BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11787
         (804 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT003692_1636891 Arabidopsis thaliana At1g61220 mRNA, complet...   149   8e-35   
gb:OSJN00083_1694591 Oryza sativa genomic DNA, chromosome 4, BAC...   116   6e-25   
gb:BT002053_1635656 Arabidopsis thaliana putative protein (At5g2...   115   7e-25   
gb:AP003224_1825590 Oryza sativa (japonica cultivar-group) genom...   115   1e-24   
gb:AB018110_1513757 Arabidopsis thaliana genomic DNA, chromosome...   102   1e-20   
gb:ATF8L15_1551226 Arabidopsis thaliana DNA chromosome 5, BAC cl...    93   5e-18   
pir|E86245|E86245 hypothetical protein [imported] - Arabidopsis ...    74   4e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023236 Oryza sativa (japonica cultivar-group) chrom...    71   2e-11   
gb:BC024500_2094553 Mus musculus katanin p80 (WD40-containing) s...    50   5e-05   
gb:AK034103_1163633 Mus musculus adult male diencephalon cDNA, R...    50   5e-05   
gb:AK031630_1162530 Mus musculus 13 days embryo male testis cDNA...    50   5e-05   
gb:BT007777_2150709 Synthetic construct Homo sapiens katanin p80...    50   6e-05   
gb:BC001353_1967515 Homo sapiens katanin p80 (WD repeat containi...    50   6e-05   
gb:AF052432_1879229 Homo sapiens katanin p80 subunit mRNA, compl...    50   6e-05   
gb:BC043772_2548233 Xenopus laevis katanin p80 (WD40-containing)...    49   8e-05   
gb:BC067983_2554967 Xenopus tropicalis hypothetical protein MGC6...    49   1e-04   
gb:AF056021_2471080 Xenopus laevis p80 katanin mRNA, partial cds.      49   1e-04   
gb:AJ720686_2502873 Gallus gallus mRNA for hypothetical protein,...    48   2e-04   
gb:AY597210_1617101 Chlamydomonas reinhardtii katanin p80 subuni...    48   2e-04   
gb:BC047819_2549905 Danio rerio zgc:56071, mRNA (cDNA clone MGC:...    46   0.001   
gb:AK010364_1155709 Mus musculus ES cells cDNA, RIKEN full-lengt...    45   0.002   
pir|A96638|A96638 hypothetical protein F11P17.7 [imported] - Ara...    43   0.006   Arabidopsis thaliana [mouse-ear cress]
gb:AF052433_1236753 Strongylocentrotus purpuratus katanin p80 su...    40   0.039   
gb:AP004877_1846437 Oryza sativa (japonica cultivar-group) genom...    33   6.3     


>gb:BT003692_1636891 Arabidopsis thaliana At1g61220 mRNA, complete
           cds.>gb:AK118677_1816641 Arabidopsis thaliana At1g61220
           mRNA for unknown protein, complete cds, clone:
           RAFL19-94-P08.
          Length = 163

 Score =  149 bits (375), Expect = 8e-35
 Identities = 75/138 (54%), Positives = 96/138 (69%)
 Frame = -1

Query: 804 TKXQVVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXX 625
           TK Q+VRHFWER+DIKGAI AL+KL DHSVQADV+++L ++ E++T              
Sbjct: 16  TKLQIVRHFWERSDIKGAIAALRKLSDHSVQADVINILTDKTEILTLDLFSQLAPVLTGL 75

Query: 624 XXSKIERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLXXX 445
             SK ER  NVSLEMLLKLVA+FG V++S  SAR  VGVDLHAE+R++ C+ C A L   
Sbjct: 76  LGSKTERPVNVSLEMLLKLVAVFGTVIQSTVSARRVVGVDLHAEERLQICQSCSAELQKV 135

Query: 444 XXXIPTLIQRGGLVAKSA 391
              +P L +RGGL+A+ A
Sbjct: 136 QKILPLLTRRGGLIARKA 153



>gb:OSJN00083_1694591 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0064G10, complete sequence.
          Length = 935

 Score =  116 bits (290), Expect = 6e-25
 Identities = 66/139 (47%), Positives = 82/139 (58%), Gaps = 1/139 (0%)
 Frame = -1

Query: 804  TKXQVVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXX 625
            TK Q+V   W+RNDI+G I A++K+ DH+V ADV SVL+E+ E IT              
Sbjct: 786  TKLQIVHQMWQRNDIRGIIAAMEKMSDHAVSADVASVLMEKSETITLDLCTVILPVLTDL 845

Query: 624  XXSKIERHANVSLEMLLKLVAIFGPVVRSAASARP-SVGVDLHAEQRIECCRQCLAHLXX 448
              SK +RH  VSLE+L+KLV  FG V+ S  SA P SVGVDL AEQR E C  C   L  
Sbjct: 846  LESKTDRHLGVSLELLVKLVRTFGSVIHSTVSAGPSSVGVDLQAEQRRERCNLCFIELEK 905

Query: 447  XXXXIPTLIQRGGLVAKSA 391
                +P L +R G VA +A
Sbjct: 906  VKNKLPFLSRRKGAVANTA 924



>gb:BT002053_1635656 Arabidopsis thaliana putative protein (At5g23430)
            mRNA, complete cds.
          Length = 837

 Score =  115 bits (289), Expect = 7e-25
 Identities = 59/136 (43%), Positives = 88/136 (64%)
 Frame = -1

Query: 801  KXQVVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXX 622
            K QVVR +WERND+K +I +++K+ D++V ADV+ ++ ER E++T               
Sbjct: 689  KLQVVRRYWERNDVKNSIGSIEKMADNAVTADVLGIITERNEILTLDNCTSLLPLLTALL 748

Query: 621  XSKIERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLXXXX 442
             S +++H +VSL++LLKLV ++G  + S+ SA  SVGVD+ AEQRIE   +C   L    
Sbjct: 749  GSGMDQHLSVSLDLLLKLVRLYGSPIYSSLSAPASVGVDIEAEQRIERYSRCFVELEKVK 808

Query: 441  XXIPTLIQRGGLVAKS 394
              +P+L +RGGLVAKS
Sbjct: 809  ACLPSLARRGGLVAKS 824



>gb:AP003224_1825590 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0010B10.
          Length = 838

 Score =  115 bits (288), Expect = 1e-24
 Identities = 63/138 (45%), Positives = 86/138 (62%)
 Frame = -1

Query: 804  TKXQVVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXX 625
            TK +++RH +++N IKGAI A+ KLPD++V ADVVS L  ++++                
Sbjct: 688  TKLEMMRHVFDQNGIKGAIAAVAKLPDNAVLADVVSTLKGKLDLFNLDIFLSFLPVLAGL 747

Query: 624  XXSKIERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLXXX 445
              SK ERHA VSLE+LL L+ IFGPV+RS  SA  +VGVD+ AEQR++ C +C  HL   
Sbjct: 748  LTSKAERHAIVSLELLLDLIKIFGPVIRSTLSAHSAVGVDIQAEQRLQRCSRCFNHLQKI 807

Query: 444  XXXIPTLIQRGGLVAKSA 391
               +  LI RGG  A+ A
Sbjct: 808  QQVLHPLIMRGGQSAQLA 825



>gb:AB018110_1513757 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K19M13.
          Length = 932

 Score =  102 bits (253), Expect = 1e-20
 Identities = 52/131 (39%), Positives = 80/131 (61%)
 Frame = -1

Query: 801  KXQVVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXX 622
            K QVVR +WERND+K +I +++K+ D++V ADV+ ++ ER E++T               
Sbjct: 755  KLQVVRRYWERNDVKNSIGSIEKMADNAVTADVLGIITERNEILTLDNCTSLLPLLTALL 814

Query: 621  XSKIERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLXXXX 442
             S +++H +VSL++LLKLV ++G  + S+ SA  SVGVD+ AEQRIE   +C   L    
Sbjct: 815  GSGMDQHLSVSLDLLLKLVRLYGSPIYSSLSAPASVGVDIEAEQRIERYSRCFVELEKVK 874

Query: 441  XXIPTLIQRGG 409
              +P+L    G
Sbjct: 875  ACLPSLASISG 885



>gb:ATF8L15_1551226 Arabidopsis thaliana DNA chromosome 5, BAC clone
            F8L15 (ESSA project).
          Length = 823

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 49/126 (38%), Positives = 76/126 (60%)
 Frame = -1

Query: 801  KXQVVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXX 622
            K QVVR +WERNDIK +I++++K+ D++V ADV+ ++ ER E++T               
Sbjct: 685  KLQVVRRYWERNDIKNSISSIEKMADNAVIADVLLIVNERPEILTLDTCTSLLPLLTALL 744

Query: 621  XSKIERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLXXXX 442
             S ++ H +V L++LLKLV ++G  + S+ SA  SVGVD+ AEQR+E    C        
Sbjct: 745  GSNMDSHLSVCLDLLLKLVRMYGSQIYSSLSAPSSVGVDIEAEQRMERYSCCFVEFEKIK 804

Query: 441  XXIPTL 424
              +P+L
Sbjct: 805  ACLPSL 810



>pir|E86245|E86245 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890124 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007259_1535696 Arabidopsis thaliana
            chromosome I BAC T28P6 genomic sequence, complete
            sequence.
          Length = 961

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 39/77 (50%), Positives = 50/77 (64%)
 Frame = -1

Query: 717  VQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKIERHANVSLEMLLKLVAIFGPVVRS 538
            VQADV+S+L E++E++T                S+ ER  NVSL+MLLKLVA+FG V+RS
Sbjct: 882  VQADVISILTEKIEILTLDMFSQLVPVLTSLLGSRTERPVNVSLDMLLKLVAVFGTVIRS 941

Query: 537  AASARPSVGVDLHAEQR 487
              SA   VGVDLHA +R
Sbjct: 942  TVSAPRIVGVDLHANER 958



>gb:AE016959_1023236 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC068950_1540556 Oryza sativa
            chromosome 10 BAC OSJNBa0041P03 genomic sequence,
            complete sequence.>gb:AE017108_1753055 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 62 of 77
            of the complete sequence.
          Length = 866

 Score = 71.2 bits (173), Expect = 2e-11
 Identities = 44/116 (37%), Positives = 60/116 (51%), Gaps = 1/116 (0%)
 Frame = -1

Query: 735  KLPDHSVQADVVSVLIERMEVITXXXXXXXX-XXXXXXXXSKIERHANVSLEMLLKLVAI 559
            ++P  +V AD++SVL+E    IT                 S  +RH  V+LEM+LKLV  
Sbjct: 735  EIPRVTVTADIISVLMENDNSITLDICTCVLPLASSVLEKSSYDRHLKVALEMILKLVKS 794

Query: 558  FGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHLXXXXXXIPTLIQRGGLVAKSA 391
            FG  + SA S+ P VGVD+ AEQR+  C  C   L      +  L +R G V +SA
Sbjct: 795  FGSTISSAVSSTPPVGVDIEAEQRLNRCNLCFLELIKVHSVLFALTRRQGEVGRSA 850



>gb:BC024500_2094553 Mus musculus katanin p80 (WD40-containing)
           subunit B 1, mRNA (cDNA clone IMAGE:4982787), partial
           cds.
          Length = 380

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK ++++   + D SV  D+++++ ++  +                  SK 
Sbjct: 237 VRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKY 296

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  CR C   L
Sbjct: 297 ESYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDISREERLHKCRLCFKQL 348



>gb:AK034103_1163633 Mus musculus adult male diencephalon cDNA,
           RIKEN full-length enriched library, clone:9330156L08
           product:katanin p80 (WD40-containing) subunit B 1, full
           insert sequence.>gb:AK049345_1168745 Mus musculus ES
           cells cDNA, RIKEN full-length enriched library,
           clone:C330026F14 product:katanin p80 (WD40-containing)
           subunit B 1, full insert sequence.>gb:AK087973_1175118
           Mus musculus 2 days neonate thymus thymic cells cDNA,
           RIKEN full-length enriched library, clone:E430001K24
           product:katanin p80 (WD40-containing) subunit B 1, full
           insert sequence.>gb:BC045200_2099098 Mus musculus
           katanin p80 (WD40-containing) subunit B 1, mRNA (cDNA
           clone MGC:49345 IMAGE:5322489), complete
           cds.>gb:BC087177_2565034 Xenopus laevis hypothetical
           LOC495853, mRNA (cDNA clone MGC:97963 IMAGE:7197896),
           complete cds.
          Length = 658

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK ++++   + D SV  D+++++ ++  +                  SK 
Sbjct: 515 VRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKY 574

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  CR C   L
Sbjct: 575 ESYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDISREERLHKCRLCFKQL 626



>gb:AK031630_1162530 Mus musculus 13 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:6030463O17
           product:katanin p80 (WD40-containing) subunit B 1, full
           insert sequence.
          Length = 658

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK ++++   + D SV  D+++++ ++  +                  SK 
Sbjct: 515 VRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKY 574

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  CR C   L
Sbjct: 575 ESYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDISREERLHKCRLCFKQL 626



>gb:BT007777_2150709 Synthetic construct Homo sapiens katanin p80
           (WD40-containing) subunit B 1 mRNA, partial cds.
          Length = 656

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK ++++   + D SV  D+++++ ++  +                  SK 
Sbjct: 512 VRAVWTMGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKY 571

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  CR C   L
Sbjct: 572 ESYVQTGCTSLKLILQRFLPLITDMLAAPPSVGVDISREERLHKCRLCYKQL 623



>gb:BC001353_1967515 Homo sapiens katanin p80 (WD repeat containing)
           subunit B 1, mRNA (cDNA clone MGC:8689 IMAGE:2964632),
           complete cds.>gb:BT007022_1990460 Homo sapiens katanin
           p80 (WD40-containing) subunit B 1 mRNA, complete
           cds.>gb:CR456762_1992969 Homo sapiens full open reading
           frame cDNA clone RZPDo834D024D for gene KATNB1, katanin
           p80 (WD repeat containing) subunit B 1; complete cds,
           incl. stopcodon.
          Length = 655

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK ++++   + D SV  D+++++ ++  +                  SK 
Sbjct: 512 VRAVWTMGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKY 571

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  CR C   L
Sbjct: 572 ESYVQTGCTSLKLILQRFLPLITDMLAAPPSVGVDISREERLHKCRLCYKQL 623



>gb:AF052432_1879229 Homo sapiens katanin p80 subunit mRNA, complete
           cds.
          Length = 655

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK ++++   + D SV  D+++++ ++  +                  SK 
Sbjct: 512 VRAVWTMGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKY 571

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  CR C   L
Sbjct: 572 ESYVQTGCTSLKLILQRFLPLITDMLAAPPSVGVDISREERLHKCRLCYKQL 623



>gb:BC043772_2548233 Xenopus laevis katanin p80 (WD40-containing)
           subunit B 1, mRNA (cDNA clone MGC:52971 IMAGE:4930613),
           complete cds.
          Length = 655

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 32/115 (27%), Positives = 56/115 (48%), Gaps = 3/115 (2%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK +I++   + D SV  D+++++ ++  +                  SK 
Sbjct: 512 VRAVWSSGDIKTSIDSAVAINDLSVVVDLLNIVNQKASLWKLDLCLTVLPQIEKMLQSKY 571

Query: 609 ERHAN---VSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +     +SL+++LK    F P++    +A PSVGVD+  E+R+  C+ C   L
Sbjct: 572 ESYVQTGCISLKLILKR---FLPIITDILAAPPSVGVDISREERLSKCKLCYKQL 623



>gb:BC067983_2554967 Xenopus tropicalis hypothetical protein
           MGC69344, mRNA (cDNA clone MGC:69344 IMAGE:5309113),
           complete cds.
          Length = 655

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK +I++   + D SV  D+++++ ++  +                  SK 
Sbjct: 512 VRAVWSSGDIKTSIDSAVAINDLSVVVDLLNIINQKASLWKLDLCLTVLPQIEKMLQSKY 571

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  C+ C   L
Sbjct: 572 ESYVQTGCISLKLILQRFLPLITDILAAPPSVGVDISREERLSKCKLCYKQL 623



>gb:AF056021_2471080 Xenopus laevis p80 katanin mRNA, partial cds.
          Length = 351

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 29/112 (25%), Positives = 51/112 (45%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK +I++   + D SV  D+++++ ++  +                  SK 
Sbjct: 208 VRAVWSSGDIKTSIDSAVAINDLSVVVDLLNIINQKASLWKLDLCMTVLPQIEKMLQSKY 267

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  C+ C   L
Sbjct: 268 ESYVQTGCISLKLILQRFLPLITDILAAPPSVGVDISREERLSKCKLCYKQL 319



>gb:AJ720686_2502873 Gallus gallus mRNA for hypothetical protein,
           clone 23h13.
          Length = 657

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 29/112 (25%), Positives = 50/112 (44%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W  +D+K +++A     D SV  D+++++ +   +                  SK 
Sbjct: 514 VRAVWSTSDMKNSVDAAVATNDLSVVVDLLNIVNQTASLWKLDLCTVVLPQIEKLLQSKY 573

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R+  CR C   L
Sbjct: 574 ESYVQTGCTSLKLILQRFLPLITDILAAPPSVGVDITREERLHKCRLCYKQL 625



>gb:AY597210_1617101 Chlamydomonas reinhardtii katanin p80 subunit
           PF15p mRNA, complete cds.
          Length = 798

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 1/105 (0%)
 Frame = -1

Query: 792 VVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSK 613
           ++R+F ++ D + AI A ++  D +  AD++S + +R +V T                  
Sbjct: 654 IMRNFVQKGDWRNAIAAARRGDDTAALADLLSAMHDRRDVFTLDLVGEVMTVVETVLSLP 713

Query: 612 IERHANVSLEMLLKLVAIFGPVVRS-AASARPSVGVDLHAEQRIE 481
            +R     LE+L   +  FGPV+R         VG+DL  E+R E
Sbjct: 714 SDRQQQTGLEVLALHIRAFGPVIRDLCGPGARGVGIDLSFEERRE 758



>gb:BC047819_2549905 Danio rerio zgc:56071, mRNA (cDNA clone
           MGC:56071 IMAGE:5409848), complete cds.
          Length = 694

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 26/112 (23%), Positives = 50/112 (44%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   D+K ++++   + D S+  DV++++  +  +                  S+ 
Sbjct: 550 VRSVWASGDVKTSLDSAVSMNDLSIVVDVLNIINLKPSLWKLDLCTSILPQIEELLQSRY 609

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P++    +A PSVGVD+  E+R + C+ C   L
Sbjct: 610 ESYVQTGCMSLKLILKRFWPLISDTLNAPPSVGVDITREERHQKCKACYKQL 661



>gb:AK010364_1155709 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2410003J24 product:katanin p80
           (WD40-containing) subunit B 1, full insert sequence.
          Length = 657

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/112 (26%), Positives = 50/112 (44%)
 Frame = -1

Query: 789 VRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSKI 610
           VR  W   DIK ++++   + D SV  D+++++ ++  +                  SK 
Sbjct: 515 VRAVWTTGDIKTSVDSAVAINDLSVVVDLLNIVNQKASLWKLDLCTTVLPQIEKLLQSKY 574

Query: 609 ERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
           E +       L  ++  F P+    A A PSVGVD+  E+R+  CR C   L
Sbjct: 575 ESYVQTGCTSLKLILQRFLPLTDILA-APPSVGVDISREERLHKCRLCFKQL 625



>pir|A96638|A96638 hypothetical protein F11P17.7 [imported] -
            Arabidopsis thaliana>gb:AE005173_893791 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC002294_1530167 Arabidopsis thaliana
            chromosome I BAC F11P17 genomic sequence, complete
            sequence.
          Length = 1184

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 20/30 (66%), Positives = 25/30 (83%)
 Frame = -1

Query: 576  LKLVAIFGPVVRSAASARPSVGVDLHAEQR 487
            L+LVA+FG V++S  SAR  VGVDLHAE+R
Sbjct: 1069 LQLVAVFGTVIQSTVSARRVVGVDLHAEER 1098



>gb:AF052433_1236753 Strongylocentrotus purpuratus katanin p80
           subunit mRNA, complete cds.
          Length = 690

 Score = 40.4 bits (93), Expect = 0.039
 Identities = 23/113 (20%), Positives = 49/113 (43%)
 Frame = -1

Query: 792 VVRHFWERNDIKGAINALKKLPDHSVQADVVSVLIERMEVITXXXXXXXXXXXXXXXXSK 613
           VVR  W   D K ++ ++  + D ++  D++++++ +  +                  SK
Sbjct: 547 VVRAIWTAGDAKTSVESVVNMKDQAILVDILNIMLLKKSLWNLDMCVVVLPRLKELLSSK 606

Query: 612 IERHANVSLEMLLKLVAIFGPVVRSAASARPSVGVDLHAEQRIECCRQCLAHL 454
            E + + S   L  ++  F  +        PS G+D+  E+R   C +C ++L
Sbjct: 607 YENYVHTSCACLKLILKNFTSLFNQNIKCPPS-GIDITREERYNKCSKCYSYL 658



>gb:AP004877_1846437 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0472F10.
          Length = 213

 Score = 33.1 bits (74), Expect = 6.3
 Identities = 12/23 (52%), Positives = 16/23 (69%)
 Frame = +1

Query: 181 YGYGHAHACSPRASA*WLPERRP 249
           +G+GHAHA +P  S+ W P R P
Sbjct: 108 HGHGHAHAAAPSPSSSWAPARAP 130


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 857,065,394
Number of Sequences: 1806583
Number of extensions: 17890446
Number of successful extensions: 41974
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 40347
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41963
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 52419653105
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)