANTARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKN 541

Query: 437 RAFHDSDH-HHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F+  D   +NL+ + W LW +    EL+D  +++     +V
Sbjct: 542 SSFYQMDGLVNNLVTYVWKLWENKTMHELIDPFIKEDCKSDEV 584



 Score = 50.4 bits (119), Expect(2) = 9e-54
 Identities = 20/44 (45%), Positives = 30/44 (68%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           +R +H+ LLCV + P DRPTM+++  +L    + LP P+ PGFF
Sbjct: 585 IRYVHIGLLCVQENPADRPTMSTIHQVLTTSSITLPVPQPPGFF 628



>pir|T04848|T04848 protein kinase homolog F16G20.10 - Arabidopsis
            thaliana>gb:ATCHRIV59_1546168 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549633
            Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
            (ESSA project).
          Length = 830

 Score =  177 bits (448), Expect(2) = 9e-54
 Identities = 84/158 (53%), Positives = 113/158 (71%), Gaps = 1/158 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+FD +      W  R+ I  GI+RG+LYLHQDSRL IIHRDLK  NILLDA++NPK+
Sbjct: 590  DYFLFDTTMKRQLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKV 649

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            +DFG+ARI   D   A T+RV+GTYGYM+PEY + G FS+KSDV+S GV++ E+ISG KN
Sbjct: 650  ADFGMARIFGMDQTEANTRRVVGTYGYMAPEYAMYGQFSMKSDVYSFGVLVFEIISGMKN 709

Query: 437  RAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSY 327
             + +  D    NL+ + W LW++G+  +L+D    D+Y
Sbjct: 710  SSLYQMDDSVSNLVTYTWRLWSNGSQLDLVDPSFGDNY 747



 Score = 56.6 bits (135), Expect(2) = 9e-54
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFV----ERNSTEASSTDK 140
           RCIH+ALLCV +  +DRP M+++V ML    + L  PK+PGFF     E+     SS D+
Sbjct: 754 RCIHIALLCVQEDVDDRPNMSAIVQMLTTSSIVLAVPKQPGFFFRGRHEQVGEVGSSVDR 813

Query: 139 ERCC 128
              C
Sbjct: 814 LALC 817



>gb:AF084037_1767054 Arabidopsis thaliana receptor-like protein
           kinase (RKC1) gene, complete cds.
          Length = 684

 Score =  183 bits (464), Expect(2) = 9e-54
 Identities = 89/163 (54%), Positives = 118/163 (72%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++     W  R  I  GI+RG+LYLHQDSRLKIIHRDLK SNILLDA++NPKI
Sbjct: 439 DYFLFDPNKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKI 498

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D  +A T RV+GT+GYMSPEYV  G FS+KSDV+S GV++LE+ISG+KN
Sbjct: 499 ADFGMARIFGVDQTVANTARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKN 558

Query: 437 RAFHDSDH-HHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F+  D   +NL+ + W LW +    EL+D  +++     +V
Sbjct: 559 SSFYQMDGLVNNLVTYVWKLWENKTMHELIDPFIKEDCKSDEV 601



 Score = 50.4 bits (119), Expect(2) = 9e-54
 Identities = 20/44 (45%), Positives = 30/44 (68%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           +R +H+ LLCV + P DRPTM+++  +L    + LP P+ PGFF
Sbjct: 602 IRYVHIGLLCVQENPADRPTMSTIHQVLTTSSITLPVPQPPGFF 645



>gb:AY140033_1582473 Arabidopsis thaliana protein kinase-like
           protein (At4g23250) mRNA, complete cds.
          Length = 608

 Score =  183 bits (464), Expect(2) = 9e-54
 Identities = 89/163 (54%), Positives = 118/163 (72%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD ++     W  R  I  GI+RG+LYLHQDSRLKIIHRDLK SNILLDA++NPKI
Sbjct: 363 DYFLFDPNKRNQLDWTVRRNIIGGITRGILYLHQDSRLKIIHRDLKASNILLDADMNPKI 422

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D  +A T RV+GT+GYMSPEYV  G FS+KSDV+S GV++LE+ISG+KN
Sbjct: 423 ADFGMARIFGVDQTVANTARVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEIISGKKN 482

Query: 437 RAFHDSDH-HHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F+  D   +NL+ + W LW +    EL+D  +++     +V
Sbjct: 483 SSFYQMDGLVNNLVTYVWKLWENKTMHELIDPFIKEDCKSDEV 525



 Score = 50.4 bits (119), Expect(2) = 9e-54
 Identities = 20/44 (45%), Positives = 30/44 (68%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           +R +H+ LLCV + P DRPTM+++  +L    + LP P+ PGFF
Sbjct: 526 IRYVHIGLLCVQENPADRPTMSTIHQVLTTSSITLPVPQPPGFF 569



>gb:AB032474_1518697 Brassica oleracea SRK60 mRNA for S60 S-locus
            receptor kinase, complete cds.
          Length = 859

 Score =  182 bits (463), Expect(2) = 1e-53
 Identities = 85/156 (54%), Positives = 110/156 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 612  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 671

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T   +GTYGYMSPEY +DG  S K+DVFS GVI+LE++SG++N
Sbjct: 672  SDFGMARIFARDETQAMTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRN 731

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F+  +  +NLL +AW  W +G   E++D  + DS
Sbjct: 732  RGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDS 767



 Score = 50.4 bits (119), Expect(2) = 1e-53
 Identities = 21/41 (51%), Positives = 30/41 (73%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P
Sbjct: 781 LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPP 821



>gb:AB024419S2_1515949 Brassica oleracea SRK13 gene, exon 2, 3, 4, 5,
            6, 7 and complete cds.
          Length = 854

 Score =  182 bits (463), Expect(2) = 1e-53
 Identities = 85/156 (54%), Positives = 110/156 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 607  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 666

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A T   +GTYGYMSPEY +DG  S K+DVFS GVI+LE++SG++N
Sbjct: 667  SDFGMARIFARDETQAMTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRN 726

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F+  +  +NLL +AW  W +G   E++D  + DS
Sbjct: 727  RGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVDS 762



 Score = 50.4 bits (119), Expect(2) = 1e-53
 Identities = 21/41 (51%), Positives = 30/41 (73%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P
Sbjct: 776 LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPP 816



>gb:AB024421S2_1515950 Brassica oleracea SRK13-b gene, exon 2, 3, 4,
            5, 6, 7 and complete cds.
          Length = 856

 Score =  182 bits (462), Expect(2) = 1e-53
 Identities = 84/155 (54%), Positives = 110/155 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 609  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A+T   +GTYGYMSPEY +DG  S K+DVFS GVI+LE++SG++N
Sbjct: 669  SDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRN 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRD 333
            R F+  +  +NLL +AW  W +G   E++D  + D
Sbjct: 729  RGFYQVNPENNLLSYAWSHWAEGRALEIVDPVIVD 763



 Score = 50.8 bits (120), Expect(2) = 1e-53
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 6/81 (7%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP------GFFVERNSTEASS 149
            L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P       ++    S+    
Sbjct: 778  LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPPVYCLIASYYANNPSSSGQF 837

Query: 148  TDKERCCYEIAMITFSTLEGR 86
             D E   + +   T S ++ R
Sbjct: 838  DDDE--SWTVNKYTCSVIDAR 856



>gb:AY534541_1612234 Raphanus sativus haplotype S29 S-locus receptor
           kinase gene, partial cds.
          Length = 287

 Score =  178 bits (451), Expect(2) = 1e-53
 Identities = 84/156 (53%), Positives = 108/156 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRD+K  NILLD  + PKI
Sbjct: 43  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDMKAGNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLARI+  D   A T   IGTYGYMSPEY + G  S K+DVFS GVI+LE+++G++N
Sbjct: 103 SDFGLARIIARDQTEASTDTPIGTYGYMSPEYAMYGILSEKTDVFSFGVIVLEIVTGKRN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+ S+   NL+ +AW  W  G   E++D  + DS
Sbjct: 163 RGFYQSNPEDNLVCYAWTHWAQGRALEIVDPVIVDS 198



 Score = 54.7 bits (130), Expect(2) = 1e-53
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKE------PGFFVERNSTEASS 149
           L+CI + LLC+ +  E RPTM+SVV+ML +E  A+P+PK       P F+    S+   S
Sbjct: 209 LKCIQIGLLCIQESAEHRPTMSSVVWMLGSEATAIPQPKPPVYCLIPSFYANNPSSSRPS 268

Query: 148 TDKE 137
            D E
Sbjct: 269 DDDE 272



>gb:AP005742_1856979 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0489D11.
          Length = 827

 Score =  171 bits (433), Expect(2) = 2e-53
 Identities = 82/162 (50%), Positives = 116/162 (71%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD SR     W TRF I  G++RGLLYLHQDSRL IIHRDLK  N+LLDAE+ PKI
Sbjct: 591  DATLFDGSRKMKLDWTTRFNIIKGVARGLLYLHQDSRLTIIHRDLKAGNVLLDAEMKPKI 650

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            +DFG+ARI  ++   A T+RV+GTYGYM+PEY ++G FS KSDV+S GV+LLE+++G + 
Sbjct: 651  ADFGMARIFGDNQQDANTQRVVGTYGYMAPEYAMEGIFSTKSDVYSFGVLLLEIVTGIRR 710

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             +  +  +  NL+ ++W +W +G   +L+D+ + DS +  +V
Sbjct: 711  SSTSNIMNFPNLIVYSWNMWKEGKSKDLVDSSIMDSCLLHEV 752



 Score = 61.2 bits (147), Expect(2) = 2e-53
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 2/77 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLEN--EEVALPKPKEPGFFVERNSTEASSTDKE 137
           L CIHVALLCV + P+DRP M+S+VF LEN      LP P  PG F +R+S      D  
Sbjct: 753 LLCIHVALLCVQESPDDRPLMSSIVFTLENGSSVALLPAPSCPGHFTQRSSEIEQMKDNT 812

Query: 136 RCCYEIAMITFSTLEGR 86
           +    +   T + +EGR
Sbjct: 813 Q--NSMNTFTLTNIEGR 827



>gb:ATH011674_1551954 Arabidopsis thaliana mRNA for receptor-like
           protein kinase.
          Length = 667

 Score =  171 bits (432), Expect(2) = 2e-53
 Identities = 84/165 (50%), Positives = 112/165 (67%), Gaps = 3/165 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD  +     W  R+ I  GI+RG+LYLHQDSRLKIIHRDLK SNILLDA++NPKI
Sbjct: 432 DYFLFDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRLKIIHRDLKASNILLDADMNPKI 491

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLA I   +     T R+ GTY YMSPEY + G +S+KSD++S GV++LE+ISG+KN
Sbjct: 492 ADFGLATIFGVEQTQGNTNRIAGTYAYMSPEYAMHGQYSMKSDIYSFGVLVLEIISGKKN 551

Query: 437 RAFHDSDHHH---NLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              +  D      NL+ +A  LW + +P EL+D     +Y  ++V
Sbjct: 552 SGVYQMDETSTAGNLVTYASRLWRNKSPLELVDPTFGRNYQSNEV 596



 Score = 61.6 bits (148), Expect(2) = 2e-53
 Identities = 28/70 (40%), Positives = 41/70 (58%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RCIH+ALLCV + PEDRP +++++ ML +  + LP P+ PGFF      +  S   E   
Sbjct: 598 RCIHIALLCVQENPEDRPMLSTIILMLTSNTITLPVPRLPGFFPRSRQLKLVSEGSESDQ 657

Query: 127 YEIAMITFST 98
           Y     +FS+
Sbjct: 658 YTSKSSSFSS 667



>gb:AB054061_1521307 Brassica rapa SRK22 mRNA for S locus receptor
            kinase, partial cds.
          Length = 827

 Score =  181 bits (460), Expect(2) = 2e-53
 Identities = 84/156 (53%), Positives = 110/156 (70%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 580  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 639

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A+T   +GTYGYMSPEY +DG  S K+DVFS GVI+LE++SG++N
Sbjct: 640  SDFGMARIFARDETQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRN 699

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F+  +  +NL  +AW  W +G   E++D  + DS
Sbjct: 700  RGFYQVNPENNLPSYAWTHWAEGRALEIVDPVIVDS 735



 Score = 50.4 bits (119), Expect(2) = 2e-53
 Identities = 21/41 (51%), Positives = 30/41 (73%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P
Sbjct: 749 LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPP 789



>gb:AP003811_1833703 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1131_E05.>gb:AP006753_1862874 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039D04.
          Length = 674

 Score =  174 bits (440), Expect(2) = 2e-53
 Identities = 83/162 (51%), Positives = 113/162 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +  +  W  RF I  GI++GLLYLH+ SRL++IHRDLK SNILLD E+NPKI
Sbjct: 438 DCFIFDTEKGAMLNWDKRFRIIDGIAQGLLYLHKHSRLRVIHRDLKASNILLDREMNPKI 497

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   +   A T RV+GT+GY++PEY  +G FS+KSDVFS GV+LLE+ISG++ 
Sbjct: 498 SDFGMARIFCSNVTEANTTRVVGTHGYIAPEYASEGLFSIKSDVFSFGVLLLEIISGKRT 557

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             F+      NL G+A+ LW +G   EL+D  + + +   +V
Sbjct: 558 AGFYQYGKFFNLTGYAYQLWQEGQWHELVDQALGEDFPAMEV 599



 Score = 58.2 bits (139), Expect(2) = 2e-53
 Identities = 28/75 (37%), Positives = 46/75 (61%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           ++C+ VALLCV    +DRP M+ V+ ML +E V +P+P++P +F  R S+ A S+     
Sbjct: 600 MKCVQVALLCVQDSADDRPNMSDVIAMLGSEGVTMPEPRQPAYFNVRISSLAVSSSSFGE 659

Query: 130 CYEIAMITFSTLEGR 86
            Y ++ +T    +GR
Sbjct: 660 SYCMSNVTLMEEDGR 674



>gb:AP003856_1834380 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0697D09.
          Length = 690

 Score =  179 bits (455), Expect(2) = 3e-53
 Identities = 81/149 (54%), Positives = 110/149 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  +  +  W  R  I  GI++GLLYLH+ SRL++IHRDLK SNILLD ++NPKI
Sbjct: 454 DFFIFDVDKTSLIDWNKRCGIIEGIAQGLLYLHKHSRLRVIHRDLKASNILLDQDMNPKI 513

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA+I   ++    TKRV+GTYGYMSPEY  +G +S+KSDVFS GV+LLE++SG++N
Sbjct: 514 SDFGLAKIFSSNNTEGNTKRVVGTYGYMSPEYASEGIYSIKSDVFSFGVLLLEILSGKRN 573

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELM 351
             FH      NLLG+AW +W +G   +++
Sbjct: 574 SGFHQYGDFLNLLGYAWHMWEEGRWLDII 602



 Score = 52.0 bits (123), Expect(2) = 3e-53
 Identities = 24/53 (45%), Positives = 35/53 (66%)
 Frame = -1

Query: 301 IHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           I++AL+CV +  +DRPTM+ VV ML +E   LP+PK P ++  R S    ST+
Sbjct: 619 INIALMCVQENADDRPTMSDVVAMLSSESAVLPEPKHPAYYNLRVSKVQGSTN 671



>gb:AY052584_1562780 Raphanus sativus haplotype S9 S-locus receptor
           kinase (SRK) gene, partial cds.
          Length = 291

 Score =  179 bits (453), Expect(2) = 3e-53
 Identities = 84/156 (53%), Positives = 112/156 (71%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D ++F + R     W+ RF I  G++RGLLYLHQDSR +IIHRD+K SNILLD  + PKI
Sbjct: 44  DSYLFGKKRSCKLNWKHRFDITNGVARGLLYLHQDSRFRIIHRDMKVSNILLDKNMIPKI 103

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   D   A T+ V+GTYGYMSPEY + G FS KSDVFS GVI+LE++SG+++
Sbjct: 104 SDFGMARIFGRDTSEASTRNVVGTYGYMSPEYAMYGVFSEKSDVFSFGVIVLEIVSGKRS 163

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+  ++ +NLL +AW  W +G   E++D  + DS
Sbjct: 164 RGFYQLNNDNNLLSYAWSHWTEGRALEIVDPVIVDS 199



 Score = 52.8 bits (125), Expect(2) = 3e-53
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 6/81 (7%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP------GFFVERNSTEASS 149
           L+CI + LLCV +  E RPTM+SVV+ML +E   +P+PK P       F+    S+    
Sbjct: 213 LKCIQIGLLCVQERAEHRPTMSSVVWMLGSEATEIPQPKPPVYRLAKSFYANNPSSSRHC 272

Query: 148 TDKERCCYEIAMITFSTLEGR 86
            D E   + +   T S ++ R
Sbjct: 273 EDNE--SWTVNQYTCSVIDAR 291



>gb:AK118493_1816466 Arabidopsis thaliana At4g23140 mRNA for
           putative receptor-like protein kinase 5 (RLK5), complete
           cds, clone: RAFL19-72-N19.
          Length = 680

 Score =  175 bits (443), Expect(2) = 4e-53
 Identities = 87/168 (51%), Positives = 116/168 (69%), Gaps = 6/168 (3%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD ++     W  R+ I  GI+RG+LYLHQDSRL IIHRDLK SNILLDA++NPKI
Sbjct: 433 DCLLFDPTKQIQLDWMQRYNIIGGIARGILYLHQDSRLTIIHRDLKASNILLDADINPKI 492

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTY------GYMSPEYVVDGNFSVKSDVFSLGVILLEL 456
           +DFG+ARI   D     T R++GTY      GYM+PEY + G FS+KSDV+S GV++LE+
Sbjct: 493 ADFGMARIFGLDQTQDNTSRIVGTYFVVDSSGYMAPEYAMHGQFSMKSDVYSFGVLVLEI 552

Query: 455 ISGRKNRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
           ISGRKN +F +SD   +LL HAW LW +    +L+D  + ++   S+V
Sbjct: 553 ISGRKNSSFGESDGAQDLLTHAWRLWTNKKALDLVDPLIAENCQNSEV 600



 Score = 56.2 bits (134), Expect(2) = 4e-53
 Identities = 23/50 (46%), Positives = 35/50 (70%)
 Frame = -1

Query: 322 NLK*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
           N + +RCIH+ LLCV + P  RP +++V  ML +  V LP P++PGFF++
Sbjct: 597 NSEVVRCIHIGLLCVQEDPAKRPAISTVFMMLTSNTVTLPVPRQPGFFIQ 646



>gb:AY534533_1612226 Raphanus sativus haplotype S11 S-locus receptor
           kinase gene, partial cds.
          Length = 287

 Score =  178 bits (451), Expect(2) = 4e-53
 Identities = 84/156 (53%), Positives = 108/156 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRD+K  NILLD  + PKI
Sbjct: 43  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDMKAGNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLARI+  D   A T   IGTYGYMSPEY + G  S K+DVFS GVI+LE+++G++N
Sbjct: 103 SDFGLARIIARDQTEASTDTPIGTYGYMSPEYAMYGILSEKTDVFSFGVIVLEIVTGKRN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+ S+   NL+ +AW  W  G   E++D  + DS
Sbjct: 163 RGFYQSNPEDNLVCYAWTHWAQGRALEIVDPVIVDS 198



 Score = 53.1 bits (126), Expect(2) = 4e-53
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 6/64 (9%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKE------PGFFVERNSTEASS 149
           L+CI + LLC+ +  E RPTM+SVV++L +E  A+P+PK       P F+    S+   S
Sbjct: 209 LKCIQIGLLCIQERAEHRPTMSSVVWVLGSEATAIPQPKPPVYCLIPSFYANNPSSSRPS 268

Query: 148 TDKE 137
            D E
Sbjct: 269 DDDE 272



>gb:AP005679_1855870 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, BAC
            clone:OJ1210_A07.>gb:AP005742_1856970 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 9, PAC
            clone:P0489D11.
          Length = 854

 Score =  174 bits (440), Expect(2) = 7e-53
 Identities = 88/163 (53%), Positives = 111/163 (68%), Gaps = 5/163 (3%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +F   R  +  W TRF I  G++RGLLYLHQDSRL IIHRDLK SNILLDAE+NPKI
Sbjct: 616  DASLFKGKRKSVLDWSTRFKIVKGVARGLLYLHQDSRLTIIHRDLKASNILLDAEMNPKI 675

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +     TKRV+GTYGYM+PEY + G FS+KSDV+S GV+LLE++SG K 
Sbjct: 676  SDFGMARIFGNNQQKEVTKRVVGTYGYMAPEYAMGGIFSMKSDVYSFGVLLLEIVSGSKI 735

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMD-----NCVRDSYV 324
             +    +   NL  +AW LWN+G    ++D     NC+ D  +
Sbjct: 736  SSIDLIEDSPNLPVYAWNLWNEGKADIMIDSTITANCLLDEVI 778



 Score = 56.6 bits (135), Expect(2) = 7e-53
 Identities = 25/49 (51%), Positives = 32/49 (65%)
 Frame = -1

Query: 304 CIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE 158
           CIHVALLCV +   DRP M+ VV +LE    +LP P  P +F +RN+ E
Sbjct: 780 CIHVALLCVQENLNDRPLMSDVVLILEKGSKSLPAPNRPAYFAQRNNNE 828



>pir|D86247|D86247 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890139 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007259_1535681 Arabidopsis thaliana
           chromosome I BAC T28P6 genomic sequence, complete
           sequence.
          Length = 797

 Score =  164 bits (416), Expect(2) = 7e-53
 Identities = 81/128 (63%), Positives = 96/128 (75%)
 Frame = -3

Query: 695 DSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVV 516
           DSRLKIIHRDLK SNILLD  LNPKISDFGLARI   ++  A T+RV+GTYGYMSPEY +
Sbjct: 595 DSRLKIIHRDLKASNILLDENLNPKISDFGLARIFRANEDEANTRRVVGTYGYMSPEYAM 654

Query: 515 DGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVR 336
           +G FS KSDVFSLGVI LE+ISGR+N + H  +++ NLL +AW LWNDG    L D  V 
Sbjct: 655 EGFFSEKSDVFSLGVIFLEIISGRRNSSSHKEENNLNLLAYAWKLWNDGEAASLADPAVF 714

Query: 335 DSYVESQV 312
           D   E ++
Sbjct: 715 DKCFEKEI 722



 Score = 65.9 bits (159), Expect(2) = 7e-53
 Identities = 27/74 (36%), Positives = 48/74 (64%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           +C+H+ LLCV ++  DRP +++V++ML  E ++L  PK+P F V R ++EA S+D+    
Sbjct: 724 KCVHIGLLCVQEVANDRPNVSNVIWMLTTENMSLADPKQPAFIVRRGASEAESSDQSSQK 783

Query: 127 YEIAMITFSTLEGR 86
             I  ++ + + GR
Sbjct: 784 VSINDVSLTAVTGR 797



>gb:AY534535_1612228 Raphanus sativus haplotype S16 S-locus receptor
           kinase gene, partial cds.
          Length = 287

 Score =  177 bits (448), Expect(2) = 7e-53
 Identities = 83/156 (53%), Positives = 108/156 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+F + R     W+ RF I  G++RGL+YLHQDSR +IIHRD+K  NILLD  + PKI
Sbjct: 43  DYFLFGKKRSSNLNWKDRFAITNGVARGLVYLHQDSRFRIIHRDMKAGNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLARI+  D   A T   IGTYGYMSPEY + G  S K+DVFS GVI+LE+++G++N
Sbjct: 103 SDFGLARIIARDQTEASTDTPIGTYGYMSPEYAMYGILSEKTDVFSFGVIVLEIVTGKRN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+ S+   NL+ +AW  W  G   E++D  + DS
Sbjct: 163 RGFYQSNPEDNLVCYAWTHWAQGRALEIVDPVIVDS 198



 Score = 53.5 bits (127), Expect(2) = 7e-53
 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 5/64 (7%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF-----FVERNSTEASST 146
           L+CI + LLC+ +  E RPTM+SVV+ML +E  A+P+PK P +     F   N + +  +
Sbjct: 209 LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATAIPQPKPPVYCLIPSFYANNPSSSRPS 268

Query: 145 DKER 134
           D ++
Sbjct: 269 DDDK 272



>gb:BOLRPKB_1633858 Brassica campestris mRNA for receptor protein
            kinase SRK12, complete cds.
          Length = 856

 Score =  179 bits (455), Expect(2) = 9e-53
 Identities = 83/156 (53%), Positives = 109/156 (69%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 609  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+  A+T   +GTYGYMSPEY +DG  S K+DVFS GVI+LE++SG++N
Sbjct: 669  SDFGMARIFARDEIQARTDNAVGTYGYMSPEYAMDGVISEKTDVFSFGVIVLEIVSGKRN 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F+  +  +NL  + W  W +G   E++D  + DS
Sbjct: 729  RGFYQVNPENNLPSYVWTHWAEGRALEIVDPVILDS 764



 Score = 50.4 bits (119), Expect(2) = 9e-53
 Identities = 21/41 (51%), Positives = 30/41 (73%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P
Sbjct: 778 LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPP 818



>gb:AY534537_1612230 Raphanus sativus haplotype S20 S-locus receptor
           kinase gene, partial cds.
          Length = 287

 Score =  177 bits (449), Expect(2) = 9e-53
 Identities = 83/156 (53%), Positives = 108/156 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DY +F + R     W+ RF I  G++RGLLYLHQDSR +IIHRD+K  NILLD  + PKI
Sbjct: 43  DYLLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDMKAGNILLDKNMIPKI 102

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLARI+  D   A T   IGTYGYMSPEY + G  S K+DVFS GVI+LE+++G++N
Sbjct: 103 SDFGLARIIARDQTEASTDNPIGTYGYMSPEYAMYGVLSEKTDVFSFGVIVLEIVTGKRN 162

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+ S+  +NL+ +AW  W  G   E++D  + DS
Sbjct: 163 RGFYQSNPENNLICYAWTHWAQGRALEIVDPVIVDS 198



 Score = 52.8 bits (125), Expect(2) = 9e-53
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 6/64 (9%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKE------PGFFVERNSTEASS 149
           L+CI + LLC+ +    RPTM+SVV+ML +E  A+P+PK       P F+    S+   S
Sbjct: 209 LKCIQIGLLCIQERAVHRPTMSSVVWMLGSEATAIPQPKPPVYCLIPSFYANHPSSSRQS 268

Query: 148 TDKE 137
            D E
Sbjct: 269 NDDE 272



>pir|T02153|T02153 protein kinase homolog T1F15.1 - Arabidopsis
            thaliana>gb:AE005173_894373 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC011020_1537197 Arabidopsis thaliana
            chromosome 1 BAC F12B7 genomic sequence, complete
            sequence.>gb:T1F15_1723567 Arabidopsis thaliana
            chromosome 1 BAC T1F15 sequence, complete sequence.
          Length = 833

 Score =  179 bits (453), Expect(2) = 2e-52
 Identities = 90/160 (56%), Positives = 115/160 (71%), Gaps = 1/160 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+FD  R  +  W  RF I  GI +GLLYLH+ SRLK+IHRD+K SNILLD ++NPKI
Sbjct: 593  DYFLFDPLRKNVLDWTLRFRIMEGIIQGLLYLHKYSRLKVIHRDIKASNILLDEDMNPKI 652

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLARI   ++  A TKRV GT+GYMSPEY  +G FS KSDVFS GV++LE+I GRKN
Sbjct: 653  SDFGLARIFGAEETRANTKRVAGTFGYMSPEYFREGLFSAKSDVFSFGVLMLEIICGRKN 712

Query: 437  RAF-HDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVE 321
             +F HD +   NL+ H W L+ +    E++D  +RDS ++
Sbjct: 713  NSFHHDLEGPLNLIVHVWNLFKENKIREVIDLSLRDSALD 752



 Score = 50.4 bits (119), Expect(2) = 2e-52
 Identities = 33/77 (42%), Positives = 41/77 (53%), Gaps = 2/77 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENE-EVALPKPKEPGFF-VERNSTEASSTDKE 137
           LRC+ VALLCV +  EDRP+M  VV M+  E   AL  PKEP F+   R S      + +
Sbjct: 757 LRCVQVALLCVQENAEDRPSMLDVVSMIYGEGNNALSLPKEPAFYDGPRRSFPEMKVEPQ 816

Query: 136 RCCYEIAMITFSTLEGR 86
                 A IT + LE R
Sbjct: 817 EPENVSASITITVLEAR 833



>gb:AB041622_1519689 Brassica rapa BcRK6 gene for receptor kinase 6,
            complete cds.
          Length = 816

 Score =  200 bits (509), Expect(2) = 2e-52
 Identities = 92/153 (60%), Positives = 118/153 (77%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD++R  +  WQ RF I  GI+RGLLYLHQDSR +IIHRDLK SN+LLD ++ PKI
Sbjct: 619  DSHIFDKTRSSMLNWQMRFDIINGIARGLLYLHQDSRFRIIHRDLKASNVLLDKDMAPKI 678

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+   D+  A T++V+GTYGYMSPEY ++G FS+KSDVFS GV+LLE+ISG++N
Sbjct: 679  SDFGLARMFGRDETEANTRKVVGTYGYMSPEYAMNGTFSMKSDVFSFGVLLLEIISGKRN 738

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCV 339
            + F DSD + NLLGH W  WN+G   E++D  V
Sbjct: 739  KGFCDSDSNLNLLGHVWRNWNEGQGLEIVDTAV 771



 Score = 28.9 bits (63), Expect(2) = 2e-52
 Identities = 11/19 (57%), Positives = 14/19 (73%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRP 254
           LRC+ + LLCV +  EDRP
Sbjct: 786 LRCLQIGLLCVQEHVEDRP 804



>pir|T10566|T10566 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F25E4.80 - Arabidopsis
           thaliana>gb:ATCHRIV32_1544911 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 32.>gb:ATF25E4_1549983
           Arabidopsis thaliana DNA chromosome 4, BAC clone F25E4
           (ESSA project).
          Length = 700

 Score =  175 bits (443), Expect(2) = 5e-52
 Identities = 87/166 (52%), Positives = 115/166 (69%), Gaps = 4/166 (2%)
 Frame = -3

Query: 797 DYFVF---DESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELN 627
           DYF+F   + ++ G   W  R+ I  GI+RGLLYLHQDSRL IIHRD+K SNILLDA++N
Sbjct: 428 DYFLFGSTNPTKKGQLDWTRRYNIIGGITRGLLYLHQDSRLTIIHRDIKASNILLDADMN 487

Query: 626 PKISDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISG 447
           PKI+DFG+AR   +      T RV+GT+GYM PEYV  G FS KSDV+S GV++LE++SG
Sbjct: 488 PKIADFGMARNFRDHQTEDSTGRVVGTFGYMPPEYVAHGQFSTKSDVYSFGVLILEIVSG 547

Query: 446 RKNRAFHDSDHH-HNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
           RKN +F+  D    NL+ + W LWN  +  EL+D  +  SY + +V
Sbjct: 548 RKNSSFYQMDGSVCNLVTYVWRLWNTDSSLELVDPAISGSYEKDEV 593



 Score = 52.8 bits (125), Expect(2) = 5e-52
 Identities = 30/92 (32%), Positives = 43/92 (46%), Gaps = 8/92 (8%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE--------RNSTEAS 152
           RCIH+ LLCV + P +RP ++++  ML N  + L  P+ PGFF          R   E  
Sbjct: 595 RCIHIGLLCVQENPVNRPALSTIFQMLTNSSITLNVPQPPGFFFRNRPESDTLRRGLEPD 654

Query: 151 STDKERCCYEIAMITFSTLEGR*KQHNFDCIS 56
             + E     I   T +TL G+       CI+
Sbjct: 655 QYNNESVTCSIDNATITTLLGKTLASALCCIT 686



>gb:AB012247_1511814 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MSL1.
          Length = 805

 Score =  179 bits (453), Expect(2) = 8e-52
 Identities = 90/161 (55%), Positives = 115/161 (71%), Gaps = 1/161 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+FD  R  +  W+ RF I  GI +GLLYLH+ SRLK+IHRD+K  NILLD ++NPKI
Sbjct: 564  DYFLFDPLRKIVLDWKLRFRIMEGIIQGLLYLHKYSRLKVIHRDIKAGNILLDEDMNPKI 623

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI    +  A TKRV GT+GYMSPEY  +G FS KSDVFS GV++LE+I GRKN
Sbjct: 624  SDFGMARIFGAQESKANTKRVAGTFGYMSPEYFREGLFSAKSDVFSFGVLMLEIICGRKN 683

Query: 437  RAF-HDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVES 318
             +F HDS+   NL+ H W L+ +    E++D  + DS VE+
Sbjct: 684  NSFHHDSEGPLNLIVHVWNLFKENRVREVIDPSLGDSAVEN 724



 Score = 48.1 bits (113), Expect(2) = 8e-52
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 3/78 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENE-EVALPKPKEPGFF--VERNSTEASSTDK 140
           LRC+ VALLCV +  +DRP+M  VV M+  +   AL  PKEP F+    R+S E      
Sbjct: 728 LRCVQVALLCVQQNADDRPSMLDVVSMIYGDGNNALSLPKEPAFYDGPPRSSPEMEVEPP 787

Query: 139 ERCCYEIAMITFSTLEGR 86
           E        +T + +E R
Sbjct: 788 EMENVSANRVTITVMEAR 805



>pir|E86247|E86247 receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AE005172_890140 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC007259_1535680 Arabidopsis thaliana
            chromosome I BAC T28P6 genomic sequence, complete
            sequence.
          Length = 795

 Score =  175 bits (444), Expect(2) = 8e-52
 Identities = 84/149 (56%), Positives = 113/149 (75%), Gaps = 1/149 (0%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W  R  I  GI+RG+LYLHQDSRL+IIHRDLK SNILLD+E+ PKISDFG+ARI   +  
Sbjct: 573  WPKRMEIVRGIARGILYLHQDSRLRIIHRDLKASNILLDSEMIPKISDFGMARIFGGNQM 632

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
               T RV+GT+GYM+PEY ++G FS+KSDV+S GV++LE+I+G+KN AFH+     NL+G
Sbjct: 633  EGCTSRVVGTFGYMAPEYAMEGQFSIKSDVYSFGVLMLEIITGKKNSAFHEES--SNLVG 690

Query: 395  HAWLLWNDGNPFELMDNCV-RDSYVESQV 312
            H W LW +G   E++DN + +++Y E +V
Sbjct: 691  HIWDLWENGEATEIIDNLMDQETYDEREV 719



 Score = 51.6 bits (122), Expect(2) = 8e-52
 Identities = 28/76 (36%), Positives = 40/76 (52%), Gaps = 1/76 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF-FVERNSTEASSTDKER 134
           ++CI + LLCV +   DR  M+SVV ML +    LP PK P F    R   E  +  K +
Sbjct: 720 MKCIQIGLLCVQENASDRVDMSSVVIMLGHNATNLPNPKHPAFTSARRRGGENGACLKGQ 779

Query: 133 CCYEIAMITFSTLEGR 86
               +  +TFS ++GR
Sbjct: 780 TGISVNDVTFSDIQGR 795



>gb:AY052585_1562781 Raphanus sativus haplotype S10 S-locus receptor
           kinase (SRK) gene, partial cds.
          Length = 288

 Score =  176 bits (447), Expect(2) = 8e-52
 Identities = 83/156 (53%), Positives = 107/156 (68%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+F + R     W+ RF I  G++RGL+YLHQDSR +IIHRD+K  NILLD  + PKI
Sbjct: 44  DYFLFGKKRSSNLNWKDRFAITNGVARGLVYLHQDSRFRIIHRDMKAGNILLDKNMIPKI 103

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLARI+  D   A T   IGTYGYMSPEY + G  S K+DVFS GVI+LE+++G++N
Sbjct: 104 SDFGLARIIARDQTEASTDNPIGTYGYMSPEYAMYGILSEKTDVFSFGVIVLEIVTGKRN 163

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           R F+ S    NL+ +AW  W  G   E++D  + DS
Sbjct: 164 RGFYQSTPEDNLVCYAWTHWAQGRALEIVDPVIVDS 199



 Score = 50.4 bits (119), Expect(2) = 8e-52
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 5/63 (7%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF-----FVERNSTEASST 146
           L+CI + LLC+ +    RPTM+SVV+ML +E  A+P+PK P +     F   N + +  +
Sbjct: 210 LKCIQIGLLCIQERAVHRPTMSSVVWMLGSEATAIPQPKPPVYCLIPSFYANNPSSSRPS 269

Query: 145 DKE 137
           D +
Sbjct: 270 DND 272



>gb:AP003863_1834484 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1058_A12.>gb:AP005810_1858255 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0696F12.
          Length = 699

 Score =  167 bits (423), Expect(2) = 1e-51
 Identities = 79/151 (52%), Positives = 108/151 (71%), Gaps = 1/151 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W+ R+ I  G++RGL YLH+DS+LK++HRDLK SNILLDA +NPKI
Sbjct: 474 DLILFDTEKREKLDWEKRYRIINGVARGLQYLHEDSQLKVVHRDLKASNILLDANMNPKI 533

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           S+FGLARI  +D   A T RV+ TYGYM+PEY++ GN+SVKSD FS GV++LE+++GRKN
Sbjct: 534 SNFGLARIFGQDQTQAVTNRVVDTYGYMAPEYMMRGNYSVKSDAFSFGVMVLEIVTGRKN 593

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMD 348
             F+++ H   +LL   W  W  G   E++D
Sbjct: 594 NDFYNNSHQSEDLLNTIWERWMAGTVDEMVD 624



 Score = 59.3 bits (142), Expect(2) = 1e-51
 Identities = 26/57 (45%), Positives = 35/57 (61%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKE 137
           +C+HVALLCV + P DRP M+SVV ML++E V+L  P +P FF      +      E
Sbjct: 638 KCVHVALLCVQENPADRPVMSSVVMMLDSETVSLQVPSKPAFFARNGGAKPGVASDE 694



>pir|T06082|T06082 protein kinase homolog T9A14.110 - Arabidopsis
           thaliana>gb:ATCHRIV90_1547867 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 90.>gb:ATT9A14_1556560
           Arabidopsis thaliana DNA chromosome 4, BAC clone T9A14
           (ESSA project).
          Length = 665

 Score =  168 bits (426), Expect(2) = 2e-51
 Identities = 84/173 (48%), Positives = 115/173 (66%), Gaps = 1/173 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +     W+ R+ I  G++RGLLYLHQDSRL+IIHRDLK SNILLD E+ PKI
Sbjct: 426 DKFIFDPIQGNELEWEIRYKIIGGVARGLLYLHQDSRLRIIHRDLKASNILLDEEMTPKI 485

Query: 617 SDFGLARIVEEDDGLAK-TKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRK 441
           +DFG+AR+ + D    + T R++GT+GYM+PEYV+ G FS K+DV+S GV++LE+ISG+K
Sbjct: 486 ADFGMARLFDIDHTTQRYTNRIVGTFGYMAPEYVMHGQFSFKTDVYSFGVLVLEIISGKK 545

Query: 440 NRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSCSSSL 282
           N  F   D   +L+  AW  W +G    L+D           + TM S SS++
Sbjct: 546 NSGFSSEDSMGDLISFAWRNWKEGVALNLVDKI---------LMTMSSYSSNM 589



 Score = 57.0 bits (136), Expect(2) = 2e-51
 Identities = 25/55 (45%), Positives = 37/55 (67%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASST 146
           +RCI++ LLCV +   +RP+MASVV ML+   +AL +P +P FF   N+   SS+
Sbjct: 591 MRCINIGLLCVQEKVAERPSMASVVLMLDGHTIALSEPSKPAFFSHSNAVSDSSS 645



>gb:AP005810_1858257 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0696F12.
          Length = 638

 Score =  175 bits (444), Expect(2) = 2e-51
 Identities = 85/162 (52%), Positives = 110/162 (67%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W+ R+ I  GI+RGL YLH+DS+LK++HRDLK SNILLD  +NPKI
Sbjct: 408 DLILFDTEKSEQLDWEKRYKIINGIARGLQYLHEDSQLKVVHRDLKASNILLDVNMNPKI 467

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLARI   D   A TK VIGTYGYM+PEY+  GN+SVKSDVFS GV++LE+++GRKN
Sbjct: 468 SDFGLARIFGRDQTQAVTKNVIGTYGYMAPEYLTRGNYSVKSDVFSFGVMVLEIVTGRKN 527

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              ++S    +LL   W  W  G   E++D  +   + ES V
Sbjct: 528 NHSYNSQQSEDLLTMIWEQWVAGTVLEMVDPSMNSFFSESDV 569



 Score = 50.1 bits (118), Expect(2) = 2e-51
 Identities = 23/53 (43%), Positives = 31/53 (58%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS 152
           +RCIH+ LLCV   P +RP M+SVV ML  + V L  P +P  F  +   + S
Sbjct: 570 MRCIHIGLLCVQGDPANRPVMSSVVLMLGTDTVELHAPAKPTLFARKGGGDES 622



>gb:AB013717S2_1512251 Brassica rapa gene for SRK46Bra, exon 2, 3, 4,
            5, 6, 7 and complete cds.
          Length = 860

 Score =  174 bits (442), Expect(2) = 3e-51
 Identities = 81/156 (51%), Positives = 107/156 (68%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 613  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 672

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+   +T   +GTYGYMSPEY + G  S K+DVFS GVI+LE++ G++N
Sbjct: 673  SDFGMARIFARDETQVRTDNAVGTYGYMSPEYAMYGVISEKTDVFSFGVIVLEIVIGKRN 732

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F+  +  +NL  +AW  W +G   E++D  + DS
Sbjct: 733  RGFYQVNPENNLPSYAWTHWAEGRALEIVDPVILDS 768



 Score = 50.4 bits (119), Expect(2) = 3e-51
 Identities = 21/41 (51%), Positives = 30/41 (73%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P
Sbjct: 782 LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPP 822



>pir|JC2481|JC2481 S-receptor kinase (EC 2.7.1.-) 8 precursor - field
            mustard>gb:BOLRPKA_1633857 Brassica campestris mRNA for
            receptor protein kinase SRK8, complete cds.
          Length = 858

 Score =  174 bits (442), Expect(2) = 3e-51
 Identities = 81/156 (51%), Positives = 107/156 (68%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 611  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 670

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   D+   +T   +GTYGYMSPEY + G  S K+DVFS GVI+LE++ G++N
Sbjct: 671  SDFGMARIFARDETQVRTDNAVGTYGYMSPEYAMYGVISEKTDVFSFGVIVLEIVIGKRN 730

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F+  +  +NL  +AW  W +G   E++D  + DS
Sbjct: 731  RGFYQVNPENNLPSYAWTHWAEGRALEIVDPVILDS 766



 Score = 50.4 bits (119), Expect(2) = 3e-51
 Identities = 21/41 (51%), Positives = 30/41 (73%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P
Sbjct: 780 LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPP 820



>gb:OSJN00019_1693370 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 827

 Score =  173 bits (439), Expect(2) = 5e-51
 Identities = 88/162 (54%), Positives = 112/162 (69%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +   +  W TRF I  G++RGLLYLHQDSRL +IHRDLK SNILLD +++PKI
Sbjct: 602  DAFIFDHANKYVLDWPTRFKIIKGVARGLLYLHQDSRLTVIHRDLKPSNILLDVDMSPKI 661

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI   +   A T RV+GTYGYMSPEY +DG FSVKSD +S GVILLE++S  K 
Sbjct: 662  SDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGAFSVKSDTYSFGVILLEIVSCLKI 721

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                 +D   NLL +AW LW +    +LMD+ +  S   ++V
Sbjct: 722  SLPRLTD-FPNLLAYAWNLWKNDRAMDLMDSSISKSCSPTEV 762



 Score = 50.8 bits (120), Expect(2) = 5e-51
 Identities = 24/47 (51%), Positives = 29/47 (61%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER 170
           L CI + LLCV   P +RP M+SVV MLENE   L  P +P +F  R
Sbjct: 763 LLCIQIGLLCVQDNPNNRPLMSSVVSMLENETTTLSAPIQPVYFAHR 809



>gb:AP003368_1828581 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC
            clone:B1100D10.>gb:AP003406_1828882 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:B1070A12.
          Length = 809

 Score =  165 bits (417), Expect(2) = 7e-51
 Identities = 81/142 (57%), Positives = 104/142 (73%)
 Frame = -3

Query: 737  IATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDGLAKTKR 558
            I  GI++GLLYLH+ SR +IIHRDLK SNILLD ++NPKISDFG+ARI    +  A T R
Sbjct: 596  IIEGIAQGLLYLHKHSRFRIIHRDLKASNILLDIDMNPKISDFGMARIFGSKETEANTNR 655

Query: 557  VIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLGHAWLLW 378
            V+GTYGYM+PEY ++G FSVKSDVFS GV+LLE++SG +N  FH   +  NLL +AW LW
Sbjct: 656  VVGTYGYMAPEYAMEGIFSVKSDVFSFGVLLLEIVSGIRNAGFHQRGNSLNLLCYAWELW 715

Query: 377  NDGNPFELMDNCVRDSYVESQV 312
             +G   EL D  + ++  E +V
Sbjct: 716  KEGRWSELADPSIYNACPEHKV 737



 Score = 58.9 bits (141), Expect(2) = 7e-51
 Identities = 27/54 (50%), Positives = 35/54 (64%)
 Frame = -1

Query: 316 K*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA 155
           K LRCIHV L+CV + P +RPTM  ++  L+NE   LP+PK+P F      TEA
Sbjct: 736 KVLRCIHVGLMCVQESPINRPTMTEIISALDNESTTLPEPKQPAFVSAGIWTEA 789



>pir|JC2482|JC2482 S-receptor kinase (EC 2.7.1.-) 12 precursor - field
            mustard  (fragment)
          Length = 856

 Score =  170 bits (431), Expect(2) = 2e-50
 Identities = 79/156 (50%), Positives = 106/156 (67%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            DYF+F + R     W+ RF I  G++RGLLYLHQDSR +IIHRDLK  NILLD  + PKI
Sbjct: 609  DYFLFGKKRSSNLNWKDRFAITNGVARGLLYLHQDSRFRIIHRDLKPGNILLDKYMIPKI 668

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI    +   +T   +GTYGYMSP+Y + G  S K+DVFS GVI+LE++SG++N
Sbjct: 669  SDFGMARIFIRAETQVRTDNAVGTYGYMSPDYAMYGVISEKTDVFSFGVIVLEIVSGKRN 728

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
            R F+  +  +NL  + W  W +G   E++D  + DS
Sbjct: 729  RGFYQVNPENNLPSYVWTHWAEGRALEIVDPVILDS 764



 Score = 51.6 bits (122), Expect(2) = 2e-50
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 6/81 (7%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP------GFFVERNSTEASS 149
            L+CI + LLC+ +  E RPTM+SVV+ML +E   +P+PK P       ++    S+    
Sbjct: 778  LKCIQIGLLCIQERAEHRPTMSSVVWMLGSEATEIPQPKPPVYCLIASYYANNPSSSRQF 837

Query: 148  TDKERCCYEIAMITFSTLEGR 86
             D E   + +   T+S ++ R
Sbjct: 838  DDDE--SWTVDKYTWSVIDAR 856



>gb:AP003863_1834480 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1058_A12.>gb:AP005810_1858251 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0696F12.
          Length = 678

 Score =  160 bits (405), Expect(2) = 2e-50
 Identities = 75/166 (45%), Positives = 109/166 (65%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD SR     W+  + I  GI++G+LYLH+DS L+IIHRDLK++NILL  ++ PKI
Sbjct: 434 DNFLFDTSRGNTPNWEQLYNIIFGIAKGILYLHEDSSLRIIHRDLKSNNILLGEDMEPKI 493

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLAR++EE     +T R++GT+GYM+PEY + GN S K DV S GV++LE+++GR+N
Sbjct: 494 ADFGLARLLEEGHTNTRTTRIVGTFGYMAPEYAIHGNVSTKIDVLSFGVLVLEIVTGRRN 553

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMH 300
               D D   NLL   W  W  G   +L+D  + + +    +  +H
Sbjct: 554 LNSDDHD-RGNLLSDVWNCWTKGTVTQLIDQSLEEQFRRQALRCIH 598



 Score = 61.6 bits (148), Expect(2) = 2e-50
 Identities = 27/53 (50%), Positives = 35/53 (66%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS 152
           LRCIH+ LLCV   P+DRP M+SV+FML  E + L  P +P FF + +S   S
Sbjct: 594 LRCIHIGLLCVQSDPDDRPHMSSVIFMLSRENMNLQPPAQPAFFFDGDSNSCS 646



>gb:AY303171_1597402 Solanum bulbocastanum chromosome 8 clone
           177O13, complete sequence.
          Length = 761

 Score =  153 bits (386), Expect(2) = 4e-50
 Identities = 73/155 (47%), Positives = 103/155 (66%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  R  +  WQ R+ I  GI++GLLYLH+ SR+++IHRDLK SN+LLD  +NPKI
Sbjct: 546 DFFLFDPERKKLLDWQKRYEIIEGIAQGLLYLHKYSRMRVIHRDLKASNVLLDENMNPKI 605

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI ++++  A T RV+GTYGYM+PE+ ++G FS+KSDVFS G+++LE+      
Sbjct: 606 ADFGMARIFKQNETEAVTARVVGTYGYMAPEFAMEGAFSIKSDVFSFGILMLEI------ 659

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRD 333
                          AW LW +G   EL D  + D
Sbjct: 660 ---------------AWELWKEGCALELKDPALGD 679



 Score = 68.2 bits (165), Expect(2) = 4e-50
 Identities = 34/75 (45%), Positives = 45/75 (60%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LR IHV LLCV +   DRPTM+ V+ ML NE + LP PK+P FF  RN TE+ S   +  
Sbjct: 687 LRVIHVGLLCVQEGATDRPTMSDVISMLGNESMPLPTPKQPAFFTGRNETESHSAGIKAE 746

Query: 130 CYEIAMITFSTLEGR 86
            Y +   + + +E R
Sbjct: 747 QYSVNDCSITVIEAR 761



>gb:AP003811_1833701 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1131_E05.>gb:AP006753_1862872 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039D04.
          Length = 656

 Score =  174 bits (440), Expect(2) = 4e-50
 Identities = 84/157 (53%), Positives = 108/157 (68%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+ D  R     W+TR  I  GI++GLLYLH+ SRL+IIHRDLK SNILLD+ELNPKI
Sbjct: 424 DHFLVDPIRRTSLNWKTRRKIVEGIAQGLLYLHKHSRLRIIHRDLKASNILLDSELNPKI 483

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   D   AK  R++GT+GYM+PEY  +G  S+KSDVFS GV+LLE++SG ++
Sbjct: 484 SDFGMARIFPSDASRAKASRLVGTFGYMAPEYASEGLISIKSDVFSFGVLLLEIMSGTRS 543

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
             F       NLL +AW +W DG   + +D    D Y
Sbjct: 544 AGFQHYGEFQNLLEYAWGMWKDGRWCDFIDQSFGDEY 580



 Score = 47.4 bits (111), Expect(2) = 4e-50
 Identities = 18/43 (41%), Positives = 32/43 (74%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF 182
           ++C+ VAL+CV +   +RPTM+ VV ML ++++ L +PK+P +
Sbjct: 586 MKCLVVALMCVQEKSAERPTMSDVVAMLSSDDIPLTEPKQPAY 628



>gb:AP003863_1834477 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1058_A12.
          Length = 673

 Score =  164 bits (414), Expect(2) = 5e-50
 Identities = 76/150 (50%), Positives = 104/150 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W  RF I  GI+R L YLH+DS+L+IIHRDLK SN+LLD++ NPKI
Sbjct: 427 DTILFDLEKRKELDWGKRFRIINGIARALQYLHEDSQLRIIHRDLKASNVLLDSDYNPKI 486

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+ E D     T RV+GTYGYM+PEY + G++SVKSDVFS G++++E+++GR++
Sbjct: 487 SDFGLARLFEGDQTREVTSRVVGTYGYMAPEYAMRGHYSVKSDVFSFGILMIEIVTGRRS 546

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
              +  D  ++LL   W  W  G   E+MD
Sbjct: 547 SGSYSFDQSYDLLSRVWEHWTMGTILEMMD 576



 Score = 57.0 bits (136), Expect(2) = 5e-50
 Identities = 23/53 (43%), Positives = 36/53 (67%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS 152
           L+CIH+ LLCV   P DRP M++V  ML +  V+L  P +P FF+ ++ T+++
Sbjct: 589 LKCIHIGLLCVQDNPADRPMMSTVNIMLSSNTVSLQSPSKPSFFIPKSGTDSN 641



>gb:AP003863_1834472 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1058_A12.
          Length = 670

 Score =  169 bits (428), Expect(2) = 5e-50
 Identities = 80/151 (52%), Positives = 104/151 (68%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  R  +  W  R  I   I+RGL YLH+DS+LKIIHRDLK SN+LLD++ NPKI
Sbjct: 442 DTILFDPDRSNVLDWWKRLKIVNAIARGLQYLHEDSQLKIIHRDLKASNVLLDSDFNPKI 501

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+   D     T RV+GTYGYM+PEY + G++S+KSDVFS GV++LE+++GRKN
Sbjct: 502 SDFGLARLFGNDQSQDVTNRVVGTYGYMAPEYAMRGHYSIKSDVFSFGVLILEIVTGRKN 561

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDN 345
              +DS+   +LL   W  W  G   EL D+
Sbjct: 562 NVSYDSEQSVDLLTLVWEHWLAGTVVELADS 592



 Score = 51.6 bits (122), Expect(2) = 5e-50
 Identities = 21/54 (38%), Positives = 34/54 (62%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS 149
           L+C+H+ LLCV + P +RP M+ V  ML +  V+L  P  P F ++++S  + S
Sbjct: 604 LKCVHIGLLCVQEDPTERPMMSMVNVMLSSSTVSLQAPSRPAFCIQKSSVNSDS 657



>pir|F85057|F85057 receptor-like protein kinase [imported] -
           Arabidopsis thaliana>gb:ATCHRIV13_1544301 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           13.>gb:AY127017_1580471 Arabidopsis thaliana
           AT4g04570/F4H6_9 mRNA, complete cds.>gb:AF074021_1765944
           Arabidopsis thaliana BAC F4H6, chromosome IV, complete
           sequence.
          Length = 654

 Score =  176 bits (445), Expect(2) = 5e-50
 Identities = 83/150 (55%), Positives = 109/150 (72%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FDE +  + TW+ RF I  GI+RGLLYLH+DS+LKIIHRDLK SNILLDAE+NPK+
Sbjct: 430 DHFIFDEDKRSLLTWEVRFRIIEGIARGLLYLHEDSQLKIIHRDLKASNILLDAEMNPKV 489

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG AR+ + D+  A+TKR+ GT GYM+PEY+  G  S KSDV+S GV+LLE+ISG +N
Sbjct: 490 ADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGERN 549

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
            +F        L   AW  W +G P  ++D
Sbjct: 550 NSFEG----EGLAAFAWKRWVEGKPEIIID 575



 Score = 45.1 bits (105), Expect(2) = 5e-50
 Identities = 20/54 (37%), Positives = 33/54 (61%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS 149
           ++ I + LLCV +    RPTM+SV+  L +E + +P PK P F   R+ +E+ +
Sbjct: 587 IKLIQIGLLCVQENSTKRPTMSSVIIWLGSETIIIPLPKAPAFTWIRSQSESGA 640



>gb:BT010572_1640518 Arabidopsis thaliana At4g23300 gene, complete
           cds.>gb:AK176570_1818558 Arabidopsis thaliana mRNA for
           serine/threonine kinase - like protein, complete cds,
           clone: RAFL25-10-G15.
          Length = 660

 Score =  163 bits (413), Expect(2) = 7e-50
 Identities = 76/165 (46%), Positives = 114/165 (69%), Gaps = 3/165 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD  + G   W  R+ I  GI++G+L+LHQD +L II+RD K SNILLDA++NPKI
Sbjct: 435 DYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKI 494

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+A +   ++    T  +  T+ YMSPEY V G FS+KSDV+S G+++LE+ISG+KN
Sbjct: 495 SDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKN 554

Query: 437 RAFHDSDH---HHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            + + +D      NL+ +AW LW +G+  +L+D+ +  +Y  ++V
Sbjct: 555 SSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEV 599



 Score = 57.0 bits (136), Expect(2) = 7e-50
 Identities = 23/43 (53%), Positives = 33/43 (76%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           RCIH+ALLCV + PEDRP ++++V ML +  +++P P  PGFF
Sbjct: 601 RCIHIALLCVQENPEDRPKLSTIVSMLTSNTISVPAPGIPGFF 643



>pir|T04847|T04847 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.190 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546167 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549632
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 643

 Score =  163 bits (413), Expect(2) = 7e-50
 Identities = 76/165 (46%), Positives = 114/165 (69%), Gaps = 3/165 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD  + G   W  R+ I  GI++G+L+LHQD +L II+RD K SNILLDA++NPKI
Sbjct: 418 DYFLFDPEKQGELDWTRRYKIIGGIAQGILHLHQDPQLTIIYRDFKASNILLDADMNPKI 477

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+A +   ++    T  +  T+ YMSPEY V G FS+KSDV+S G+++LE+ISG+KN
Sbjct: 478 SDFGMATVFGMEESRGNTNWIAETFVYMSPEYAVHGKFSMKSDVYSFGILILEIISGKKN 537

Query: 437 RAFHDSDH---HHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            + + +D      NL+ +AW LW +G+  +L+D+ +  +Y  ++V
Sbjct: 538 SSLYQNDETTTAGNLVTYAWRLWRNGSQLKLLDSSIGRNYQSNEV 582



 Score = 57.0 bits (136), Expect(2) = 7e-50
 Identities = 23/43 (53%), Positives = 33/43 (76%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           RCIH+ALLCV + PEDRP ++++V ML +  +++P P  PGFF
Sbjct: 584 RCIHIALLCVQENPEDRPKLSTIVSMLTSNTISVPAPGIPGFF 626



>gb:AF224707_1778586 Arabidopsis thaliana receptor-like protein
           kinase 6 (RLK6) mRNA, complete cds.
          Length = 659

 Score =  198 bits (504), Expect = 9e-50
 Identities = 98/187 (52%), Positives = 132/187 (70%), Gaps = 2/187 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD        W TR+ I  GI+RG+LYLHQDSRL IIHRDLK  NILLDA++NPK+
Sbjct: 422 DYFLFDSRMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKV 481

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI E D   A T+RV+GTYGYMSPEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 482 ADFGMARIFEIDQTEAHTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGRKN 541

Query: 437 RAFHDSD-HHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ-VATMHSCSSSLRFETTR 264
            + +  D    NL+ + W LW+DG+P +L+D+  RDSY  ++ +  +H     ++ +T  
Sbjct: 542 SSLYQMDASFGNLVTYTWRLWSDGSPLDLVDSSFRDSYQRNEIIRCIHIALLCVQEDTEN 601

Query: 263 R*TNNGI 243
           R T + I
Sbjct: 602 RPTMSAI 608



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS-STDKER 134
           +RCIH+ALLCV +  E+RPTM+++V ML    +AL  P+ PGFF   N  +A  S DK  
Sbjct: 585 IRCIHIALLCVQEDTENRPTMSAIVQMLTTSSIALAVPQPPGFFFRSNHEQAGPSMDKSS 644

Query: 133 CC 128
            C
Sbjct: 645 LC 646



>gb:AY142496_1582925 Arabidopsis thaliana putative protein kinase
           (At4g23130) mRNA, complete cds.
          Length = 663

 Score =  198 bits (504), Expect = 9e-50
 Identities = 98/187 (52%), Positives = 132/187 (70%), Gaps = 2/187 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD        W TR+ I  GI+RG+LYLHQDSRL IIHRDLK  NILLDA++NPK+
Sbjct: 426 DYFLFDSRMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKV 485

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI E D   A T+RV+GTYGYMSPEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 486 ADFGMARIFEIDQTEAHTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGRKN 545

Query: 437 RAFHDSD-HHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ-VATMHSCSSSLRFETTR 264
            + +  D    NL+ + W LW+DG+P +L+D+  RDSY  ++ +  +H     ++ +T  
Sbjct: 546 SSLYQMDASFGNLVTYTWRLWSDGSPLDLVDSSFRDSYQRNEIIRCIHIALLCVQEDTEN 605

Query: 263 R*TNNGI 243
           R T + I
Sbjct: 606 RPTMSAI 612



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS-STDKER 134
           +RCIH+ALLCV +  E+RPTM+++V ML    +AL  P+ PGFF   N  +A  S DK  
Sbjct: 589 IRCIHIALLCVQEDTENRPTMSAIVQMLTTSSIALAVPQPPGFFFRSNHEQAGPSMDKSS 648

Query: 133 CC 128
            C
Sbjct: 649 LC 650



>pir|T04830|T04830 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.20 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546150 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549615
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).>gb:ATF7H19_1550956 Arabidopsis thaliana
           DNA chromosome 4, BAC clone F7H19 (ESSA project).
          Length = 650

 Score =  198 bits (504), Expect = 9e-50
 Identities = 98/187 (52%), Positives = 132/187 (70%), Gaps = 2/187 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD        W TR+ I  GI+RG+LYLHQDSRL IIHRDLK  NILLDA++NPK+
Sbjct: 413 DYFLFDSRMQSQLDWTTRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDADMNPKV 472

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI E D   A T+RV+GTYGYMSPEY + G FS+KSDV+S GV++LE+ISGRKN
Sbjct: 473 ADFGMARIFEIDQTEAHTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGRKN 532

Query: 437 RAFHDSD-HHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ-VATMHSCSSSLRFETTR 264
            + +  D    NL+ + W LW+DG+P +L+D+  RDSY  ++ +  +H     ++ +T  
Sbjct: 533 SSLYQMDASFGNLVTYTWRLWSDGSPLDLVDSSFRDSYQRNEIIRCIHIALLCVQEDTEN 592

Query: 263 R*TNNGI 243
           R T + I
Sbjct: 593 RPTMSAI 599



 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 1/62 (1%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS-STDKER 134
           +RCIH+ALLCV +  E+RPTM+++V ML    +AL  P+ PGFF   N  +A  S DK  
Sbjct: 576 IRCIHIALLCVQEDTENRPTMSAIVQMLTTSSIALAVPQPPGFFFRSNHEQAGPSMDKSS 635

Query: 133 CC 128
            C
Sbjct: 636 LC 637



>gb:AP003736_1832655 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1008_E09.>gb:AP005786_1857853 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0458H05.
          Length = 702

 Score =  166 bits (421), Expect(2) = 9e-50
 Identities = 82/155 (52%), Positives = 105/155 (67%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W  RF I  GI+RGL YLH+DS+LKI+HRDLK SNILLD + +PKI
Sbjct: 452 DIVLFDTDKNRELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNILLDFDYSPKI 511

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA+I   D     T R+ GTYGYM+PEY + GN+S+KSDVFS GV++LE+I+GR+N
Sbjct: 512 SDFGLAKIFGGDQSEDVTNRIAGTYGYMAPEYAMRGNYSIKSDVFSFGVLVLEIITGRRN 571

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRD 333
              +DS    +LL   W  W  GN  EL+D  + D
Sbjct: 572 TGSYDSGQDVDLLNLVWEHWTRGNVVELIDPSMGD 606



 Score = 53.5 bits (127), Expect(2) = 9e-50
 Identities = 25/54 (46%), Positives = 32/54 (59%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS 149
           L+CIH+ LLCV K P  RPT++SV  ML +  V LP    P F ++  S   SS
Sbjct: 614 LKCIHIGLLCVQKKPASRPTISSVNIMLSSNTVRLPSLSRPAFCIQEVSASDSS 667



>gb:AP003736_1832650 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1008_E09.>gb:AP005786_1857848 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0458H05.
          Length = 682

 Score =  167 bits (423), Expect(2) = 9e-50
 Identities = 81/150 (54%), Positives = 104/150 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W  RF I  GI++GL YLH+DSRLKI+HRDLK SNILLD + NPKI
Sbjct: 447 DTILFDIDKNIELDWGKRFKIINGIAQGLQYLHEDSRLKIVHRDLKASNILLDFDYNPKI 506

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA+I + D     T R+ GTYGYM+PEY + G++SVK DVFS GV++LE+++GR+N
Sbjct: 507 SDFGLAKIFDGDQSKDITHRIAGTYGYMAPEYAMHGHYSVKLDVFSFGVLVLEIVTGRRN 566

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
              +DS    +LL H W  W  GN  EL+D
Sbjct: 567 SGSYDSGQDLDLLNHVWGHWTRGNVVELID 596



 Score = 52.8 bits (125), Expect(2) = 9e-50
 Identities = 25/54 (46%), Positives = 32/54 (59%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS 149
           L+CIH+ LLCV K P  RPT++SV  ML +  V LP    P F ++  S   SS
Sbjct: 609 LKCIHIGLLCVQKRPASRPTISSVNIMLSSNTVRLPSLSRPAFCIQDVSASDSS 662



>gb:AP004688_1843412 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0036C11.
          Length = 434

 Score =  176 bits (445), Expect(2) = 9e-50
 Identities = 81/161 (50%), Positives = 114/161 (70%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F+E +     W TR  I  GI+RGLLYLH+DS LK++HRDLK SN+LLD +++PKI
Sbjct: 191 DAFLFNEGKSAQLGWATRHNIIVGIARGLLYLHEDSLLKVVHRDLKASNVLLDDKMSPKI 250

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+A+I E++     T RV+GTYGYM+PE+ ++G +SVKSDVFS GV+LLE++SG++N
Sbjct: 251 SDFGMAKIFEDECNEVNTGRVVGTYGYMAPEFALEGVYSVKSDVFSFGVLLLEILSGQRN 310

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
            A +  +H  +L+  AW LW +G   E MD  +   Y   +
Sbjct: 311 GALYLEEHQQSLIQDAWKLWTEGLAAEFMDPALGRGYAAEE 351



 Score = 44.3 bits (103), Expect(2) = 9e-50
 Identities = 19/43 (44%), Positives = 28/43 (65%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           RC HV LLCV +  + RPTM++V+  L ++ + LP+P  P  F
Sbjct: 354 RCYHVGLLCVQEDADARPTMSNVLLALISDHMNLPEPSRPPMF 396



>pir|C85057|C85057 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:ATCHRIV12_1544298 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           12.>gb:AF076243_1766171 Arabidopsis thaliana BAC T26N6
           from chromosome IV at 19.3 cM, complete sequence.
          Length = 659

 Score =  173 bits (438), Expect(2) = 2e-49
 Identities = 81/150 (54%), Positives = 109/150 (72%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD+ +  + TW+ R+ I  GI+RGLLYLH+DS+LKIIHRDLK SNILLDAE+NPK+
Sbjct: 435 DHFIFDDEKRSLLTWEMRYRIIEGIARGLLYLHEDSQLKIIHRDLKASNILLDAEMNPKV 494

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG AR+ + D+  A+TKR+ GT GYM+PEY+  G  S KSDV+S GV+LLE+ISG +N
Sbjct: 495 ADFGTARLFDSDETRAETKRIAGTRGYMAPEYLNHGQISAKSDVYSFGVMLLEMISGERN 554

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
            +F        L   AW  W +G P  ++D
Sbjct: 555 NSFEG----EGLAAFAWKRWVEGKPEIIID 580



 Score = 46.2 bits (108), Expect(2) = 2e-49
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTE 158
           ++ I + LLCV + P  RPTM+SV+  L +E   +P PK P F   R+ +E
Sbjct: 592 IKLIQIGLLCVQENPTKRPTMSSVIIWLGSETNIIPLPKAPAFTGSRSQSE 642



>pir|T04846|T04846 protein kinase homolog F21P8.180 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546166 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549631
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 682

 Score =  159 bits (401), Expect(2) = 3e-49
 Identities = 80/136 (58%), Positives = 98/136 (72%), Gaps = 1/136 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD  +     W  R  I  GI+RG+LYLHQDSRL IIHRDLK SNILLDAE+NPKI
Sbjct: 434 DHFLFDPIKRVQLDWPRRHNIIEGITRGILYLHQDSRLTIIHRDLKASNILLDAEMNPKI 493

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLAR    +   A T RV+GT+GYM PEYV +G FS KSDV+S GV++LE+I G+KN
Sbjct: 494 ADFGLARNFRVNQTEANTGRVVGTFGYMPPEYVANGQFSTKSDVYSFGVLILEIIGGKKN 553

Query: 437 RAFHDSDHH-HNLLGH 393
            +FH  D    NL+ H
Sbjct: 554 SSFHQIDGSVSNLVTH 569



 Score = 59.7 bits (143), Expect(2) = 3e-49
 Identities = 24/49 (48%), Positives = 34/49 (69%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNS 164
           +RCIH+ LLCV + P+DRP+M+++  ML N  + LP P+ PGFF    S
Sbjct: 600 IRCIHIGLLCVQENPDDRPSMSTIFRMLTNVSITLPVPQPPGFFFRERS 648



>gb:AP005810_1858256 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0696F12.
          Length = 649

 Score =  156 bits (394), Expect(2) = 3e-49
 Identities = 76/161 (47%), Positives = 111/161 (68%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD SR     W  ++ I  GI++G+LYLH+DS L+IIHRDLK++NIL+  ++ PKI
Sbjct: 429 DNFLFDPSRGNALNWDQQYNIILGIAKGILYLHEDSSLRIIHRDLKSNNILVGDDMEPKI 488

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLAR++ E    +KT RV+GT+GYM+PEY +DGN S K D+FS GV++LE+I+ R+N
Sbjct: 489 ADFGLARLLGEGHTHSKTTRVVGTFGYMAPEYAIDGNVSTKIDIFSFGVLVLEIITRRRN 548

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
             +H  D  H+L+   W  W  G   +++   + + Y ESQ
Sbjct: 549 --WHSDD--HDLVSDVWNCWTKGTATKMIYQSL-NGYSESQ 584



 Score = 62.4 bits (150), Expect(2) = 3e-49
 Identities = 27/52 (51%), Positives = 35/52 (67%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA 155
           LRCIH+ LLCV   P+DRP M+S++FML  E + L  P EP FF+ R S  +
Sbjct: 586 LRCIHIGLLCVQPDPDDRPHMSSIIFMLTKENMKLQPPAEPAFFLGRESASS 637



>gb:AP003863_1834475 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1058_A12.
          Length = 678

 Score =  161 bits (408), Expect(2) = 5e-49
 Identities = 77/162 (47%), Positives = 107/162 (66%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD SR     W+ R+ I  GI++G+LYLH+DS ++IIHRDLK +NILLD  +NPKI
Sbjct: 430 DIFLFDTSRAKTLNWEQRYNIILGIAKGILYLHEDSSIRIIHRDLKANNILLDENMNPKI 489

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGL R++       KT  V+GTYGYM+PEY + G  S K D+FS GV++LE+++GR+N
Sbjct: 490 ADFGLGRLLGGGHTQTKTATVVGTYGYMAPEYALFGKVSPKIDIFSFGVLVLEIVTGRRN 549

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             F  + +  NLL   W  W  G   +L D  + D Y +S+V
Sbjct: 550 SGFDTTYNAVNLLTEVWNCWTKGTALQLADQSL-DGYSDSKV 590



 Score = 56.2 bits (134), Expect(2) = 5e-49
 Identities = 23/46 (50%), Positives = 33/46 (71%)
 Frame = -1

Query: 316 K*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           K LRCIH+ LLCV + P DRP+++SV+ ML    + L +P++P FF
Sbjct: 589 KVLRCIHIGLLCVQESPIDRPSISSVILMLTRRRIKLQQPRQPAFF 634



>gb:AP004260_1839289 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0011H09.>gb:AP004306_1839942 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0506F02.
          Length = 670

 Score =  166 bits (419), Expect(2) = 6e-49
 Identities = 81/154 (52%), Positives = 107/154 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +     W  RF+I  GI+ GL YLH+DS+LKIIHRDLK SN+LLDA +NPKI
Sbjct: 420 DTFLFDPEKRKQIDWAKRFMIIKGITGGLQYLHEDSQLKIIHRDLKASNVLLDANMNPKI 479

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+  +D     T RV+GTYGYM+PEY + G +S+KSDV+S GV+LLE+I+GRKN
Sbjct: 480 SDFGLARLFGDDQSQETTNRVVGTYGYMAPEYALRGQYSIKSDVYSFGVLLLEIITGRKN 539

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVR 336
              ++S+   +LL   W  W      E++D  +R
Sbjct: 540 SDSYNSEQAVDLLSLVWEHWAMKTITEMVDPYLR 573



 Score = 51.6 bits (122), Expect(2) = 6e-49
 Identities = 22/46 (47%), Positives = 29/46 (63%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
           LRCIHV L+CV + P DRPT++ +  ML+   V+   P  P FF E
Sbjct: 583 LRCIHVGLVCVQEDPMDRPTLSMINIMLDGNTVSAKAPSRPAFFTE 628



>gb:AP003863_1834478 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1058_A12.>gb:AP005810_1858249 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0696F12.
          Length = 624

 Score =  157 bits (397), Expect(2) = 4e-48
 Identities = 79/162 (48%), Positives = 104/162 (64%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W  R+ I  GI+RGL YLH+DS+LK++HRDLK SNILLD  +NPKI
Sbjct: 389 DQILFDADKRQQLDWGKRYKIINGIARGLQYLHEDSQLKVVHRDLKASNILLDMNMNPKI 448

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+   D     T  VIGTYGYMSPEY + GN+S+KSDVFS GV++LE+++G+KN
Sbjct: 449 SDFGLARLFGRDQTQGVTNLVIGTYGYMSPEYAMRGNYSLKSDVFSFGVMVLEIVTGKKN 508

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              ++S    +LL   W  W      E +D  +   +  S V
Sbjct: 509 NDCYNSLQSEDLLTLVWEQWTARAVSEAVDPVMGGGFSWSDV 550



 Score = 57.4 bits (137), Expect(2) = 4e-48
 Identities = 25/48 (52%), Positives = 33/48 (68%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERN 167
           +RCIH+ LLCV + P DRP M+SVV ML ++ V+L  P +P F   RN
Sbjct: 551 MRCIHIGLLCVQENPADRPVMSSVVMMLGSDTVSLRAPSKPAFCARRN 598



>gb:AJ704376_1813563 Senecio squalidus mRNA for S-receptor kinase-like
            protein 1 (rlk1 gene).
          Length = 637

 Score =  191 bits (486), Expect = 1e-47
 Identities = 99/215 (46%), Positives = 144/215 (66%), Gaps = 1/215 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D+F+FDE+R     W  RF I  GI++GLLYLH+ SR+++IHRDLK +NILLD  LNPKI
Sbjct: 402  DFFLFDENRKAELDWPKRFNIIEGIAQGLLYLHKYSRMRVIHRDLKANNILLDENLNPKI 461

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG+ARI +E++  A T RV+GTYGYMSPEY ++G FS+KSD+FS GV++LE+++GRKN
Sbjct: 462  SDFGMARIFKENETEAMTNRVVGTYGYMSPEYAMEGTFSIKSDIFSFGVLMLEIVTGRKN 521

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY-VESQVATMHSCSSSLRFETTRR 261
             +F   D   NL+G+AW LW  G+  EL D  + ++  ++  + ++H     ++   T R
Sbjct: 522  TSFVHLDRTFNLIGYAWELWQQGDTLELKDPTLGETCGIQQFLRSVHVALLCVQESATDR 581

Query: 260  *TNNGISSFHVGERGSSFT*TKRARLLCGKEFNRS 156
             T + + S  + +  S  T  K A  + GK  ++S
Sbjct: 582  PTTSDMISMLLNDTISLPTPNKPA-FVIGKVESKS 615



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 28/75 (37%), Positives = 48/75 (64%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           LR +HVALLCV +   DRPT + ++ ML N+ ++LP P +P F + +  ++++   KE+ 
Sbjct: 564 LRSVHVALLCVQESATDRPTTSDMISMLLNDTISLPTPNKPAFVIGKVESKSTDESKEKD 623

Query: 130 CYEIAMITFSTLEGR 86
           C  +  +T + +EGR
Sbjct: 624 C-SVNDMTVTVMEGR 637



>gb:AP005786_1857838 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0458H05.
          Length = 696

 Score =  164 bits (414), Expect(2) = 1e-47
 Identities = 76/163 (46%), Positives = 109/163 (66%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +  +  W  R  I  G++RG+ YLH+DS+LKI+HRDLK SN+LLD++ NPKI
Sbjct: 446 DTILFDAEKSSLLDWGRRLKIINGVARGMQYLHEDSQLKIVHRDLKASNVLLDSDYNPKI 505

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+   D     T RV+GTYGYM+PEY + G++SVKSDVFS GV++LE+++GR+N
Sbjct: 506 SDFGLARLFGGDQTQDVTNRVVGTYGYMAPEYAMRGHYSVKSDVFSFGVLVLEIVTGRRN 565

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVA 309
              + S+   +LL   W  W  G   E++D  + +     ++A
Sbjct: 566 SGSYYSEQSGDLLSIIWEHWTMGTIMEMVDRSMGERAAGGEIA 608



 Score = 49.3 bits (116), Expect(2) = 1e-47
 Identities = 21/46 (45%), Positives = 29/46 (63%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER 170
           RCIHV LLCV + P  RP M++V  ML +  V+L  P  P F++ +
Sbjct: 609 RCIHVGLLCVQENPASRPAMSAVNVMLSSGTVSLKAPSRPAFYIRK 654



>pir|T01550|T01550 receptor kinase homolog A_TM018A10.18 -
           Arabidopsis thaliana>gb:ATCHRIV3_1544783 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           3.>gb:TM018A10_1725179 Arabidopsis thaliana BAC
           TM018A10.
          Length = 429

 Score =  155 bits (393), Expect(2) = 2e-47
 Identities = 71/150 (47%), Positives = 103/150 (68%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+++FD +R  I  W+TR+ I +G++RGLLYLH+DSR KI+HRD+K SN+LLD  +NPKI
Sbjct: 199 DHYIFDSNRRMILDWETRYRIISGVARGLLYLHEDSRFKIVHRDMKASNVLLDDAMNPKI 258

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+A++ + D       +   T GYM+PEY + G FSVK+DVFS GV++LE+I G+KN
Sbjct: 259 ADFGMAKLFDTD-------QTSQTSGYMAPEYAMSGEFSVKTDVFSFGVLVLEIIKGKKN 311

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
               + D    LL + W  W +G    ++D
Sbjct: 312 NWSPEEDSSLFLLSYVWKSWREGEVLNIVD 341



 Score = 56.6 bits (135), Expect(2) = 2e-47
 Identities = 27/59 (45%), Positives = 36/59 (61%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKER 134
           ++CIH+ LLCV +  E RPTMASVV ML      LP+P +P F+      E+ S DK +
Sbjct: 355 MKCIHIGLLCVQENAESRPTMASVVVMLNANSFTLPRPSQPAFY--SGDGESLSRDKNQ 411



>gb:LCO580824_1684039 Lotus corniculatus var. japonicus har1 gene and
            genes for transcription factor homolog BTF3-like protein,
            S-receptor kinase-like protein 1, S-receptor kinase-like
            protein 2, S-receptor kinase-like protein 3 and SAR
            DNA-binding protein-like protein.
          Length = 826

 Score =  159 bits (403), Expect(2) = 2e-47
 Identities = 87/161 (54%), Positives = 103/161 (63%), Gaps = 24/161 (14%)
 Frame = -3

Query: 722  SRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDGLAKTKRVIGTY 543
            +R L Y   DSRL+IIHRDLKTSNILLD+E+NPKISDFGLARI   D   AKTKRV+GTY
Sbjct: 563  NRSLDYFIFDSRLRIIHRDLKTSNILLDSEMNPKISDFGLARIFTGDQVEAKTKRVMGTY 622

Query: 542  GYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLGH---------- 393
            GYMSPEY V G+FSVKSDVFS GVI+LE+ISG+K   F D  HH NLL H          
Sbjct: 623  GYMSPEYAVHGSFSVKSDVFSFGVIVLEIISGKKIGRFCDPHHHRNLLSHSSNFAVFLIK 682

Query: 392  --------------AWLLWNDGNPFELMDNCVRDSYVESQV 312
                          AW LW +  P EL+D  +    + +++
Sbjct: 683  ALRICMFENVKNRKAWRLWIEERPLELVDELLDGLAIPTEI 723



 Score = 52.4 bits (124), Expect(2) = 2e-47
 Identities = 32/72 (44%), Positives = 41/72 (56%), Gaps = 3/72 (4%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNS---TEASSTDK 140
           LR IH+ALLCV + PE RP M SVV ML N E  LPKP  P F+   +     E++S + 
Sbjct: 724 LRYIHIALLCVQQRPEYRPDMLSVVLML-NGEKELPKPSLPAFYTGNDDLLWPESTSKNC 782

Query: 139 ERCCYEIAMITF 104
           ER    + +  F
Sbjct: 783 ERVIKHVILNGF 794



>gb:AP005156_1848351 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1729_E01.
          Length = 633

 Score =  171 bits (434), Expect(2) = 7e-47
 Identities = 77/162 (47%), Positives = 115/162 (70%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +     W TRF I  G++RGL YLHQDS+ KI+HRD+K SN+LLDA+LNPKI
Sbjct: 438 DTFLFDVEQRRQLDWATRFRIIEGVARGLQYLHQDSQKKIVHRDMKASNVLLDADLNPKI 497

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            DFGLAR+  +D     T R++GT+GYM+PEYV+ G +S KSDVFS G+++LE+++G++N
Sbjct: 498 GDFGLARLFGQDQTRDVTNRIVGTFGYMAPEYVIRGQYSTKSDVFSFGILILEIVTGQRN 557

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              + ++ + +L+   W  W +GN  E++D  +  +Y E++V
Sbjct: 558 SGPYFAEQNEDLVSLVWRHWTEGNIVEMVDYSLDRNYPEAEV 599



 Score = 38.9 bits (89), Expect(2) = 7e-47
 Identities = 15/28 (53%), Positives = 22/28 (78%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFML 227
           L+C+++ LLCV + P DRPTMA V+ +L
Sbjct: 600 LKCVNIGLLCVQQNPVDRPTMADVMILL 627



>gb:AP005774_1857664 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0086N05.
          Length = 624

 Score =  157 bits (398), Expect(2) = 7e-47
 Identities = 75/149 (50%), Positives = 105/149 (70%), Gaps = 1/149 (0%)
 Frame = -3

Query: 758 TWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDD 579
           TW  R  I  GI++G+LYLH  SRL ++HRDLK SNILLD+++ PKISDFG+ARI   + 
Sbjct: 410 TWSKRLHIIDGIAQGILYLHNYSRLCVVHRDLKASNILLDSDMTPKISDFGMARIFYSNT 469

Query: 578 GLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHH-HNL 402
             + T R++GT GY+SPEY+ DG  S+KSDVFS GV++LE+ISG++   F+  D   +NL
Sbjct: 470 IESNTTRIVGTLGYISPEYIFDGVCSIKSDVFSFGVLVLEIISGKRTSGFYPYDGKLYNL 529

Query: 401 LGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
           + +AWLLW  G   EL+  C+ +++   Q
Sbjct: 530 ISYAWLLWRSGQGHELICCCIENNHESIQ 558



 Score = 52.8 bits (125), Expect(2) = 7e-47
 Identities = 28/65 (43%), Positives = 39/65 (60%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RCI VALLCV +  +DRP +  VV ML +E + LP P +P +F  R+S    S+D   C 
Sbjct: 559 RCIQVALLCVQERADDRPCIDQVVTMLNSEGMTLPGPNQPAYFYVRSS---GSSDVLSCD 615

Query: 127 YEIAM 113
             I++
Sbjct: 616 SNISI 620



>gb:AC099774_1737232 Oryza sativa chromosome 10 BAC OSJNBa0073L20
           genomic sequence, complete sequence.
          Length = 666

 Score =  160 bits (405), Expect(2) = 9e-47
 Identities = 76/151 (50%), Positives = 105/151 (69%), Gaps = 1/151 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +    +W+TR+ I  G +RGLLYLH+DS++KIIHRDLK SN+LLD+ +NPKI
Sbjct: 425 DTILFDPQKREQLSWETRYQIIHGTARGLLYLHEDSQIKIIHRDLKASNVLLDSNMNPKI 484

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+       + T +V+GT GYM+PEY V G+ SVK DV+S G+++LE+++GR+N
Sbjct: 485 SDFGLARLCSGTKTTSITSQVVGTLGYMAPEYAVLGHLSVKVDVYSFGILVLEIVTGRRN 544

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDGNPFELMD 348
               D+D    NLL + W  W  G P E+ D
Sbjct: 545 TDVFDADEESSNLLSYVWDHWQKGIPLEITD 575



 Score = 49.7 bits (117), Expect(2) = 9e-47
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 3/72 (4%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVA-LPKPKEPGFFVE--RNSTEASSTDK 140
           L+C+H+ LLCV + P DRPTM SV+ ML++ +      P +P F     RN+T +S +  
Sbjct: 592 LKCVHIGLLCVQENPADRPTMLSVLVMLQDVDTTNFAAPSKPAFTFANVRNTTSSSPSAA 651

Query: 139 ERCCYEIAMITF 104
                E+++  F
Sbjct: 652 ALSANEVSISEF 663



>gb:AP003736_1832662 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1008_E09.>gb:AP005156_1848347 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1729_E01.
          Length = 657

 Score =  170 bits (431), Expect(2) = 9e-47
 Identities = 78/162 (48%), Positives = 113/162 (69%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +     W TRF I  GI+RGL YLHQDS+ KIIHRD+K SN+LLDA++NPKI
Sbjct: 432 DIFLFDSEQSRQLDWATRFKIIEGIARGLQYLHQDSQKKIIHRDMKASNVLLDADMNPKI 491

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            DFGLAR+  +D     T R++GT+GYMSPEYV+ G +S KSDVFS G++++E+++GR+N
Sbjct: 492 GDFGLARLFGQDQTRDVTNRIVGTFGYMSPEYVIRGQYSTKSDVFSFGILVIEIVTGRRN 551

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              H  + + +L+      W +GN  E+ D+ +  +Y E+++
Sbjct: 552 SGPHFLEQNEDLISIVRRHWEEGNIVEMTDHSLGRNYPEAEL 593



 Score = 39.7 bits (91), Expect(2) = 9e-47
 Identities = 21/52 (40%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVA-LP--KPKEPGFFVERNS 164
           L+C+ + LLCV + P DRPTMA V+ +L ++  + LP      P   +E NS
Sbjct: 594 LKCVSIGLLCVQQNPVDRPTMADVMVLLNSDATSTLPAFATHSPTISIEGNS 645



>gb:AP003736_1832657 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1008_E09.>gb:AP005786_1857855 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0458H05.
          Length = 643

 Score =  164 bits (416), Expect(2) = 9e-47
 Identities = 81/162 (50%), Positives = 106/162 (65%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  R     W  RF I  GI+RGL YLH+DS+LKI+HRDLK SN+LLD+  NPKI
Sbjct: 428 DTILFDAERIKELDWGQRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDSAYNPKI 487

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA+I E D     T R+ GTYGYMSPEY + G +S+K DV+S GV++LE+I+GR+N
Sbjct: 488 SDFGLAKIFERDQSQVITHRIAGTYGYMSPEYAMRGQYSMKLDVYSFGVLVLEIITGRRN 547

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              + SDH  +L+   W  W      EL+D  + + Y   +V
Sbjct: 548 FGSYGSDHVVDLIYVTWEHWTSDKAIELIDPSLGNHYPVDKV 589



 Score = 45.4 bits (106), Expect(2) = 9e-47
 Identities = 25/56 (44%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = -1

Query: 316 K*LRCIHVALLCVSKLPEDRPTMASVVFMLENE-EVALPKPKEPGFFVERNSTEAS 152
           K L+CIH+ LLCV   P DRP M++V  ML +   V LP    P F+V+     AS
Sbjct: 588 KVLKCIHIGLLCVQPKPADRPLMSAVNAMLSSTGTVRLPCLSRPSFWVQEIGATAS 643



>gb:ATF16G20_1548770 Arabidopsis thaliana DNA chromosome 4, BAC
           clone F16G20 (ESSAII project).
          Length = 213

 Score =  153 bits (387), Expect(2) = 9e-47
 Identities = 72/130 (55%), Positives = 97/130 (74%), Gaps = 1/130 (0%)
 Frame = -3

Query: 713 LLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDGLAKTKRVIGTYGYM 534
           +LYLHQDSRL IIHRDLK  NILLDA++NPK++DFG+ARI   D   A T+RV+GTYGYM
Sbjct: 1   ILYLHQDSRLTIIHRDLKAGNILLDADMNPKVADFGMARIFGMDQTEANTRRVVGTYGYM 60

Query: 533 SPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHH-HNLLGHAWLLWNDGNPFE 357
           +PEY + G FS+KSDV+S GV++ E+ISG KN + +  D    NL+ + W LW++G+  +
Sbjct: 61  APEYAMYGQFSMKSDVYSFGVLVFEIISGMKNSSLYQMDDSVSNLVTYTWRLWSNGSQLD 120

Query: 356 LMDNCVRDSY 327
           L+D    D+Y
Sbjct: 121 LVDPSFGDNY 130



 Score = 56.6 bits (135), Expect(2) = 9e-47
 Identities = 28/64 (43%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFV----ERNSTEASSTDK 140
           RCIH+ALLCV +  +DRP M+++V ML    + L  PK+PGFF     E+     SS D+
Sbjct: 137 RCIHIALLCVQEDVDDRPNMSAIVQMLTTSSIVLAVPKQPGFFFRGRHEQVGEVGSSVDR 196

Query: 139 ERCC 128
              C
Sbjct: 197 LALC 200



>gb:AE005172_890143 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC011661_1537280 Genomic sequence
            for Arabidopsis thaliana BAC T23J18 from chromosome I,
            complete sequence.
          Length = 809

 Score =  147 bits (371), Expect(2) = 2e-46
 Identities = 76/162 (46%), Positives = 101/162 (62%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D ++FD  +  +  W+TRF I  GI RGL+YLH+DSRLKIIHRDLK SNILLD  LNPKI
Sbjct: 594  DAYLFDPVKQRLLDWKTRFNIIDGICRGLMYLHRDSRLKIIHRDLKASNILLDENLNPKI 653

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLARI + ++    T RV+GTY                     LGVILLE++SGR+N
Sbjct: 654  SDFGLARIFQGNEDEVSTVRVVGTY---------------------LGVILLEIVSGRRN 692

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
             +F++   + NL  +AW LWN G    L+D  + +   E+++
Sbjct: 693  SSFYNDGQNPNLSAYAWKLWNTGEDIALVDPVIFEECFENEI 734



 Score = 62.0 bits (149), Expect(2) = 2e-46
 Identities = 28/74 (37%), Positives = 45/74 (60%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC+HV LLCV     DRP++A+V++ML +E   LP+PK+P F   R ++E  S+ +    
Sbjct: 736 RCVHVGLLCVQDHANDRPSVATVIWMLSSENSNLPEPKQPAFIPRRGTSEVESSGQSDPR 795

Query: 127 YEIAMITFSTLEGR 86
             I  ++ + + GR
Sbjct: 796 ASINNVSLTKITGR 809



>gb:AE005173_893819 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC004255_1531578 Arabidopsis
            thaliana BAC T1F9 chromosome 1, complete sequence.
          Length = 804

 Score =  166 bits (420), Expect(2) = 2e-46
 Identities = 85/156 (54%), Positives = 104/156 (66%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D FVFD  +     W  RF I  GI+RGLLYLH+DSRLK+IHRDLK SNILLD ++NPKI
Sbjct: 572  DTFVFDARKKLEVDWPKRFDIVQGIARGLLYLHRDSRLKVIHRDLKVSNILLDEKMNPKI 631

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ E      KT+RV+GT GYMSPEY   G FS KSD++S GV+LLE+I G K 
Sbjct: 632  SDFGLARMYEGTQCQDKTRRVVGTLGYMSPEYAWTGVFSEKSDIYSFGVLLLEIIIGEKI 691

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
              F   +    LL +AW  W +    +L+D  + DS
Sbjct: 692  SRFSYGEEGKTLLAYAWESWGETKGIDLLDQDLADS 727



 Score = 43.1 bits (100), Expect(2) = 2e-46
 Identities = 21/52 (40%), Positives = 27/52 (51%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS 152
           RC+ + LLCV   P DRP    ++ ML      LP PK+P F V     E+S
Sbjct: 735 RCVQIGLLCVQHQPADRPNTLELLAMLTTTS-DLPSPKQPTFVVHSRDDESS 785



>gb:AP003736_1832661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1008_E09.
          Length = 663

 Score =  168 bits (425), Expect(2) = 2e-46
 Identities = 79/163 (48%), Positives = 114/163 (69%), Gaps = 1/163 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FDE +     W TRF I  GI+RGL YLHQDS+ KI+HRD+K SNILLDA++NPKI
Sbjct: 436 DTFLFDEEKRRQLDWTTRFRIIEGIARGLQYLHQDSQKKIVHRDMKASNILLDADMNPKI 495

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISG-RK 441
            DFGLAR+  +D     T R++GT+GYMSPEYV  G +S KSDVFS G++++E+++G R+
Sbjct: 496 GDFGLARLFGQDQTREITNRIVGTFGYMSPEYVTHGQYSTKSDVFSFGILVIEIVTGRRR 555

Query: 440 NRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
           N   +  + + +++   W  W +GN  E++D+ +  +Y E +V
Sbjct: 556 NNGPYFFEPNEDIISIVWRHWAEGNIKEIIDHSLGRNYPEGEV 598



 Score = 41.2 bits (95), Expect(2) = 2e-46
 Identities = 18/39 (46%), Positives = 28/39 (71%), Gaps = 1/39 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVA-LPKP 197
           L+C+++ LLCV + P DRPTMA V+ +L ++  + LP P
Sbjct: 599 LKCVNIGLLCVQQNPIDRPTMADVMVLLNSDATSTLPAP 637



>gb:AE016959_1021800 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC090486_1734344
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBa0093I09,
           from Chromosome 10, complete
           sequence.>gb:AC099774_1737233 Oryza sativa chromosome 10
           BAC OSJNBa0073L20 genomic sequence, complete
           sequence.>gb:AE017076_1751619 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 30 of 77 of the
           complete sequence.
          Length = 680

 Score =  164 bits (416), Expect(2) = 3e-46
 Identities = 78/151 (51%), Positives = 107/151 (70%), Gaps = 1/151 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  + G   W+TR+ I  GI+RGLLYLH+DS++KIIHRDLK SN+LLDA +NPKI
Sbjct: 440 DTFLFDPEKRGQLNWETRYQIIHGIARGLLYLHEDSQIKIIHRDLKASNVLLDANMNPKI 499

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+ +     + T  V+GT GYM+PEY V G+ SVK DV+S G+++LE+++GR+N
Sbjct: 500 SDFGLARLFDGTKTASITNHVVGTLGYMAPEYAVLGHVSVKLDVYSFGILVLEIVTGRRN 559

Query: 437 R-AFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
                + +  +NLL + W  W  G P E+ D
Sbjct: 560 TDVSGEVEESNNLLSYVWDHWVKGTPLEIAD 590



 Score = 43.9 bits (102), Expect(2) = 3e-46
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEV-ALPKPKEPGF-FVERNSTEASS 149
           L+C+H  LLCV + P DRPTM  ++ ML + +  +   P +P F F    +T +SS
Sbjct: 606 LKCVHFGLLCVQENPVDRPTMLDILVMLHDVDTNSFVAPSKPAFTFAHGGNTTSSS 661



>gb:ATCHRIV12_1544293 Arabidopsis thaliana DNA chromosome 4, contig
           fragment No. 12.>gb:AF076243_1766166 Arabidopsis
           thaliana BAC T26N6 from chromosome IV at 19.3 cM,
           complete sequence.
          Length = 658

 Score =  174 bits (440), Expect(2) = 6e-46
 Identities = 82/150 (54%), Positives = 108/150 (72%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FDE +  + TW  R+ I  G++RGLLYLH+DS+L+IIHRDLK SNILLDAE+NPK+
Sbjct: 422 DHFIFDEDKRWLLTWDVRYRIIEGVARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKV 481

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+AR+   D+   +T RV+GTYGYM+PEYV  G FS KSDV+S GV+LLE+ISG KN
Sbjct: 482 ADFGMARLFNMDETRGETSRVVGTYGYMAPEYVRHGQFSAKSDVYSFGVMLLEMISGEKN 541

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
           + F        L   AW  W +G    ++D
Sbjct: 542 KNFET----EGLPAFAWKRWIEGELESIID 567



 Score = 33.5 bits (75), Expect(2) = 6e-46
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENE-EVALPKPKEPGF 182
           ++ I + LLCV +    RPTM SV+  L  +    +PKP E  F
Sbjct: 579 IKLIQIGLLCVQENAAKRPTMNSVITWLARDGTFTIPKPTEAAF 622



>gb:AP003811_1833702 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1131_E05.>gb:AP006753_1862873 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0039D04.
          Length = 637

 Score =  153 bits (387), Expect(2) = 6e-46
 Identities = 72/144 (50%), Positives = 98/144 (68%), Gaps = 1/144 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+F   +     W  R  I  GI +GLLYLH  SRL ++HRDLK SNILLD+ +NPKI
Sbjct: 411 DYFIFSNVKGAQLNWSKRLHIIDGIGQGLLYLHNFSRLCVVHRDLKASNILLDSTMNPKI 470

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   +   + T R++GT+GY+ PEY  +G  S+KSDVFS GV++LE++SG++ 
Sbjct: 471 SDFGMARIFYSNMAESNTTRIVGTHGYIPPEYAFEGVCSIKSDVFSFGVLILEIVSGKRT 530

Query: 437 RAFHDSDHH-HNLLGHAWLLWNDG 369
             F+  +   +NL+  AW LW DG
Sbjct: 531 AHFYQHNGKLYNLISFAWQLWRDG 554



 Score = 53.9 bits (128), Expect(2) = 6e-46
 Identities = 28/54 (51%), Positives = 34/54 (62%), Gaps = 1/54 (1%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF-VERNSTEASS 149
           RCIHVALLCV +  E RP M  VV ML  + V+LP P +P +F V  +  E SS
Sbjct: 573 RCIHVALLCVQESAEFRPAMERVVTMLNTKNVSLPMPMQPAYFNVNPSEEEVSS 626



>pir|T09349|T09349 S-receptor kinase (EC 2.7.1.-) T26M18.110 precursor
            - Arabidopsis thaliana>gb:ATCHRIV33_1544955 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            33.>gb:ATT26M18_1555502 Arabidopsis thaliana DNA
            chromosome 4, BAC clone T26M18 (ESSA project).
          Length = 849

 Score =  153 bits (387), Expect(2) = 8e-46
 Identities = 79/167 (47%), Positives = 107/167 (64%), Gaps = 1/167 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D  +FD  +     W+TR  I  G +RGL YLH+ SRL+IIHRDLK SNILLD E+NPKI
Sbjct: 619  DGLLFDSLKSRELDWETRMKIVNGTTRGLQYLHEYSRLRIIHRDLKASNILLDDEMNPKI 678

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFG ARI         T+R++GT+GYMSPEY + G  S KSD++S GV+LLE+ISG+K 
Sbjct: 679  SDFGTARIFGCKQIDDSTQRIVGTFGYMSPEYALGGVISEKSDIYSFGVLLLEIISGKKA 738

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY-VESQVATMH 300
              F  +D  H+L+ + W  W +     ++D  +  SY +E  +  +H
Sbjct: 739  TRFVHNDQKHSLIAYEWESWCETKGVSIIDEPMCCSYSLEEAMRCIH 785



 Score = 53.5 bits (127), Expect(2) = 8e-46
 Identities = 23/43 (53%), Positives = 32/43 (74%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF 182
           +RCIH+ALLCV   P+DRP ++ +V+ML N+   LP PK+P F
Sbjct: 781 MRCIHIALLCVQDHPKDRPMISQIVYMLSNDN-TLPIPKQPTF 822



>gb:AP003863_1834476 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1058_A12.
          Length = 695

 Score =  150 bits (378), Expect(2) = 1e-45
 Identities = 70/136 (51%), Positives = 96/136 (70%)
 Frame = -3

Query: 755 WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
           W  RF I  GI+RGL YL +DS+L+IIHRDLK SN+LLD++  PKISDFGLAR+   D  
Sbjct: 460 WGKRFRIINGIARGLQYLQEDSQLRIIHRDLKASNVLLDSDYTPKISDFGLARLFGGDQT 519

Query: 575 LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
              T+ V+GTYGYM+PEY + G++SVKSDVFS G++++E+++GR++      D  ++LL 
Sbjct: 520 REITRHVVGTYGYMAPEYAMRGHYSVKSDVFSFGILMIEIVTGRRSSGSLSFDQSNDLLS 579

Query: 395 HAWLLWNDGNPFELMD 348
             W  W  G   E+MD
Sbjct: 580 LVWEHWTMGTILEMMD 595



 Score = 56.6 bits (135), Expect(2) = 1e-45
 Identities = 23/53 (43%), Positives = 36/53 (67%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEAS 152
           L+CIH+ LLCV   P DRP M++V  ML +  V+L  P +P FF+ ++ T+++
Sbjct: 608 LKCIHIGLLCVQDNPADRPMMSTVNVMLSSSTVSLQSPSKPSFFIPKSDTDSN 660



>pir|G85056|G85056 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:ATCHRIV12_1544294 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           12.>gb:AF076243_1766167 Arabidopsis thaliana BAC T26N6
           from chromosome IV at 19.3 cM, complete sequence.
          Length = 646

 Score =  175 bits (443), Expect(2) = 1e-45
 Identities = 79/152 (51%), Positives = 109/152 (71%), Gaps = 2/152 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FDE +  + TW  R+ I  G++RGLLYLH+DS+L+IIHRDLK SNILLDAE+NPK+
Sbjct: 427 DHFIFDEEKRRVLTWDVRYTIIEGVARGLLYLHEDSQLRIIHRDLKASNILLDAEMNPKV 486

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+AR+ + D+   +T RV+GTYGYM+PEY   G FS KSDV+S GV+LLE+ISG+ N
Sbjct: 487 ADFGMARLFDMDETRGQTSRVVGTYGYMAPEYATYGQFSTKSDVYSFGVMLLEMISGKSN 546

Query: 437 RAF--HDSDHHHNLLGHAWLLWNDGNPFELMD 348
           +     + +    L    W  W +G   E++D
Sbjct: 547 KKLEKEEEEEEEELPAFVWKRWIEGRFAEIID 578



 Score = 31.6 bits (70), Expect(2) = 1e-45
 Identities = 14/39 (35%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLE-NEEVALPKP 197
           ++ IH+ LLCV +    RP++ S++F LE +  + +P P
Sbjct: 593 MKLIHIGLLCVQEDISKRPSINSILFWLERHATITMPVP 631



>gb:AE005173_893805 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC004255_1531592 Arabidopsis
            thaliana BAC T1F9 chromosome 1, complete sequence.
          Length = 821

 Score =  159 bits (403), Expect(2) = 2e-45
 Identities = 78/156 (50%), Positives = 105/156 (67%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD  +     W TRF I  GI+RGLLYLH+DS L+++HRDLK SNILLD ++NPKI
Sbjct: 580  DIFIFDLKKKLEIDWATRFNIIQGIARGLLYLHRDSFLRVVHRDLKVSNILLDEKMNPKI 639

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+   +     T  V+GT GYMSPEY   G FS KSD++S GV++LE+I+G++ 
Sbjct: 640  SDFGLARLFHGNQHQDSTGSVVGTLGYMSPEYAWTGTFSEKSDIYSFGVLMLEIITGKEI 699

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
             +F     + NLL +AW  W++     L+D  + DS
Sbjct: 700  SSFSYGKDNKNLLSYAWDSWSENGGVNLLDQDLDDS 735



 Score = 45.8 bits (107), Expect(2) = 2e-45
 Identities = 22/58 (37%), Positives = 33/58 (56%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKER 134
           RC+H+ LLCV     DRP +  V+ ML      LPKP +P F +E +  ++S +  +R
Sbjct: 745 RCVHIGLLCVQHQAIDRPNIKQVMSML-TSTTDLPKPTQPMFVLETSDEDSSLSHSQR 801



>gb:AP004260_1839291 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0011H09.>gb:AP004306_1839944 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0506F02.
          Length = 647

 Score =  155 bits (393), Expect(2) = 2e-45
 Identities = 75/162 (46%), Positives = 105/162 (64%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W  R+ I  GI+RGL YLH+ S+LKIIHRDLK SNILLD+++ PKI
Sbjct: 413 DTVLFDPEKSKQLDWGKRYNILYGIARGLQYLHEHSQLKIIHRDLKASNILLDSDMKPKI 472

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+A+I  +D     T RV+GT GYMSPEY + G +S K DVFS GV++LE+++GR+N
Sbjct: 473 ADFGMAKIFGDDQTRNATSRVVGTLGYMSPEYAMRGQYSTKLDVFSFGVLVLEIVTGRRN 532

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                S+H  +L    W  WN+G   E++D  + + Y    +
Sbjct: 533 SYAVVSEHCEDLFSLVWRHWNEGTVTEIVDPSLGNHYSRGDI 574



 Score = 49.7 bits (117), Expect(2) = 2e-45
 Identities = 21/56 (37%), Positives = 33/56 (58%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           L+CI++ LLCV + P DRP M++++ ML +  V L  P  P +   RN +   + D
Sbjct: 575 LKCINIGLLCVQQNPVDRPPMSAIILMLSSGTVTLQAPYRPAYIFGRNRSYTETMD 630



>pir|H85056|H85056 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:ATCHRIV12_1544295 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           12.>gb:AF076243_1766168 Arabidopsis thaliana BAC T26N6
           from chromosome IV at 19.3 cM, complete sequence.
          Length = 648

 Score =  163 bits (413), Expect(2) = 3e-45
 Identities = 77/156 (49%), Positives = 112/156 (71%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FDE +  + TW  R  I  G++RGL+YLH+DS+L+IIHRDLK SNILLDA +NPK+
Sbjct: 421 DHFIFDEEKRLLLTWDMRARIIEGVARGLVYLHEDSQLRIIHRDLKASNILLDAYMNPKV 480

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+AR+   D   A T++V+GT+GYM+PEYV +  FSVK+DV+S GV+LLE+I+GR N
Sbjct: 481 ADFGMARLFNMDQTRAVTRKVVGTFGYMAPEYVRNRTFSVKTDVYSFGVVLLEMITGRSN 540

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           + + ++     L  +AW  W  G    ++D+ +  S
Sbjct: 541 KNYFEA---LGLPAYAWKCWVAGEAASIIDHVLSRS 573



 Score = 41.6 bits (96), Expect(2) = 3e-45
 Identities = 19/43 (44%), Positives = 27/43 (62%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF 182
           +R IH+ LLCV +    RPTM+ V+  L +E +A+P P   GF
Sbjct: 579 MRFIHIGLLCVQENVSKRPTMSLVIQWLGSETIAIPLPTVAGF 621



>gb:AP003736_1832653 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1008_E09.>gb:AP005786_1857851 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0458H05.
          Length = 698

 Score =  159 bits (401), Expect(2) = 4e-45
 Identities = 74/154 (48%), Positives = 104/154 (67%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W  R  I +G++RGL YLH+DS+L+++HRDLK SN+LLD + NPKI
Sbjct: 452 DTILFDYEKSKDLDWGKRLKIVSGVARGLQYLHEDSQLRVVHRDLKASNVLLDFDHNPKI 511

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA++ E D     T  + GTYGYM+PEY + G +SVKSD FS GV++LE+++GR+N
Sbjct: 512 SDFGLAKLFEWDQTQDVTSHIAGTYGYMAPEYAMRGQYSVKSDAFSFGVMILEIVTGRRN 571

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVR 336
            +F +S+   +LL   W  W  G   EL+D  +R
Sbjct: 572 SSFSNSEQSIDLLSLVWEHWTTGTIEELLDPAMR 605



 Score = 45.8 bits (107), Expect(2) = 4e-45
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS 149
           L+ I++ LLCV   P DRPTM++V  ML +E  ++  P  P F ++   + A +
Sbjct: 613 LKLINIGLLCVQDNPADRPTMSAVSVMLSSETFSIQAPSRPTFCIQETDSAADT 666



>gb:AY074844_1567697 Arabidopsis thaliana AT4g21410/T6K22_140 mRNA,
           complete cds.
          Length = 679

 Score =  153 bits (386), Expect(2) = 6e-45
 Identities = 72/154 (46%), Positives = 103/154 (66%), Gaps = 4/154 (2%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +  +  W  R+ +  GI+RGLLYLH+DSR +IIHRDLK SNILLD E+NPKI
Sbjct: 439 DQFIFDTEKRQLLDWVVRYKMIGGIARGLLYLHEDSRFRIIHRDLKASNILLDQEMNPKI 498

Query: 617 SDFGLARIVEEDDGLAK--TKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGR 444
           +DFGLA++ +    +    T R+ GTYGYM+PEY + G FSVK+DVFS GV+++E+I+G+
Sbjct: 499 ADFGLAKLFDSGQTMTHRFTSRIAGTYGYMAPEYAMHGQFSVKTDVFSFGVLVIEIITGK 558

Query: 443 KNR--AFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
           +N     +  +   +LL   W  W +     ++D
Sbjct: 559 RNNNGGSNGDEDAEDLLSWVWRSWREDTILSVID 592



 Score = 50.8 bits (120), Expect(2) = 6e-45
 Identities = 27/59 (45%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASSTD 143
           LRCIH+ LLCV +    RPTMA+V  ML +    LP P  P F +E     S  +SST+
Sbjct: 604 LRCIHIGLLCVQESAATRPTMATVSLMLNSYSFTLPTPLRPAFVLESVVIPSNVSSSTE 662



>pir|G96640|G96640 hypothetical protein T25B24.10 [imported] -
            Arabidopsis thaliana>gb:AE005173_893825 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC005850_1533098 Arabidopsis thaliana
            chromosome I BAC T25B24 genomic sequence, complete
            sequence.
          Length = 802

 Score =  161 bits (408), Expect(2) = 8e-45
 Identities = 84/162 (51%), Positives = 103/162 (63%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD  +     W  RF I  GI+RGLLYLH+DSRL+IIHRD+K SNILLD ++NPKI
Sbjct: 571  DTFIFDSRKRVEIDWPKRFSIIQGIARGLLYLHRDSRLRIIHRDVKVSNILLDDKMNPKI 630

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ E       T+R++GT GYMSPEY   G FS KSD +S GV+LLE+ISG K 
Sbjct: 631  SDFGLARMYEGTKYQDNTRRIVGTLGYMSPEYAWTGVFSEKSDTYSFGVLLLEVISGEKI 690

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              F       NLL +AW  W +      +D    DS   S+V
Sbjct: 691  SRFSYDKERKNLLAYAWESWCENGGVGFLDKDATDSCHPSEV 732



 Score = 42.0 bits (97), Expect(2) = 8e-45
 Identities = 21/55 (38%), Positives = 29/55 (52%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           RC+ + LLCV   P DRP    ++ ML      LP PKEP F V  +   + ++D
Sbjct: 734 RCVQIGLLCVQHQPADRPNTLELLSMLTTTS-DLPLPKEPTFAVHTSDDGSRTSD 787



>gb:AP004274_1839611 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0450A04.>gb:AP004570_1841742 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0625E02.
          Length = 668

 Score =  152 bits (383), Expect(2) = 8e-45
 Identities = 77/159 (48%), Positives = 108/159 (67%), Gaps = 2/159 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F+  R  +  W  R  I  GIS+GLLYLH+ S + ++HRDLK SN+LLDAE+N KI
Sbjct: 436 DVFIFNVKRE-LLDWPKRLHIIHGISQGLLYLHEHSTVCVVHRDLKASNVLLDAEMNAKI 494

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   +   + T R++GT GY++PEY +DG  S K+DVFS GV++LE+ISG++ 
Sbjct: 495 SDFGIARIFGSNAAQSSTTRIVGT-GYIAPEYALDGVCSSKADVFSFGVLILEIISGKRT 553

Query: 437 RAF--HDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
                ++    + L+ +AWLLW DG   EL+D C+ D Y
Sbjct: 554 GGSYRYNDGKLYCLIAYAWLLWKDGRWHELIDECLGDRY 592



 Score = 51.6 bits (122), Expect(2) = 8e-45
 Identities = 30/68 (44%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
 Frame = -1

Query: 304 CIHVALLCVSKLPEDRPTMASVVFMLENEEVA--LPKPKEPGFFVERNSTEASSTDKERC 131
           C+ VALLCV +  EDR  M  VV ML NE+ A  LP+PK+  +F  R S          C
Sbjct: 599 CMQVALLCVQEDAEDRKAMDEVVKMLGNEQAASQLPEPKQSAYFNVRPSGGGGDAPPSAC 658

Query: 130 CYEIAMIT 107
              I+MIT
Sbjct: 659 NISISMIT 666



>pir|B96640|B96640 hypothetical protein T25B24.15 [imported] -
            Arabidopsis thaliana>gb:AE005173_893820 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC005850_1533103 Arabidopsis thaliana
            chromosome I BAC T25B24 genomic sequence, complete
            sequence.
          Length = 829

 Score =  160 bits (405), Expect(2) = 1e-44
 Identities = 80/156 (51%), Positives = 104/156 (66%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD  +     W  RF I  GI+RGLLYLH DSRL++IHRDLK SNILLD ++NPKI
Sbjct: 598  DTFLFDSRKRLEIDWPKRFDIIQGIARGLLYLHHDSRLRVIHRDLKVSNILLDEKMNPKI 657

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ +  +    T+RV+GT GYMSPEY   G FS KSD++S GV++LE+ISG K 
Sbjct: 658  SDFGLARMYQGTEYQDNTRRVVGTLGYMSPEYAWTGMFSEKSDIYSFGVLMLEIISGEKI 717

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
              F        L+ +AW  W++    +L+D  + DS
Sbjct: 718  SRFSYGVEGKTLIAYAWESWSEYRGIDLLDQDLADS 753



 Score = 42.7 bits (99), Expect(2) = 1e-44
 Identities = 22/55 (40%), Positives = 27/55 (49%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           RCI + LLCV   P DRP    ++ ML      LP PK+P F       E+ S D
Sbjct: 761 RCIQIGLLCVQHQPADRPNTLELLAMLTTTS-DLPSPKQPTFAFHTRDDESLSND 814



>gb:AE016959_1021829 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC091749_1735020 Oryza sativa
            chromosome 10 BAC OSJNBb0008A05 genomic sequence,
            complete sequence.>gb:AC131374_1740979 Oryza sativa
            (japonica cultivar-group) chromosome 10 clone
            OSJNAb0008A05, complete sequence.>gb:AE017076_1751648
            Oryza sativa (japonica cultivar-group) chromosome 10,
            section 30 of 77 of the complete sequence.
          Length = 816

 Score =  159 bits (402), Expect(2) = 1e-44
 Identities = 76/151 (50%), Positives = 105/151 (69%), Gaps = 1/151 (0%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD  + G   W+TR+ I  G +RGL+YLH+DS +KIIHRDLK SN+LLD+ +NPKI
Sbjct: 576  DTFLFDPEKRGQLIWETRYHIIHGTARGLVYLHEDSHIKIIHRDLKASNVLLDSSMNPKI 635

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ + +   + T  V+GT GYM+PEY V G  SVK DV+S GV++LE+++GR+N
Sbjct: 636  SDFGLARLFDGNKTASVTSHVVGTLGYMAPEYAVLGLLSVKLDVYSFGVLVLEVVTGRRN 695

Query: 437  R-AFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
               F   +  +NLL + W  W  G P  ++D
Sbjct: 696  TDVFGAVEESNNLLSYVWDHWVKGTPLAIVD 726



 Score = 43.9 bits (102), Expect(2) = 1e-44
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 2/58 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLEN-EEVALPKPKEPGF-FVERNSTEASSTD 143
           L+CI + LLCV + P DRPTM  ++ ML + +  +   P +P F FV    T  SS++
Sbjct: 742 LKCIQLGLLCVQENPADRPTMLHILVMLHDVDATSFAAPSKPAFTFVNGGHTTGSSSN 799



>pir|T05148|T05148 protein kinase homolog F18E5.20 - Arabidopsis
           thaliana>gb:ATCHRIV55_1545977 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 55.>gb:ATF18E5_1549112
           Arabidopsis thaliana DNA chromosome 4, BAC clone F18E5
           (ESSAII project).>gb:ATT6K22_1556405 Arabidopsis
           thaliana DNA chromosome 4, BAC clone T6K22 (ESSAII
           project).
          Length = 711

 Score =  148 bits (374), Expect(2) = 2e-44
 Identities = 72/153 (47%), Positives = 101/153 (66%), Gaps = 4/153 (2%)
 Frame = -3

Query: 794 YFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKIS 615
           Y V D  +  +  W  R+ +  G++RGLLYLH+DSR +IIHRDLK SNILLD E+NPKI+
Sbjct: 472 YAVTDLKKRQLLDWGVRYKMIGGVARGLLYLHEDSRYRIIHRDLKASNILLDQEMNPKIA 531

Query: 614 DFGLARIVEEDDGLAK--TKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGR- 444
           DFGLA++ + D       T ++ GTYGYM+PEY + G FSVK+DVFS GV+++E+I+G+ 
Sbjct: 532 DFGLAKLYDTDQTSTHRFTSKIAGTYGYMAPEYAIYGQFSVKTDVFSFGVLVIEIITGKG 591

Query: 443 -KNRAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
             N   +D +   NLL   W  W +     ++D
Sbjct: 592 NNNGRSNDDEEAENLLSWVWRCWREDIILSVID 624



 Score = 53.9 bits (128), Expect(2) = 2e-44
 Identities = 24/46 (52%), Positives = 28/46 (60%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
           LRCIH+ LLCV + P  RPTM SV  ML +    LP P  P F +E
Sbjct: 636 LRCIHIGLLCVQESPASRPTMDSVALMLNSYSYTLPTPSRPAFALE 681



>pir|D96639|D96639 protein T1F9.12 [imported] - Arabidopsis
            thaliana>gb:AE005173_893808 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC004255_1531589 Arabidopsis thaliana BAC
            T1F9 chromosome 1, complete sequence.
          Length = 831

 Score =  155 bits (393), Expect(2) = 2e-44
 Identities = 81/162 (50%), Positives = 107/162 (66%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +      WQ RF I  G++RGLLYLH+DSRL++IHRDLK SNILLD ++ PKI
Sbjct: 602  DVFLFDSTLKFEIDWQKRFNIIQGVARGLLYLHRDSRLRVIHRDLKVSNILLDEKMIPKI 661

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ +       T+RV+GT GYM+PEY   G FS KSD++S GV+LLE+I G K 
Sbjct: 662  SDFGLARMSQGTQYQDNTRRVVGTLGYMAPEYAWTGVFSEKSDIYSFGVLLLEIIIGEKI 721

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
              F  S+    LL +AW  W +    +L+D  + DS   ++V
Sbjct: 722  SRF--SEEGKTLLAYAWESWCETKGVDLLDQALADSSHPAEV 761



 Score = 46.2 bits (108), Expect(2) = 2e-44
 Identities = 26/74 (35%), Positives = 37/74 (50%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC+ + LLCV   P DRP    ++ ML      LP PK+P F V     +++S D     
Sbjct: 763 RCVQIGLLCVQHQPADRPNTLELMSMLTTIS-ELPSPKQPTFTVHSRDDDSTSND----L 817

Query: 127 YEIAMITFSTLEGR 86
             +  IT S ++GR
Sbjct: 818 ITVNEITQSVIQGR 831



>gb:AP003863_1834479 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1058_A12.>gb:AP005810_1858250 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0696F12.
          Length = 672

 Score =  135 bits (339), Expect(2) = 3e-44
 Identities = 62/125 (49%), Positives = 92/125 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F  SR    +W  ++ I  GI++G++YLH+DS ++IIHRDLK +NILLD +++PKI
Sbjct: 437 DNFLFHASRGNALSWDQQYNIIFGIAKGIMYLHEDSSIRIIHRDLKANNILLDEDMDPKI 496

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLAR++       KT R++GT GYM+PEY + GN S K D+FS GV++LE+++ RKN
Sbjct: 497 ADFGLARLIGGGHTHTKTTRIVGT-GYMAPEYAIHGNVSPKIDIFSFGVLVLEIVTKRKN 555

Query: 437 RAFHD 423
            ++ D
Sbjct: 556 CSYGD 560



 Score = 66.6 bits (161), Expect(2) = 3e-44
 Identities = 30/59 (50%), Positives = 37/59 (62%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKER 134
           LRCIH+ LLCV   P+DRP + SV+FML  + + L  P EP FF   NS  AS T  +R
Sbjct: 586 LRCIHIGLLCVQSDPDDRPDIPSVIFMLTRDNMELQPPTEPAFFFNGNSNSASQTSDQR 644



>pir|T01551|T01551 receptor kinase homolog A_TM018A10.19 -
           Arabidopsis thaliana>gb:ATCHRIV3_1544782 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           3.>gb:TM018A10_1725180 Arabidopsis thaliana BAC
           TM018A10.
          Length = 372

 Score =  147 bits (371), Expect(2) = 3e-44
 Identities = 68/141 (48%), Positives = 94/141 (66%), Gaps = 2/141 (1%)
 Frame = -3

Query: 764 IXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEE 585
           I  W+ R+ I +G++RGLLYLH+DS  KIIHRD+K SN+LLD  +NPKI+DFG+ ++   
Sbjct: 142 ILDWEKRYRIISGVARGLLYLHEDSHFKIIHRDMKASNVLLDDAMNPKIADFGMVKLFNT 201

Query: 584 DDGLAK--TKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHH 411
           D       T +V GTYGYM+PEY + G FSVK+DVFS GV++LE+I G+KN    +    
Sbjct: 202 DQTSQTMFTSKVAGTYGYMAPEYAMSGQFSVKTDVFSFGVLVLEIIKGKKNNWSPEEQSS 261

Query: 410 HNLLGHAWLLWNDGNPFELMD 348
             LL + W  W +G    ++D
Sbjct: 262 LFLLSYVWKCWREGEVLNIVD 282



 Score = 54.3 bits (129), Expect(2) = 3e-44
 Identities = 29/77 (37%), Positives = 44/77 (57%), Gaps = 3/77 (3%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF---VERNSTEASSTDKE 137
           +CIH+ LLCV + P  RPTMAS+V ML      LP+P +P F+   V+ +S + + T   
Sbjct: 297 KCIHIGLLCVQENPGSRPTMASIVRMLNANSFTLPRPLQPAFYSGVVDSSSRDNNHTRNP 356

Query: 136 RCCYEIAMITFSTLEGR 86
           R    +  +T + L+ R
Sbjct: 357 RIA-SLNDVTITELDPR 372



>gb:AY056250_1563570 Arabidopsis thaliana putative serine/threonine
            kinase (At1g11280) mRNA, complete cds.
          Length = 830

 Score =  159 bits (403), Expect(2) = 4e-44
 Identities = 83/165 (50%), Positives = 110/165 (66%), Gaps = 2/165 (1%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +      W  RF I  G+SRGLLYLH+DS +++IHRDLK SNILLD ++NPKI
Sbjct: 597  DTFLFDLALKLQIDWPKRFNIIQGVSRGLLYLHRDSCMRVIHRDLKVSNILLDDKMNPKI 656

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ +       T++V+GT GYMSPEY   G FS KSD+++ GV+LLE+ISG+K 
Sbjct: 657  SDFGLARMFQGTQHQDNTRKVVGTLGYMSPEYAWTGMFSEKSDIYAFGVLLLEIISGKKI 716

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY--VESQVA 309
             +F   +    LLGHAW  W +    +L+D  +  S   VE +VA
Sbjct: 717  SSFCCGEEGKTLLGHAWECWLETGGVDLLDEDISSSCSPVEVEVA 761



 Score = 41.6 bits (96), Expect(2) = 4e-44
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA 155
           RC+ + LLC+ +   DRP +A VV M+      LP+PK+P F ++    E+
Sbjct: 762 RCVQIGLLCIQQQAVDRPNIAQVVTMM-TSATDLPRPKQPLFALQIQDQES 811



>pir|G86246|G86246 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890134 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007259_1535686 Arabidopsis thaliana
            chromosome I BAC T28P6 genomic sequence, complete
            sequence.>gb:AY062482_1565138 Arabidopsis thaliana Very
            similar to receptor protein kinases (At1g11280; T28P6.7)
            mRNA, complete cds.
          Length = 820

 Score =  159 bits (403), Expect(2) = 4e-44
 Identities = 83/165 (50%), Positives = 110/165 (66%), Gaps = 2/165 (1%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +      W  RF I  G+SRGLLYLH+DS +++IHRDLK SNILLD ++NPKI
Sbjct: 587  DTFLFDLTLKLQIDWPKRFNIIQGVSRGLLYLHRDSCMRVIHRDLKVSNILLDDKMNPKI 646

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ +       T++V+GT GYMSPEY   G FS KSD+++ GV+LLE+ISG+K 
Sbjct: 647  SDFGLARMFQGTQHQDNTRKVVGTLGYMSPEYAWTGMFSEKSDIYAFGVLLLEIISGKKI 706

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY--VESQVA 309
             +F   +    LLGHAW  W +    +L+D  +  S   VE +VA
Sbjct: 707  SSFCCGEEGKTLLGHAWECWLETGGVDLLDEDISSSCSPVEVEVA 751



 Score = 41.6 bits (96), Expect(2) = 4e-44
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA 155
           RC+ + LLC+ +   DRP +A VV M+      LP+PK+P F ++    E+
Sbjct: 752 RCVQIGLLCIQQQAVDRPNIAQVVTMM-TSATDLPRPKQPLFALQIQDQES 801



>pir|C96639|C96639 protein T1F9.14 [imported] - Arabidopsis
            thaliana>gb:AE005173_893806 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC004255_1531591 Arabidopsis thaliana BAC
            T1F9 chromosome 1, complete sequence.
          Length = 828

 Score =  153 bits (387), Expect(2) = 5e-44
 Identities = 76/149 (51%), Positives = 102/149 (68%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W  RF I  GI+ GLLYLH+DS L+++HRD+K SNILLD E+NPKISDFGLAR+ +    
Sbjct: 611  WPKRFEIIQGIACGLLYLHRDSCLRVVHRDMKVSNILLDEEMNPKISDFGLARMFQGTQH 670

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
             A T+RV+GT GYMSPEY   G FS KSD+++ GV+LLE+I+G++  +F   +    LL 
Sbjct: 671  QANTRRVVGTLGYMSPEYAWTGMFSEKSDIYAFGVLLLEIITGKRISSFTIGEEGKTLLE 730

Query: 395  HAWLLWNDGNPFELMDNCVRDSYVESQVA 309
             AW  W +    +L+D  +  S  ES+VA
Sbjct: 731  FAWDSWCESGGSDLLDQDISSSGSESEVA 759



 Score = 47.4 bits (111), Expect(2) = 5e-44
 Identities = 25/74 (33%), Positives = 42/74 (56%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC+ + LLC+ +   DRP +A V+ ML    + LPKPK+P F ++   +++ S    +  
Sbjct: 760 RCVQIGLLCIQQQAGDRPNIAQVMSML-TTTMDLPKPKQPVFAMQVQESDSES----KTM 814

Query: 127 YEIAMITFSTLEGR 86
           Y +  IT + + GR
Sbjct: 815 YSVNNITQTAIVGR 828



>gb:AP003736_1832651 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1008_E09.>gb:AP005786_1857849 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0458H05.
          Length = 711

 Score =  157 bits (396), Expect(2) = 7e-44
 Identities = 72/153 (47%), Positives = 103/153 (67%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W  R  I +G++RGL YLH+DS+L+++HRDLK SN+LLD + NPKI
Sbjct: 457 DTILFDYEKSKDLDWGKRLNIVSGVARGLQYLHEDSQLRVVHRDLKASNVLLDFDHNPKI 516

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLA++ E D     T  + GTYGYM+PEY + G +SVKSD FS GV+++E+++GR+N
Sbjct: 517 SDFGLAKLFEWDQTQDVTSHIAGTYGYMAPEYAMRGQYSVKSDAFSFGVLIIEIVTGRRN 576

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCV 339
            +F +S+   +LL   W  W  G   EL+D  +
Sbjct: 577 SSFSNSEQSIDLLSLVWEHWTTGTIEELLDPAI 609



 Score = 43.5 bits (101), Expect(2) = 7e-44
 Identities = 22/62 (35%), Positives = 33/62 (53%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC 131
           L+ I++ LLCV   P DRP M++V  ML ++ V+L  P  P F ++     A +   E  
Sbjct: 618 LKLINIGLLCVQDNPADRPAMSAVNVMLSSDTVSLQAPSRPTFSIQEMDGAADTDLYESG 677

Query: 130 CY 125
            Y
Sbjct: 678 AY 679



>gb:AE005173_893813 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC004255_1531584 Arabidopsis
            thaliana BAC T1F9 chromosome 1, complete sequence.
          Length = 824

 Score =  156 bits (394), Expect(2) = 1e-43
 Identities = 79/148 (53%), Positives = 99/148 (66%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W  RF I  GI RGLLYLH+DSRL++IHRDLK SNILLD ++NPKISDFGLAR+ +    
Sbjct: 606  WPKRFDIIQGIVRGLLYLHRDSRLRVIHRDLKVSNILLDEKMNPKISDFGLARLFQGSQY 665

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
              KT+RV+GT GYMSPEY   G FS KSD++S GV+LLE+ISG K   F   +    LL 
Sbjct: 666  QDKTRRVVGTLGYMSPEYAWTGVFSEKSDIYSFGVLLLEIISGEKISRFSYGEEGKALLA 725

Query: 395  HAWLLWNDGNPFELMDNCVRDSYVESQV 312
            + W  W +     L+D  + DS   ++V
Sbjct: 726  YVWECWCETRGVNLLDQALDDSSHPAEV 753



 Score = 43.5 bits (101), Expect(2) = 1e-43
 Identities = 22/55 (40%), Positives = 28/55 (50%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           RC+ + LLCV   P DRP    ++ ML      LP PK+P F V   + E  S D
Sbjct: 755 RCVQIGLLCVQHQPADRPNTLELLSMLTTTS-DLPLPKQPTFAVHTRNDEPPSND 808



>gb:AF083714_1766944 Arabidopsis thaliana clone sps280 unknown mRNA.
          Length = 808

 Score =  157 bits (398), Expect(2) = 2e-43
 Identities = 83/165 (50%), Positives = 108/165 (65%), Gaps = 2/165 (1%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD +      W  RF I  G+SRGLLYLH+DS +++IHRDLK SNILLD ++NPKI
Sbjct: 575  DTFLFDLTLKLQIDWPKRFNIIQGVSRGLLYLHRDSCMRVIHRDLKVSNILLDEKMNPKI 634

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ +         RV+GT GYMSPEY   G FS KSD+++ GV+LLE+ISG+K 
Sbjct: 635  SDFGLARMFQGTQHKTTLVRVVGTLGYMSPEYAWTGMFSEKSDIYAFGVLLLEIISGKKI 694

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY--VESQVA 309
             +F   +    LLGHAW  W +    +L+D  +  S   VE +VA
Sbjct: 695  SSFCCGEEGKTLLGHAWECWLETGGVDLLDEDISSSCSPVEVEVA 739



 Score = 41.2 bits (95), Expect(2) = 2e-43
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA 155
           RC+ + LLC+ +   DRP +A VV M+      LP+PK+P F ++    E+
Sbjct: 740 RCVQIGLLCIQQQAIDRPNIAQVVTMM-TSATDLPRPKQPLFALQIQDQES 789



>gb:AE016959_1021799 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC090486_1734343
           Genomic sequence for Oryza sativa (japonica
           cultivar-group) cultivar Nipponbare clone OSJNBa0093I09,
           from Chromosome 10, complete
           sequence.>gb:AE017076_1751618 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 30 of 77 of the
           complete sequence.
          Length = 687

 Score =  148 bits (373), Expect(2) = 4e-43
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 22/172 (12%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +    +W+TR+ I  G +RGLLYLH+DS++KIIHRDLK SN+LLD+ +NPKI
Sbjct: 425 DTILFDPQKREQLSWETRYQIIHGTARGLLYLHEDSQIKIIHRDLKASNVLLDSNMNPKI 484

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+       + T +V+GT GYM+PEY V G+ SVK DV+S G+++LE+++GR+N
Sbjct: 485 SDFGLARLCSGTKTTSITSQVVGTLGYMAPEYAVLGHLSVKVDVYSFGILVLEIVTGRRN 544

Query: 437 RAFHDSDHH-HNLLGH---------------------AWLLWNDGNPFELMD 348
               D+D    NLL +                      W  W  G P E+ D
Sbjct: 545 TDVFDADEESSNLLSYVRPIDQLFYDFLKAMAFFMLKVWDHWQKGIPLEITD 596



 Score = 49.7 bits (117), Expect(2) = 4e-43
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 3/72 (4%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVA-LPKPKEPGFFVE--RNSTEASSTDK 140
           L+C+H+ LLCV + P DRPTM SV+ ML++ +      P +P F     RN+T +S +  
Sbjct: 613 LKCVHIGLLCVQENPADRPTMLSVLVMLQDVDTTNFAAPSKPAFTFANVRNTTSSSPSAA 672

Query: 139 ERCCYEIAMITF 104
                E+++  F
Sbjct: 673 ALSANEVSISEF 684



>gb:AE005173_893811 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC004255_1531586 Arabidopsis
            thaliana BAC T1F9 chromosome 1, complete sequence.
          Length = 839

 Score =  150 bits (380), Expect(2) = 1e-42
 Identities = 74/142 (52%), Positives = 95/142 (66%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W  R  I  GI+RG+ YLH+DS LK+IHRDLK SNILLD ++NPKISDFGLAR+ +  + 
Sbjct: 622  WPKRLDIIQGIARGIHYLHRDSHLKVIHRDLKVSNILLDEKMNPKISDFGLARMYQGTEY 681

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
               T+RV+GT GYM+PEY   G FS KSD++S GV++LE+ISG K   F        L+ 
Sbjct: 682  QDNTRRVVGTLGYMAPEYAWTGMFSEKSDIYSFGVLMLEIISGEKISRFSYGKEEKTLIA 741

Query: 395  HAWLLWNDGNPFELMDNCVRDS 330
            +AW  W D    +L+D  V DS
Sbjct: 742  YAWESWCDTGGIDLLDKDVADS 763



 Score = 45.4 bits (106), Expect(2) = 1e-42
 Identities = 22/55 (40%), Positives = 30/55 (54%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           RC+ + LLCV   P DRP    ++ ML      LP P++P F V R   ++SS D
Sbjct: 771 RCVQIGLLCVQHQPADRPNTLELLSMLTTTS-DLPPPEQPTFVVHRRDDKSSSED 824



>gb:AE005173_893809 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC004255_1531588 Arabidopsis
            thaliana BAC T1F9 chromosome 1, complete sequence.
          Length = 825

 Score =  153 bits (387), Expect(2) = 1e-42
 Identities = 82/158 (51%), Positives = 100/158 (63%), Gaps = 4/158 (2%)
 Frame = -3

Query: 791  FVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISD 612
            F  D  +     W  RF I  GI+RGLLYLH+DSRL+IIHRDLK SNILLD ++NPKISD
Sbjct: 591  FCLDSKKRLEIDWPKRFDIIQGIARGLLYLHRDSRLRIIHRDLKVSNILLDEKMNPKISD 650

Query: 611  FGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRA 432
            FGLAR+    +   KT+RV+GT GYMSPEY   G FS KSD++S GV+LLE+ISG K   
Sbjct: 651  FGLARMFHGTEYQDKTRRVVGTLGYMSPEYAWAGVFSEKSDIYSFGVLLLEIISGEKISR 710

Query: 431  FHDSDHHHNLLGH----AWLLWNDGNPFELMDNCVRDS 330
            F   +    LL +    AW  W       L+D  + DS
Sbjct: 711  FSYGEEGKTLLAYVSKSAWECWCGARGVNLLDQALGDS 748



 Score = 42.7 bits (99), Expect(2) = 1e-42
 Identities = 25/74 (33%), Positives = 35/74 (47%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC+ + LLCV   P DRP    ++ ML      LP PK+P F V     ++ S D     
Sbjct: 756 RCVQIGLLCVQYQPADRPNTLELLSMLTTTS-DLPLPKQPTFVVHTRDGKSPSNDS---M 811

Query: 127 YEIAMITFSTLEGR 86
             +  +T S + GR
Sbjct: 812 ITVNEMTESVIHGR 825



>gb:AP005156_1848353 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1729_E01.
          Length = 609

 Score =  154 bits (390), Expect(2) = 4e-42
 Identities = 74/164 (45%), Positives = 109/164 (66%), Gaps = 2/164 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +     W  RF I  GI+RGL YLHQDS+ KI+HRD+K SNILLDA++NPKI
Sbjct: 383 DTFLFDAEQKRKLDWAVRFKIIEGIARGLQYLHQDSQKKIVHRDMKASNILLDADMNPKI 442

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            DFGLAR+  +D     T R+ GT+GYM PEYV+ G +S KSDVFS G++++E+++GR+ 
Sbjct: 443 GDFGLARLFGQDQTREVTSRIAGTFGYMPPEYVLRGQYSTKSDVFSFGILVIEIVTGRRR 502

Query: 437 RA--FHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +  +    +  ++L      W +G   E++D+ +  +Y E++V
Sbjct: 503 NSGPYLSEQNDEDILSIVRRHWEEGAIAEMIDHSLGRNYSETEV 546



 Score = 40.0 bits (92), Expect(2) = 4e-42
 Identities = 15/31 (48%), Positives = 24/31 (77%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENE 218
           L+C+++ LLCV + P DRPTMA V+ +L ++
Sbjct: 547 LKCVNIGLLCVQQNPVDRPTMADVMILLNSD 577



>gb:AE005173_893807 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC004255_1531590 Arabidopsis
            thaliana BAC T1F9 chromosome 1, complete
            sequence.>gb:AY090241_1573996 Arabidopsis thaliana
            At1g61380/T1F9_13 mRNA, complete cds.>gb:BT000638_1634916
            Arabidopsis thaliana unknown protein (At1g61380/T1F9_13)
            mRNA, complete cds.
          Length = 805

 Score =  157 bits (396), Expect(2) = 8e-42
 Identities = 81/163 (49%), Positives = 104/163 (63%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD        W  RF I  GI+RGLLYLH+DSRL++IHRDLK SNILLD  +NPKI
Sbjct: 570  DIFIFDPCLKFELDWPKRFNIIQGIARGLLYLHRDSRLRVIHRDLKVSNILLDDRMNPKI 629

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ +       T+RV+GT GYMSPEY   G FS KSD++S GV++LE+ISG++ 
Sbjct: 630  SDFGLARMFQGTQYQDNTRRVVGTLGYMSPEYAWAGLFSEKSDIYSFGVLMLEIISGKRI 689

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVA 309
              F   D    LL + W  W +     L+D  + D+    +VA
Sbjct: 690  SRFIYGDESKGLLAYTWDSWCETGGSNLLDRDLTDTCQAFEVA 732



 Score = 36.6 bits (83), Expect(2) = 8e-42
 Identities = 23/74 (31%), Positives = 33/74 (44%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC+ + LLCV     DRP    V+ ML      LP PK+P F V   +         +  
Sbjct: 733 RCVQIGLLCVQHEAVDRPNTLQVLSML-TSATDLPVPKQPIFAVHTLNDMPMLQANSQDF 791

Query: 127 YEIAMITFSTLEGR 86
             +  +T S ++GR
Sbjct: 792 LSVNEMTESMIQGR 805



>pir|F96639|F96639 protein T1F9.8 [imported] - Arabidopsis
           thaliana>gb:AE005173_893812 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC004255_1531585 Arabidopsis thaliana BAC
           T1F9 chromosome 1, complete sequence.
          Length = 774

 Score =  154 bits (388), Expect(2) = 1e-41
 Identities = 79/139 (56%), Positives = 98/139 (70%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D FVFD  +     W  RF I  GI+RGLLYLH+DSRL++IHRDLK SNILLD ++NPKI
Sbjct: 574 DTFVFDARKKLELDWPKRFEIIEGIARGLLYLHRDSRLRVIHRDLKVSNILLDEKMNPKI 633

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR+ +      KT+RV+GT GYMSPEY   G FS KSD++S GV+LLE+ISG+K 
Sbjct: 634 SDFGLARMFQGTQYQEKTRRVVGTLGYMSPEYAWTGVFSEKSDIYSFGVLLLEIISGKKI 693

Query: 437 RAFHDSDHHHNLLGHAWLL 381
            +F   +    LL +  LL
Sbjct: 694 SSFSYGEEGKALLAYIGLL 712



 Score = 39.3 bits (90), Expect(2) = 1e-41
 Identities = 24/71 (33%), Positives = 34/71 (47%)
 Frame = -1

Query: 298 HVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCCYEI 119
           ++ LLCV   P DRP    ++ ML      LP PK+P F V     E+ S D       +
Sbjct: 708 YIGLLCVQHEPADRPNTLELLSMLTTTS-DLPLPKKPTFVVHTRKDESPSNDS---MITV 763

Query: 118 AMITFSTLEGR 86
             +T S ++GR
Sbjct: 764 NEMTESVIQGR 774



>gb:AP003736_1832664 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1008_E09.>gb:AP005156_1848349 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1729_E01.
          Length = 275

 Score =  154 bits (390), Expect(2) = 2e-41
 Identities = 72/164 (43%), Positives = 110/164 (67%), Gaps = 2/164 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD  +     W TRF I  G +RGL YLH+DS+ KIIHRD+K SNILLDA++NPKI
Sbjct: 53  DTHLFDTEQRKQLDWATRFKIIEGTARGLQYLHEDSQKKIIHRDMKASNILLDADMNPKI 112

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            DFGLA++  +D     T R+ GT+GY+SPEYV+ G +S KSDVFS G++++E+++G++ 
Sbjct: 113 GDFGLAKLFAQDQTREVTSRIAGTFGYISPEYVMCGQYSTKSDVFSFGILVIEIVTGQRR 172

Query: 437 RA--FHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +  +    +  ++L   W  W +G   E++D+ +  +Y E++V
Sbjct: 173 NSGPYFSEQNGVDILSIVWRHWEEGTTAEMIDHSLGRNYNEAEV 216



 Score = 37.4 bits (85), Expect(2) = 2e-41
 Identities = 16/38 (42%), Positives = 24/38 (63%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKP 197
           ++CI++ LLC  + P DRPTM  V+ +L N +   P P
Sbjct: 217 VKCINIGLLCAQQNPVDRPTMVDVMVLL-NSDATCPLP 253



>gb:AY085162_1570243 Arabidopsis thaliana clone 13461 mRNA, complete
            sequence.
          Length = 805

 Score =  155 bits (391), Expect(2) = 3e-41
 Identities = 80/163 (49%), Positives = 104/163 (63%)
 Frame = -3

Query: 797  DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
            D F+FD        W  RF I  GI+RGLLYLH+DSRL++IHR+LK SNILLD  +NPKI
Sbjct: 570  DIFIFDPCLKFELDWPKRFNIIQGIARGLLYLHRDSRLRVIHRNLKVSNILLDDRMNPKI 629

Query: 617  SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
            SDFGLAR+ +       T+RV+GT GYMSPEY   G FS KSD++S GV++LE+ISG++ 
Sbjct: 630  SDFGLARMFQGTQYQDNTRRVVGTLGYMSPEYAWAGLFSEKSDIYSFGVLMLEIISGKRI 689

Query: 437  RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVA 309
              F   D    LL + W  W +     L+D  + D+    +VA
Sbjct: 690  SRFIYGDESKGLLAYTWDSWCETGGSNLLDRDLTDTCQAFEVA 732



 Score = 36.6 bits (83), Expect(2) = 3e-41
 Identities = 23/74 (31%), Positives = 33/74 (44%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCC 128
           RC+ + LLCV     DRP    V+ ML      LP PK+P F V   +         +  
Sbjct: 733 RCVQIGLLCVQHEAVDRPNTLQVLSML-TSATDLPVPKQPIFAVHTLNDMPMLQANSQDF 791

Query: 127 YEIAMITFSTLEGR 86
             +  +T S ++GR
Sbjct: 792 LSVNEMTESMIQGR 805



>gb:AF088885_1767271 Nicotiana tabacum receptor-like kinase CHRK1
           (Chrk1) mRNA, complete cds.
          Length = 739

 Score =  142 bits (359), Expect(2) = 3e-41
 Identities = 68/155 (43%), Positives = 105/155 (67%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D++++D  +     W+TR  I  G+++GLLYL + S   +IHRDLK SNILLD E+ PKI
Sbjct: 503 DFYLYDPVQSLQLDWETRVRIIEGVTQGLLYLQEYSAFTVIHRDLKASNILLDDEMKPKI 562

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+A++ ++D+  A T R++GTYG + PEYV  G +S K DV+S GV+LL+++  +KN
Sbjct: 563 SDFGIAKLFQKDEKEANTGRIVGTYGCVPPEYVKRGLYSRKYDVYSFGVLLLQILGEKKN 622

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRD 333
            + +   +  NLL +A+ LW  GN  + +D  ++D
Sbjct: 623 SSEYGIKNDLNLLEYAYELWEKGNGVDFLDLSLQD 657



 Score = 48.9 bits (115), Expect(2) = 3e-41
 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = -1

Query: 316 K*LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER-NSTEASSTDK 140
           K LR +  ALLCV +  EDRP+M  V  ML+NE   LP PK P F   + N T+ +    
Sbjct: 663 KQLRYMQAALLCVQEKWEDRPSMLEVYSMLKNETEVLPNPKVPAFSKNKDNDTQETLVTP 722

Query: 139 ERCCYEIAMITFSTLEGR 86
           +  C + + +T S L  R
Sbjct: 723 DLTCSDNS-LTISQLIAR 739



>gb:AP003935_1835510 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0661G04.
          Length = 541

 Score =  139 bits (350), Expect(2) = 1e-40
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 1/155 (0%)
 Frame = -3

Query: 788 VFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDF 609
           +F +++  +  W  RF I  G++ GLLYLH+     I+HRDLK SNILLD ++NPKI DF
Sbjct: 319 IFHKTKGALLNWSKRFQIIKGLAEGLLYLHK--HCWIVHRDLKPSNILLDHDMNPKIGDF 376

Query: 608 GLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAF 429
           G A  +  D    +TKRV+GT GY++PEY   G +S+K+DVFS GV++LE ISGRKN   
Sbjct: 377 GSAVTLVSDVAEERTKRVVGTSGYIAPEYASQGLYSLKTDVFSFGVVVLETISGRKNFIM 436

Query: 428 H-DSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
               D    L+  AW +W DG   EL+D  + D Y
Sbjct: 437 EKQRDIVGYLVRDAWHMWKDGRLQELVDPALCDGY 471



 Score = 50.1 bits (118), Expect(2) = 1e-40
 Identities = 22/41 (53%), Positives = 27/41 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           +RC  VALLC  + P DRPTM  V  ML++E + L  PKEP
Sbjct: 477 MRCTQVALLCAQEDPADRPTMTDVTAMLDSESIMLSDPKEP 517



>gb:AP003770_1833321 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0550B04.>gb:AP005457_1852188 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0532H03.
          Length = 540

 Score =  142 bits (358), Expect(2) = 1e-39
 Identities = 72/158 (45%), Positives = 100/158 (63%), Gaps = 1/158 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +F + +  +  W  R  I  G++ GLLYLH+     I+HRDLK +NILLD ++NPKI
Sbjct: 293 DNIIFHKRKGALLNWSKRLQIIKGLAEGLLYLHK--HCLIVHRDLKPNNILLDHDMNPKI 350

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG A  +  D     T+RV+GT GY++PEY  +G +S+K+DVFS GV++LE+ISGRKN
Sbjct: 351 ADFGSAVTLVSDVAEECTRRVVGTSGYIAPEYASEGRYSLKTDVFSFGVVVLEIISGRKN 410

Query: 437 RAFH-DSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSY 327
                  D   NL+  AW +W DG   EL+D  + D Y
Sbjct: 411 FIMEKQGDTVGNLIRDAWHMWRDGRLHELVDPALCDEY 448



 Score = 43.9 bits (102), Expect(2) = 1e-39
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 6/63 (9%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP------GFFVERNSTEASS 149
           +RC  VALLC  + P +RPTM  V  +L ++ + L  PK+P      G   +R ST    
Sbjct: 454 MRCTQVALLCAQEDPTERPTMTDVTRVLNSQSILLSDPKKPTELTDGGASTDRPSTYIGQ 513

Query: 148 TDK 140
           + K
Sbjct: 514 SSK 516



>gb:OSJN00082_1694555 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0061C06, complete sequence.
          Length = 443

 Score =  138 bits (347), Expect(2) = 5e-39
 Identities = 72/170 (42%), Positives = 104/170 (61%), Gaps = 8/170 (4%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +F+  +     W+ RF+I  GI+RGLLYLH++S  KII RDLK SN+LLD ++ PKI
Sbjct: 179 DTILFEPEKRQQLDWRKRFMIICGIARGLLYLHEESSQKIIDRDLKPSNVLLDEDMIPKI 238

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR    +     T+R +GT GYMSPEY   G+ S KSD+FS GVI+LE+++GR++
Sbjct: 239 SDFGLARAFGGEQSKDVTRRPVGTLGYMSPEYAYCGHVSTKSDMFSFGVIVLEMVTGRRS 298

Query: 437 RAF--------HDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
                      ++S    +LL + W  W   +  + +D  +   Y E++V
Sbjct: 299 NGMYASTKSDTYESADSTSLLSYVWEKWRTRSLADAVDASLGGRYPENEV 348



 Score = 46.2 bits (108), Expect(2) = 5e-39
 Identities = 18/42 (42%), Positives = 27/42 (64%)
 Frame = -1

Query: 304 CIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           C+ + LLCV + P DRP +++VV ML +   +L  P +P FF
Sbjct: 351 CVQIGLLCVQENPADRPDISAVVLMLSSNSTSLQTPSKPAFF 392



>pir|A96640|A96640 protein T1F9.2 [imported] - Arabidopsis
            thaliana>gb:AE005173_893818 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC004255_1531579 Arabidopsis thaliana BAC
            T1F9 chromosome 1, complete sequence.
          Length = 817

 Score =  144 bits (363), Expect(2) = 8e-39
 Identities = 78/163 (47%), Positives = 99/163 (60%), Gaps = 8/163 (4%)
 Frame = -3

Query: 794  YFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKIS 615
            Y+  D  +     W  RF I  GI+RGL YLH+DS L++IHRDLK SNILLD ++NPKIS
Sbjct: 579  YYCLDSRKRLEIDWPKRFNIIEGIARGLHYLHRDSCLRVIHRDLKVSNILLDEKMNPKIS 638

Query: 614  DFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNR 435
            DFGLAR+ +  +    T+RV GT GYM+PEY   G FS KSD++S GVILLE+I+G K  
Sbjct: 639  DFGLARMYQGTEYQDNTRRVAGTLGYMAPEYAWTGMFSEKSDIYSFGVILLEIITGEKIS 698

Query: 434  AFHDSDHHHNLLGH--------AWLLWNDGNPFELMDNCVRDS 330
             F        LL +        AW  W +    +L+D  V DS
Sbjct: 699  RFSYGRQGKTLLAYVNLKPKQQAWESWCESGGIDLLDKDVADS 741



 Score = 39.3 bits (90), Expect(2) = 8e-39
 Identities = 20/53 (37%), Positives = 26/53 (49%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASS 149
           RC+ + LLCV   P DRP    ++ ML      L  PK+P F V     E+ S
Sbjct: 749 RCVQIGLLCVQHQPADRPNTMELLSMLTTTS-DLTSPKQPTFVVHTRDEESLS 800



>pir|B96729|B96729 hypothetical protein F24J13.9 [imported] -
           Arabidopsis thaliana>gb:AE005173_894636 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC010796_1537111 Arabidopsis thaliana
           chromosome 1 BAC F24J13 genomic sequence, complete
           sequence.>gb:AK118924_1816875 Arabidopsis thaliana
           At1g70520 mRNA for putative protein kinase, complete
           cds, clone: RAFL21-26-G23.
          Length = 649

 Score =  134 bits (336), Expect(2) = 8e-39
 Identities = 65/150 (43%), Positives = 96/150 (64%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD +R     WQ R+ I  G + GL+YLH+ S +KIIHRD+K SNILLD++L  KI
Sbjct: 407 DRFIFDVNRGKTLDWQRRYTIIVGTAEGLVYLHEQSSVKIIHRDIKASNILLDSKLQAKI 466

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLAR  ++D     T  + GT GYM+PEY+  G  +   DV+S GV++LE+++G++N
Sbjct: 467 ADFGLARSFQDDKSHIST-AIAGTLGYMAPEYLAHGQLTEMVDVYSFGVLVLEIVTGKQN 525

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
                SD+  +L+  AW  +  G   ++ D
Sbjct: 526 TKSKMSDYSDSLITEAWKHFQSGELEKIYD 555



 Score = 49.7 bits (117), Expect(2) = 8e-39
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 1/75 (1%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERC- 131
           R + + LLC  ++P  RP M+ ++ ML+N+E  LP P  P F  ER       +D +   
Sbjct: 575 RVVQIGLLCTQEIPSLRPPMSKLLHMLKNKEEVLPLPSNPPFMDERVMELRDGSDGDSAG 634

Query: 130 CYEIAMITFSTLEGR 86
           C  +A ++ S+  GR
Sbjct: 635 CASLATVSQSSFYGR 649



>gb:AP005810_1858259 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0696F12.
          Length = 649

 Score =  153 bits (386), Expect(2) = 4e-38
 Identities = 75/161 (46%), Positives = 108/161 (67%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +FD ++     W+ ++ I  GI++G+LYLH+DS L+IIHRDLK++NILL  ++ PKI
Sbjct: 438 DNILFDTTKGNSLNWEQQYNIILGIAKGILYLHEDSSLRIIHRDLKSNNILLGEDMEPKI 497

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLAR++ E    ++T RV+GT+GYM+PEYV DGN S K D+FS GV++LE++  R+N
Sbjct: 498 ADFGLARLLGEGHTHSRTTRVVGTFGYMAPEYVADGNVSTKIDIFSFGVLVLEIVMRRRN 557

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
               D D + NLL   W  W  G   + +D  + D Y  SQ
Sbjct: 558 SDSGDHD-NVNLLTDVWNSWTKGTISQFIDQSL-DGYSRSQ 596



 Score = 28.1 bits (61), Expect(2) = 4e-38
 Identities = 11/23 (47%), Positives = 14/23 (60%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMAS 242
           +RCIH+ LLCV   PE   +  S
Sbjct: 598 MRCIHIGLLCVQPDPESASSSTS 620



>gb:AB092809_1525114 Lotus corniculatus var. japonicus HAR1 gene for
            LRR receptor-like kinase, hypothetical proteins, complete
            and partial cds, clone:BAC259.12D-2.
          Length = 730

 Score =  159 bits (403), Expect = 4e-38
 Identities = 87/161 (54%), Positives = 103/161 (63%), Gaps = 24/161 (14%)
 Frame = -3

Query: 722  SRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDGLAKTKRVIGTY 543
            +R L Y   DSRL+IIHRDLKTSNILLD+E+NPKISDFGLARI   D   AKTKRV+GTY
Sbjct: 562  NRSLDYFIFDSRLRIIHRDLKTSNILLDSEMNPKISDFGLARIFTGDQVEAKTKRVMGTY 621

Query: 542  GYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLGH---------- 393
            GYMSPEY V G+FSVKSDVFS GVI+LE+ISG+K   F D  HH NLL H          
Sbjct: 622  GYMSPEYAVHGSFSVKSDVFSFGVIVLEIISGKKIGRFCDPHHHRNLLSHSSNFAVFLIK 681

Query: 392  --------------AWLLWNDGNPFELMDNCVRDSYVESQV 312
                          AW LW +  P EL+D  +    + +++
Sbjct: 682  ALRICMFENVKNRKAWRLWIEERPLELVDELLDGLAIPTEI 722



>gb:AP003863_1834463 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1058_A12.
          Length = 597

 Score =  159 bits (401), Expect = 7e-38
 Identities = 76/135 (56%), Positives = 99/135 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD+ +  +  W+ R  I  G+ +GLLYLH+ SR++IIHRDLK SNILLD +LNPKI
Sbjct: 445 DFFIFDQEQGPLLDWKKRLHIIEGVVQGLLYLHKHSRVRIIHRDLKASNILLDKDLNPKI 504

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFG+ARI   +   A T RV+GTYGYM+PEY  +G FSVKSDVFS GV+LLE++SG++N
Sbjct: 505 SDFGMARIFGSNMTEANTNRVVGTYGYMAPEYASEGIFSVKSDVFSFGVLLLEIVSGKRN 564

Query: 437 RAFHDSDHHHNLLGH 393
                     NLLG+
Sbjct: 565 SGHQHYGEFVNLLGY 579



>pir|H96731|H96731 hypothetical protein F5A18.8 [imported] -
           Arabidopsis thaliana>gb:AE005173_894658 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011663_1537314 Arabidopsis thaliana
           chromosome 1 BAC F5A18 genomic sequence, complete
           sequence.
          Length = 381

 Score =  145 bits (365), Expect(2) = 8e-38
 Identities = 79/162 (48%), Positives = 104/162 (64%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +F  +R     W+ RF I TGI+RGLLYLH+D+   IIHRD+K  NILLD +  PKI
Sbjct: 100 DKVLFKSNRKSEIDWKQRFEIITGIARGLLYLHEDAPNCIIHRDIKAGNILLDEKWVPKI 159

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+AR+ +ED     T RV GT GYM+PEYV+ G  SVK+DVFS GV++LEL+SG+KN
Sbjct: 160 ADFGMARLYQEDVTHVNT-RVAGTNGYMAPEYVMHGVLSVKADVFSFGVLVLELVSGQKN 218

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
            +F        LL  A+ L+  G   E++D  +  S    QV
Sbjct: 219 SSFSMRHPDQTLLEWAFKLYKKGRTMEILDQDIAASADPDQV 260



 Score = 35.0 bits (79), Expect(2) = 8e-38
 Identities = 15/40 (37%), Positives = 21/40 (52%)
 Frame = -1

Query: 304 CIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPG 185
           C+ + LLCV   P  RP+M  V  +L  +   L +P  PG
Sbjct: 263 CVQIGLLCVQGDPHQRPSMRRVSLLLSRKPGHLEEPDHPG 302



>pir|T04836|T04836 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.80 - Arabidopsis
           thaliana>gb:ATCHRIV58_1546156 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 58.>gb:ATF21P8_1549621
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 570

 Score =  157 bits (396), Expect = 3e-37
 Identities = 73/127 (57%), Positives = 93/127 (73%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           DYF+FD  +     W  R+ I  GI+RG+LYLHQDSRLKIIHRDLK SNILLDA++NPKI
Sbjct: 420 DYFLFDPEKQSQLDWTRRYKIIGGIARGILYLHQDSRLKIIHRDLKASNILLDADMNPKI 479

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGLA I   +     T R+ GTY YMSPEY + G +S+KSD++S GV++LE+ISG+KN
Sbjct: 480 ADFGLATIFGVEQTQGNTNRIAGTYAYMSPEYAMHGQYSMKSDIYSFGVLVLEIISGKKN 539

Query: 437 RAFHDSD 417
              +  D
Sbjct: 540 SGVYQMD 546



>pir|T04844|T04844 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F21P8.160 - Arabidopsis
           thaliana>gb:ATCHRIV59_1546164 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 59.>gb:ATF21P8_1549629
           Arabidopsis thaliana DNA chromosome 4, BAC clone F21P8
           (ESSA project).
          Length = 581

 Score =  156 bits (395), Expect = 4e-37
 Identities = 75/127 (59%), Positives = 95/127 (74%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D+F+FD +      W  R+ I  GI+RG+LYLHQDSRL IIHRDLK  NILLD ++NPKI
Sbjct: 383 DHFLFDSTMKMKLDWTRRYKIIGGIARGILYLHQDSRLTIIHRDLKAGNILLDDDMNPKI 442

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFG+ARI   D   A T+RV+GTYGYMSPEY + G FS+KSDV+S GV++LE+ISG KN
Sbjct: 443 ADFGMARIFGMDQTEAMTRRVVGTYGYMSPEYAMYGQFSMKSDVYSFGVLVLEIISGMKN 502

Query: 437 RAFHDSD 417
            + +  D
Sbjct: 503 SSLYQMD 509



 Score = 42.7 bits (99), Expect = 0.008
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
 Frame = -1

Query: 265 EDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEA--SSTDKERCCYEIAMIT 107
           EDRPTM+S+V ML    +AL +P+ PGFF      +A  S      C  + A IT
Sbjct: 522 EDRPTMSSIVQMLTTSLIALAEPRPPGFFFRSKQEQAGPSIDSSTHCSVDEASIT 576



>gb:AB006702_1509943 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPO12.
          Length = 651

 Score =  141 bits (355), Expect(2) = 7e-37
 Identities = 76/171 (44%), Positives = 104/171 (60%), Gaps = 3/171 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FDES+  +  W  R  I  G + GL YLH  S ++IIHRD+KTSN+LLD +LNPKI
Sbjct: 397 DQFLFDESQSKVLNWSQRLNIILGTAEGLAYLHGGSPVRIIHRDIKTSNVLLDDQLNPKI 456

Query: 617 SDFGLARIVEEDDGLAKT---KRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISG 447
           +DFGLAR      GL KT     + GT GYM+PEYVV G  + K+DV+S GV++LE+  G
Sbjct: 457 ADFGLARCF----GLDKTHLSTGIAGTLGYMAPEYVVRGQLTEKADVYSFGVLVLEIACG 512

Query: 446 RKNRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSC 294
            +  AF     H  LL   W L+      E +D C++D +++ Q +   +C
Sbjct: 513 TRINAFVPETGH--LLQRVWNLYTLNRLVEALDPCLKDEFLQVQGSEAEAC 561



 Score = 35.8 bits (81), Expect(2) = 7e-37
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNST---EASST 146
           + + V LLC    P  RP+M  V+ ML   +  +P P  P F    + T   E SST
Sbjct: 562 KVLRVGLLCTQASPSLRPSMEEVIRMLTERDYPIPSPTSPPFLRVSSLTTDLEGSST 618



>pir|T10570|T10570 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F25E4.120 - Arabidopsis thaliana (fragment)
          Length = 239

 Score =  139 bits (351), Expect(2) = 7e-37
 Identities = 73/155 (47%), Positives = 100/155 (64%), Gaps = 1/155 (0%)
 Frame = -3

Query: 791 FVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISD 612
           F+ + ++ G   W  R+ I  GI+RG+LYLHQD RL IIHRDLK SNILLD ++ PKI+D
Sbjct: 52  FINNPAKQGELDWTRRYNIIGGIARGILYLHQDLRLTIIHRDLKASNILLDVDMKPKIAD 111

Query: 611 FGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRA 432
           FG+ARI   D                  +Y +  +FS+KSDV+S GV++LE+ISG+ NR+
Sbjct: 112 FGMARIYRIDQ-----------------KYAMRSHFSMKSDVYSFGVMILEIISGKTNRS 154

Query: 431 FHDSD-HHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           F+  D    NL+ HAW LW  G+PFEL+D  + +S
Sbjct: 155 FYYIDGSPSNLVTHAWKLWRTGSPFELVDPTMGES 189



 Score = 37.4 bits (85), Expect(2) = 7e-37
 Identities = 17/29 (58%), Positives = 23/29 (79%), Gaps = 1/29 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTM-ASVVFML 227
           +RCIH+ALLCV + P DRP + A++V ML
Sbjct: 197 IRCIHIALLCVQEDPVDRPMLPAAIVVML 225



>pir|G85121|G85121 serine/threonine kinase-like protein (partial)
           [imported] - Arabidopsis thaliana>gb:ATCHRIV32_1544915
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 32.>gb:ATF25E4_1549987 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F25E4 (ESSA project).
          Length = 239

 Score =  139 bits (351), Expect(2) = 7e-37
 Identities = 73/155 (47%), Positives = 100/155 (64%), Gaps = 1/155 (0%)
 Frame = -3

Query: 791 FVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISD 612
           F+ + ++ G   W  R+ I  GI+RG+LYLHQD RL IIHRDLK SNILLD ++ PKI+D
Sbjct: 52  FINNPAKQGELDWTRRYNIIGGIARGILYLHQDLRLTIIHRDLKASNILLDVDMKPKIAD 111

Query: 611 FGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRA 432
           FG+ARI   D                  +Y +  +FS+KSDV+S GV++LE+ISG+ NR+
Sbjct: 112 FGMARIYRIDQ-----------------KYAMRSHFSMKSDVYSFGVMILEIISGKTNRS 154

Query: 431 FHDSD-HHHNLLGHAWLLWNDGNPFELMDNCVRDS 330
           F+  D    NL+ HAW LW  G+PFEL+D  + +S
Sbjct: 155 FYYIDGSPSNLVTHAWKLWRTGSPFELVDPTMGES 189



 Score = 37.4 bits (85), Expect(2) = 7e-37
 Identities = 17/29 (58%), Positives = 23/29 (79%), Gaps = 1/29 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTM-ASVVFML 227
           +RCIH+ALLCV + P DRP + A++V ML
Sbjct: 197 IRCIHIALLCVQEDPVDRPMLPAAIVVML 225



>gb:AP006529_1862252 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1114D08.
          Length = 400

 Score =  132 bits (333), Expect(2) = 3e-36
 Identities = 74/171 (43%), Positives = 96/171 (56%), Gaps = 3/171 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F ES   + +W+ R  I   I+ GL YLH+DSR  IIHRDLK            KI
Sbjct: 184 DAFIFHESGRAMLSWKMRMDIILDIASGLQYLHKDSRHTIIHRDLKVV---------AKI 234

Query: 617 SDFGLARIVEEDDG---LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISG 447
           SDFG+AR+   + G      T RV+GT GYMSPEY +DG  S   DV+S GV+LLE+ISG
Sbjct: 235 SDFGIARLFSHNGGNQDCTITDRVVGTPGYMSPEYAMDGKLSFMQDVYSFGVLLLEIISG 294

Query: 446 RKNRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSC 294
           + N+         +L+ H W LW DG   EL+D  VR     S++    +C
Sbjct: 295 KHNQG------TSSLIAHTWRLWEDGRNLELLDPAVRGECTASELEQATTC 339



 Score = 42.4 bits (98), Expect(2) = 3e-36
 Identities = 20/39 (51%), Positives = 26/39 (66%)
 Frame = -1

Query: 304 CIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEP 188
           CI V LLCV + P+ RP MA V+ ML  E+ AL +P+ P
Sbjct: 339 CIQVGLLCVQESPDQRPPMADVIHMLSREK-ALGQPRRP 376



>gb:AE005172_890149 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC011661_1537286 Genomic sequence
            for Arabidopsis thaliana BAC T23J18 from chromosome I,
            complete sequence.
          Length = 906

 Score =  117 bits (293), Expect(2) = 6e-36
 Identities = 67/169 (39%), Positives = 97/169 (57%), Gaps = 10/169 (5%)
 Frame = -3

Query: 788  VFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDF 609
            + DE +     W  R  I  GI RG+LYLHQDSRL+IIHRDLK SN     E   + S+ 
Sbjct: 660  LIDEEQRAELDWPKRMGIIRGIGRGILYLHQDSRLRIIHRDLKASNATKSKEAQIESSEH 719

Query: 608  G-LARIVEEDD-----GLAKTKRVIGTY---GYMSPEYVVDGNFSVKSDVFSLGVILLEL 456
              L   +            ++ R   ++   GYMSPEY +DG FS+KSDV+S GV++LE+
Sbjct: 720  SELIYYINPSPQNSPISFFQSLRSFQSHCHSGYMSPEYAMDGQFSIKSDVYSFGVLILEI 779

Query: 455  ISGRKNRAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCV-RDSYVESQV 312
            I+G++N AF++     NL+ H W  W +G   E++D  +  ++Y E +V
Sbjct: 780  ITGKRNSAFYEES--LNLVKHIWDRWENGEAIEIIDKLMGEETYDEGEV 826



 Score = 56.6 bits (135), Expect(2) = 6e-36
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFV--ERNSTEASSTD 143
            ++C+H+ LLCV +   DRP M+SVVFML +  + LP PK P F     RN+    S+D
Sbjct: 827  MKCLHIGLLCVQENSSDRPDMSSVVFMLGHNAIDLPSPKHPAFTAGRRRNTKTGGSSD 884



>pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis
            thaliana>gb:AE005173_893243 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC008007_1536424 Genomic sequence for
            Arabidopsis thaliana BAC F12M16 from chromosome I,
            complete sequence.
          Length = 854

 Score =  140 bits (352), Expect(2) = 6e-36
 Identities = 68/151 (45%), Positives = 99/151 (65%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W TR  I  G++RGL YLH++SRLKI+HRD+K +N+LLD +LNPKISDFGLA++ EED  
Sbjct: 622  WPTRRKICIGVARGLAYLHEESRLKIVHRDIKATNVLLDKQLNPKISDFGLAKLDEEDST 681

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
               T R+ GT+GYM+PEY + G+ + K+DV+S G++ LE++ GR N+     ++   L+ 
Sbjct: 682  HIST-RIAGTFGYMAPEYAMRGHLTDKADVYSFGIVALEIVHGRSNKIERSKNNTFYLID 740

Query: 395  HAWLLWNDGNPFELMDNCVRDSYVESQVATM 303
               +L    N  EL+D  +   Y   +  TM
Sbjct: 741  WVEVLREKNNLLELVDPRLGSEYNREEAMTM 771



 Score = 33.9 bits (76), Expect(2) = 6e-36
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = -1

Query: 301 IHVALLCVSKLPEDRPTMASVVFMLENEE-VALPKPKEPGFFVERNSTEASSTDKE 137
           I +A++C S  P +RP+M+ VV MLE ++ V + K +E     E    E  +T K+
Sbjct: 772 IQIAIMCTSSEPCERPSMSEVVKMLEGKKMVEVEKLEEASVHRETKRLENMNTMKK 827



>gb:AF474072_1803107 Hordeum vulgare sp. vulgare cultivar Morex BAC
           clone 773k14, complete sequence.
          Length = 426

 Score =  134 bits (337), Expect(2) = 1e-35
 Identities = 71/158 (44%), Positives = 93/158 (58%)
 Frame = -3

Query: 755 WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
           W+TR  I  GI RGL YLH++S L+I+HRD+K SNILLD +  PKISDFGLAR   ED  
Sbjct: 184 WRTRHQIIIGIGRGLQYLHEESNLRIVHRDIKASNILLDDKFQPKISDFGLARFFPEDQT 243

Query: 575 LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
              T    GT GY +PEY + G  +VK+D +S GV++LE+IS RKN   +  +    L  
Sbjct: 244 YLST-AFAGTLGYTAPEYAIRGELTVKADTYSFGVLVLEIISSRKNTDLNLPNEMQYLPE 302

Query: 395 HAWLLWNDGNPFELMDNCVRDSYVESQVATMHSCSSSL 282
           HAW L+      EL+D  V+      +   M  C  +L
Sbjct: 303 HAWRLYEQSKILELVDGRVQGGEGFEEKEVMLVCQIAL 340



 Score = 38.5 bits (88), Expect(2) = 1e-35
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 4/55 (7%)
 Frame = -1

Query: 295 VALLCVSKLPEDRPTMASVVFMLE-NEEVALPKPKEPGFFVERN---STEASSTD 143
           +ALLCV   P  RP M+ VV ML    + ++P P +P F   +N     +A+S+D
Sbjct: 338 IALLCVQPYPNSRPAMSEVVRMLTMKTDQSIPAPAKPAFLDRKNLNGDRDAASSD 392



>gb:AP004553_1841485 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1790_D02.>gb:AP004645_1842562 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1119_B10.
          Length = 578

 Score =  124 bits (311), Expect(2) = 2e-35
 Identities = 71/171 (41%), Positives = 106/171 (61%), Gaps = 3/171 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQ-DSRLKIIHRDLKTSNILLDAELNPK 621
           D F+   +R     W + F I  GI+ GLLYLH  ++ + I+HRDLK SNILLD+++N K
Sbjct: 331 DKFIHGPNREVSFDWFSCFKIIQGIAEGLLYLHTYEAEICIVHRDLKPSNILLDSDMNAK 390

Query: 620 ISDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRK 441
           I DFG+A+ +       +   V GT+GY++PEY+  G  S K DV++ GVILLE+I+GR+
Sbjct: 391 IGDFGIAKTISP--ARQQDTYVSGTFGYIAPEYLRGGILSTKVDVYAYGVILLEIITGRR 448

Query: 440 N--RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATMHSC 294
           +      D ++ H L  +AW LW  G   EL+D  +R+   E+++A + SC
Sbjct: 449 SCIPCLKDDEYVH-LTEYAWDLWRTGRSAELLDAALRN---EARIAEITSC 495



 Score = 48.1 bits (113), Expect(2) = 2e-35
 Identities = 24/54 (44%), Positives = 34/54 (62%)
 Frame = -1

Query: 304 CIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTD 143
           CI +ALLCV K P DRP+M  V+ ML +E++ +  PK+PG  +  + T   S D
Sbjct: 495 CIQIALLCVQKDPADRPSMLDVLAMLRDEKI-VAAPKKPGDLLLGDETSVESGD 547



>gb:OSJN00082_1694565 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0061C06, complete sequence.
          Length = 375

 Score =  125 bits (313), Expect(2) = 2e-35
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 9/171 (5%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +     W+ RF+I  GI+RGLLYLH++S  KIIHRD          E+NPKI
Sbjct: 93  DTFLFDSDKRQQLDWRKRFMIIYGIARGLLYLHEESSQKIIHRDHTW-------EMNPKI 145

Query: 617 SDFGLARIVEEDDGLAKTKR-VIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRK 441
           SDFGLAR    D     T+R  +GT GYMSPEY   G+ S KSD+FS GVI+LE+++GR+
Sbjct: 146 SDFGLARAFGGDQSKDITRRRPVGTLGYMSPEYAYCGHVSTKSDMFSFGVIVLEMVTGRR 205

Query: 440 NRAFHDSDHHHN--------LLGHAWLLWNDGNPFELMDNCVRDSYVESQV 312
           N   + S    +        LL + W  W   +  + +D  +   Y E++V
Sbjct: 206 NNGIYASTRTDSSECMDSIYLLSYVWEKWRTRSLADAVDASLGGRYRENEV 256



 Score = 47.4 bits (111), Expect(2) = 2e-35
 Identities = 19/44 (43%), Positives = 29/44 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF 179
           L C+ + LLCV + P DRP +++VV ML +  ++L  P +P FF
Sbjct: 257 LSCVQIGLLCVQENPADRPDISAVVLMLSSNSMSLRTPSKPAFF 300



>gb:OSJN00093_1694775 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 1025

 Score =  134 bits (336), Expect(2) = 3e-35
 Identities = 64/141 (45%), Positives = 95/141 (67%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W  RF I  GI+RGL YLH++S ++++HRD+K SN+LLDA LNPKISDFGLA++ ++   
Sbjct: 791  WPARFDICLGIARGLAYLHEESSIRVVHRDIKASNVLLDANLNPKISDFGLAKLYDDKKT 850

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
               TK V GT+GY++PEY + G+ + K DVF+ GV+LLE ++GR N      +    +  
Sbjct: 851  HVSTK-VAGTFGYLAPEYAMRGHMTEKVDVFAFGVVLLETLAGRPNYDDTLEEDKIYIFE 909

Query: 395  HAWLLWNDGNPFELMDNCVRD 333
             AW L+ + NP  ++D  +R+
Sbjct: 910  WAWELYENNNPLGIVDPNLRE 930



 Score = 37.7 bits (86), Expect(2) = 3e-35
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
            LR IHVALLC    P  RP M+ VV ML  +        +P +  E
Sbjct: 937  LRAIHVALLCTQGSPHQRPPMSRVVSMLTGDTEVTDVLMKPSYITE 982



>gb:OSJN00153_1695778 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0011F23, complete sequence.
          Length = 415

 Score =  134 bits (338), Expect(2) = 5e-35
 Identities = 74/173 (42%), Positives = 100/173 (57%), Gaps = 1/173 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +F         W+TR  I  GI+RGL YLH++S L+I+HRD+K SNILLD +  PKI
Sbjct: 163 DKILFGVDGAPFLNWKTRHQIIIGIARGLQYLHEESNLRIVHRDIKASNILLDDKFQPKI 222

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           SDFGLAR   ED     T    GT GY +PEY + G  +VK+D +S GV++LE++S RKN
Sbjct: 223 SDFGLARFFPEDQTYLST-AFAGTLGYTAPEYAIRGELTVKADTYSFGVLVLEIVSSRKN 281

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVR-DSYVESQVATMHSCSSSL 282
                 +    L  HAW L+      EL+D  ++ D + E +V  M  C  +L
Sbjct: 282 TDLSLPNEMQYLPEHAWRLYEQSKILELVDAKLQADGFDEKEV--MQVCQIAL 332



 Score = 36.2 bits (82), Expect(2) = 5e-35
 Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFML---ENEEVALPKPKEPGF 182
           ++   +ALLCV   P  RP M+ VV ML     E+  +P P  P F
Sbjct: 325 MQVCQIALLCVQPFPNLRPAMSEVVLMLTMKTTEQSVIPAPVRPAF 370



>gb:AC079357_1732541 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0033D06, complete sequence.
          Length = 702

 Score =  130 bits (328), Expect(2) = 6e-35
 Identities = 67/157 (42%), Positives = 97/157 (61%), Gaps = 1/157 (0%)
 Frame = -3

Query: 788 VFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDF 609
           V D  +     W+ RF I  G + GL YLH  S ++IIHRD+K SN+LLD    PKI+DF
Sbjct: 433 VADAFKKTALDWERRFEIILGTAEGLSYLHNASEIRIIHRDIKASNVLLDERFRPKIADF 492

Query: 608 GLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN-RA 432
           GLAR   ED     T  + GT+GYM+PEY+V G  + K+D++S GV++LE+I+GRK+  +
Sbjct: 493 GLARNFMEDQSHLST-GLAGTFGYMAPEYIVHGQLTEKADIYSYGVLVLEIITGRKSLNS 551

Query: 431 FHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVE 321
              S   H+L+   W  +N+G   EL+D  +++   E
Sbjct: 552 VASSAEGHSLMSLIWKHYNEGTLMELLDPNLQEQCTE 588



 Score = 39.7 bits (91), Expect(2) = 6e-35
 Identities = 21/55 (38%), Positives = 27/55 (49%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASST 146
           L+  HV LLC    P  RP M  VV ML +    LP+P +P F   + S   S +
Sbjct: 592 LKVFHVGLLCAQASPNLRPPMWKVVEMLGSRNNELPRPTQPPFINIKGSNAKSDS 646



>gb:OSJN00093_1694778 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 948

 Score =  134 bits (338), Expect(2) = 8e-35
 Identities = 65/136 (47%), Positives = 92/136 (67%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W  RF I  GI+RGL YLH++S +++IHRD+K SN+LLDA LNPKISDFGLA++ ++   
Sbjct: 717  WPARFEICLGIARGLAYLHEESSIRVIHRDIKASNVLLDANLNPKISDFGLAKLYDDKKT 776

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
               TK V GT+GY++PEY + G  + K DVF+ GV+LLE+++GR N      +    +  
Sbjct: 777  HVSTK-VAGTFGYLAPEYAMRGRMTEKVDVFAFGVVLLEILAGRPNYDDALEEDKIYIFE 835

Query: 395  HAWLLWNDGNPFELMD 348
             AW L+ + NP  L+D
Sbjct: 836  WAWDLYENNNPLGLVD 851



 Score = 35.4 bits (80), Expect(2) = 8e-35
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = -1

Query: 310  LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVE 173
            LR I VALLC    P  RP M+ VV ML  +  A     +P +  E
Sbjct: 863  LRAIRVALLCTQGSPHQRPPMSRVVTMLAGDVEAPEVVTKPSYITE 908



>gb:AE005172_890869 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC068602_1540398 Genomic sequence
           for Arabidopsis thaliana BAC F14D16 from chromosome I,
           complete sequence.
          Length = 668

 Score =  127 bits (318), Expect(2) = 1e-34
 Identities = 66/161 (40%), Positives = 102/161 (63%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +F ++   I +W+ RF I  GIS GL YLH+ S +KIIHRD+KTSNILLD  L+PKI
Sbjct: 453 DQILFMKNTVHILSWKQRFNIIIGISEGLEYLHRGSEVKIIHRDIKTSNILLDRNLSPKI 512

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKN 438
           +DFGL R +  D     T  + GT GY++PEY++ G  + K+DV++ GV+++E+++G+KN
Sbjct: 513 ADFGLIRSMGTDKTQTNT-GIAGTLGYLAPEYLIKGQLTEKADVYAFGVLIIEIVTGKKN 571

Query: 437 RAFHDSDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQ 315
            AF  +    ++L   W  +        +D  ++ S+VE +
Sbjct: 572 NAF--TQGTSSVLYSVWEHFKANTLDRSIDPRLKGSFVEEE 610



 Score = 42.7 bits (99), Expect(2) = 1e-34
 Identities = 18/43 (41%), Positives = 28/43 (65%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF 182
           L+ + + LLCV    E RP+M+ +VFML+N++     PK+P F
Sbjct: 612 LKVLQIGLLCVQSSVELRPSMSEIVFMLQNKDSKFEYPKQPPF 654



>gb:AP005679_1855873 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1210_A07.>gb:AP005742_1856973 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0489D11.
          Length = 816

 Score =  148 bits (373), Expect = 1e-34
 Identities = 70/119 (58%), Positives = 90/119 (75%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D  +F   R     W  RF I  G++RGL+YLH DSRL IIHRDLKTSN LLD+E+ PKI
Sbjct: 621 DVAIFKSERGVTLDWPARFRIIKGVARGLVYLHHDSRLTIIHRDLKTSNALLDSEMRPKI 680

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRK 441
           +DFG+ARI  ++   A T+RV+GTYGYM+PEY ++G FSVK+D++S GV+LLE+ISG K
Sbjct: 681 ADFGMARIFGDNQQNANTRRVVGTYGYMAPEYAMEGMFSVKTDIYSFGVLLLEVISGVK 739



 Score = 43.1 bits (100), Expect = 0.006
 Identities = 24/67 (35%), Positives = 35/67 (52%)
 Frame = -1

Query: 286 LCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVERNSTEASSTDKERCCYEIAMIT 107
           L V + P+DRP M+SVV +LEN    LP P  P +F  R +   +   ++        +T
Sbjct: 752 LIVYENPDDRPLMSSVVSILENGSTTLPTPNHPAYFAPRKN--GADQRRDNVFNSGNEMT 809

Query: 106 FSTLEGR 86
            + LEGR
Sbjct: 810 LTVLEGR 816



>gb:AP005442_1851834 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OSJNBa0073I05.
          Length = 864

 Score =  138 bits (348), Expect(2) = 1e-34
 Identities = 71/138 (51%), Positives = 95/138 (68%), Gaps = 2/138 (1%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W+TRF I  GI+RGL YLH++S  +I+HRD+KTSN+LLDA LNPKISDFGLAR   +   
Sbjct: 613  WRTRFEICVGIARGLAYLHEESSTRIVHRDIKTSNVLLDANLNPKISDFGLARHYNDSMT 672

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDS--DHHHNL 402
               T  V GT GY++PEY + G+ + K+DVF+ G++ +E+I+GR N  F DS  D    L
Sbjct: 673  HVST-GVAGTLGYLAPEYAMMGHLTEKADVFAFGIVAMEIIAGRPN--FDDSVEDDKKYL 729

Query: 401  LGHAWLLWNDGNPFELMD 348
            LG AW L  +  P E++D
Sbjct: 730  LGWAWCLHENKQPLEILD 747



 Score = 30.8 bits (68), Expect(2) = 1e-34
 Identities = 14/31 (45%), Positives = 19/31 (61%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENE 218
           +R I+V LLC   LP  RP M+ VV +L  +
Sbjct: 759 MRVINVILLCTMGLPHQRPPMSKVVSILTED 789



>pir|A86211|A86211 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889771 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F24B9_1677985 Arabidopsis thaliana
           chromosome 1 BAC F24B9 sequence, complete sequence.
          Length = 554

 Score =  137 bits (346), Expect(2) = 1e-34
 Identities = 70/160 (43%), Positives = 102/160 (63%)
 Frame = -3

Query: 782 DESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGL 603
           DES      W TR  I  GI++GL +LH++SR+KI+HRD+K SN+LLD +LN KISDFGL
Sbjct: 307 DESSRLKLDWSTRKKIFLGIAKGLTFLHEESRIKIVHRDIKASNVLLDKDLNAKISDFGL 366

Query: 602 ARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHD 423
           A++  +D     + R+ GT GYM+PEY + G  + K+DV+S GV+ LE++SG+ N  F  
Sbjct: 367 AKL-NDDGNTHISTRIAGTIGYMAPEYAMRGYLTEKADVYSFGVVALEIVSGKSNTNFRP 425

Query: 422 SDHHHNLLGHAWLLWNDGNPFELMDNCVRDSYVESQVATM 303
           ++    LL  A++L   G+  EL+D  +   Y E +   M
Sbjct: 426 TEDFVYLLDWAYVLQERGSLLELVDPTLASDYSEEEAMLM 465



 Score = 31.6 bits (70), Expect(2) = 1e-34
 Identities = 14/40 (35%), Positives = 23/40 (57%)
 Frame = -1

Query: 301 IHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGF 182
           ++VAL+C +  P  RPTM+ VV ++E +        +P F
Sbjct: 466 LNVALMCTNASPTLRPTMSQVVSLIEGKTAMQELLSDPSF 505



>pir|T04954|T04954 hypothetical protein F7J7.170 - Arabidopsis
           thaliana>gb:ATCHRIV54_1545961 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 54.>gb:ATF7J7_1550974
           Arabidopsis thaliana DNA chromosome 4, BAC clone F7J7
           (ESSA project).
          Length = 597

 Score =  147 bits (372), Expect = 2e-34
 Identities = 76/174 (43%), Positives = 114/174 (65%), Gaps = 1/174 (0%)
 Frame = -3

Query: 755 WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
           W+ R+ I  G+SRGLLYLH+ S   IIHRDLK+SN+LLD ++ PKISDFG+AR  + D+ 
Sbjct: 384 WEKRYNIIVGVSRGLLYLHEGSEFPIIHRDLKSSNVLLDEQMLPKISDFGMARQFDFDNT 443

Query: 575 LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
            A T+RV+GTYGYM+PEY + G FSVK+DV+S GV++LE+I+G++N          +L  
Sbjct: 444 QAVTRRVVGTYGYMAPEYAMHGRFSVKTDVYSFGVLVLEIITGKRNSGL-GLGEGTDLPT 502

Query: 395 HAWLLWNDGNPFELMDNCVRDSYVESQ-VATMHSCSSSLRFETTRR*TNNGISS 237
            AW  W +G   EL+D  +  ++ + + +  +    S ++   T+R T + + S
Sbjct: 503 FAWQNWIEGTSMELIDPVLLQTHDKKESMQCLEIALSCVQENPTKRPTMDSVVS 556



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFML--ENEEVALPKPKEPGFFVERNSTEASSTD 143
           ++C+ +AL CV + P  RPTM SVV ML  ++E   LPKP +PGFF    S   S  D
Sbjct: 531 MQCLEIALSCVQENPTKRPTMDSVVSMLSSDSESRQLPKPSQPGFFRRSASFSISLND 588



>gb:AE016959_1023140 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC051632_1540141
           Oryza sativa chromosome 10 BAC OSJNBa0012L23 genomic
           sequence, complete sequence.>gb:AE017106_1752959 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           60 of 77 of the complete sequence.
          Length = 373

 Score =  136 bits (342), Expect(2) = 2e-34
 Identities = 75/151 (49%), Positives = 99/151 (65%), Gaps = 1/151 (0%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+F + R G   W+ RF I  G++RGL YLHQ+  + IIHRD+K+SN+LLD E  PKI
Sbjct: 138 DKFLFGDKR-GTLNWKQRFNIIVGMARGLGYLHQEFHVCIIHRDIKSSNVLLDDEFQPKI 196

Query: 617 SDFGLARIVEEDDGLAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRK- 441
           +DFGLAR++ +D     TK   GT GY +PEY + G  S K D +S GV++LE+ISGRK 
Sbjct: 197 ADFGLARLLPDDHSHLSTK-FAGTLGYTAPEYAIHGQLSEKVDTYSFGVVVLEIISGRKL 255

Query: 440 NRAFHDSDHHHNLLGHAWLLWNDGNPFELMD 348
           N A  D D  + LL  AW L+ + N  EL+D
Sbjct: 256 NDARLDPDSQY-LLEWAWKLYENNNLIELVD 285



 Score = 32.7 bits (73), Expect(2) = 2e-34
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 2/69 (2%)
 Frame = -1

Query: 307 RCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFF--VERNSTEASSTDKER 134
           + I +ALLC       RPTM+ VV +L  +  +  +P  P F   + R   E SS+    
Sbjct: 300 KIIQIALLCTQSAVASRPTMSEVVVLLLTKNSSEFQPTRPTFIDAISRVRGETSSSSSSS 359

Query: 133 CCYEIAMIT 107
                  IT
Sbjct: 360 ASKATISIT 368



>pir|T05149|T05149 protein kinase homolog F18E5.30 - Arabidopsis
           thaliana>gb:ATCHRIV55_1545978 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 55.>gb:ATF18E5_1549113
           Arabidopsis thaliana DNA chromosome 4, BAC clone F18E5
           (ESSAII project).>gb:ATT6K22_1556406 Arabidopsis
           thaliana DNA chromosome 4, BAC clone T6K22 (ESSAII
           project).
          Length = 683

 Score =  147 bits (371), Expect = 2e-34
 Identities = 67/122 (54%), Positives = 92/122 (75%), Gaps = 2/122 (1%)
 Frame = -3

Query: 797 DYFVFDESRXGIXTWQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKI 618
           D F+FD  +  +  W  R+ +  GI+RGLLYLH+DSR +IIHRDLK SNILLD E+NPKI
Sbjct: 431 DQFIFDTEKRQLLDWVVRYKMIGGIARGLLYLHEDSRFRIIHRDLKASNILLDQEMNPKI 490

Query: 617 SDFGLARIVEEDDGLAK--TKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGR 444
           +DFGLA++ +    +    T R+ GTYGYM+PEY + G FSVK+DVFS GV+++E+I+G+
Sbjct: 491 ADFGLAKLFDSGQTMTHRFTSRIAGTYGYMAPEYAMHGQFSVKTDVFSFGVLVIEIITGK 550

Query: 443 KN 438
           +N
Sbjct: 551 RN 552



 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 27/59 (45%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENEEVALPKPKEPGFFVER---NSTEASSTD 143
           LRCIH+ LLCV +    RPTMA+V  ML +    LP P  P F +E     S  +SST+
Sbjct: 608 LRCIHIGLLCVQESAATRPTMATVSLMLNSYSFTLPTPLRPAFVLESVVIPSNVSSSTE 666



>pir|D96574|D96574 hypothetical protein T3F20.24 [imported] -
            Arabidopsis thaliana>gb:AE005173_893246 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:T3F20_1724050 Sequence of BAC T3F20 from
            Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 979

 Score =  136 bits (342), Expect(2) = 2e-34
 Identities = 67/151 (44%), Positives = 100/151 (66%)
 Frame = -3

Query: 755  WQTRFVIATGISRGLLYLHQDSRLKIIHRDLKTSNILLDAELNPKISDFGLARIVEEDDG 576
            W TR  +  GI++GL YLH++SRLKI+HRD+K +N+LLD  LN KISDFGLA++ EE++ 
Sbjct: 708  WSTRNKVCIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLDEEENT 767

Query: 575  LAKTKRVIGTYGYMSPEYVVDGNFSVKSDVFSLGVILLELISGRKNRAFHDSDHHHNLLG 396
               T R+ GT GYM+PEY + G  + K+DV+S GV+ LE++SG+ N  +   +    LL 
Sbjct: 768  HIST-RIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFIYLLD 826

Query: 395  HAWLLWNDGNPFELMDNCVRDSYVESQVATM 303
             A++L   G+  EL+D  +  S+ + +   M
Sbjct: 827  WAYVLQEQGSLLELVDPDLGTSFSKKEAMRM 857



 Score = 32.3 bits (72), Expect(2) = 2e-34
 Identities = 14/31 (45%), Positives = 22/31 (70%)
 Frame = -1

Query: 310 LRCIHVALLCVSKLPEDRPTMASVVFMLENE 218
           +R +++ALLC +  P  RP M+SVV ML+ +
Sbjct: 855 MRMLNIALLCTNPSPTLRPPMSSVVSMLQGK 885


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 797,365,467
Number of Sequences: 1806583
Number of extensions: 16295751
Number of successful extensions: 61237
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 49967
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53468
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51696623407
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)