BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11718
         (930 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

sp|P11043|AROA_PETHY|AROA_PETHY 3-phosphoshikimate 1-carboxyvinyltransferas...   414   e-114   Petunia x hybrida [garden petunia]
gb:AY545666_1612944 Conyza canadensis 5-enol-pyruvylshikimate-ph...   414   e-114   
pir|B28198|XUTOVS 3-phosphoshikimate 1-carboxyvinyltransferase (...   411   e-113   
sp|P23281|ARO2_TOBAC|ARO2_TOBAC 3-phosphoshikimate 1-carboxyvinyltransferas...   410   e-113   Nicotiana tabacum [American tobacco]
gb:AY545667_1612945 Conyza canadensis 5-enol-pyruvylshikimate-ph...   409   e-113   
sp|P10748|AROA_LYCES|AROA_LYCES 3-phosphoshikimate 1-carboxyvinyltransferas...   409   e-113   Solanum lycopersicum
sp|P23981|ARO1_TOBAC|ARO1_TOBAC 3-phosphoshikimate 1-carboxyvinyltransferas...   409   e-113   Nicotiana tabacum [American tobacco]
gb:AF371966_1792436 Dicliptera chinensis 5-enolpyruvylshikimate-...   408   e-113   
gb:AF371965_1792435 Dicliptera chinensis 5-enolpyruvylshikimate-...   408   e-113   
gb:AY150520_1585085 Vitis vinifera 5-enolpyruvylshikimate-3-phos...   399   e-110   
gb:AY545668_1612946 Conyza canadensis 5-enol-pyruvylshikimate-ph...   395   e-109   
pir|H84888|H84888 hypothetical protein At2g45300 [imported] - Ar...   393   e-108   Arabidopsis thaliana [mouse-ear cress]
pir|S01061|XUMUVS 3-phosphoshikimate 1-carboxyvinyltransferase (...   390   e-107   
gb:A69537_1450450 Sequence 5 from Patent WO9802562.                   389   e-107   
gb:A69535_1450449 Sequence 3 from Patent WO9802562.                   389   e-107   
gb:A59347_1449890 Sequence 4 from Patent WO9704114.>gb:A59406_14...   389   e-107   
gb:A59345_1449889 Sequence 2 from Patent WO9704114.>gb:A59404_14...   389   e-107   
gb:AY512663_1610475 Brassica rapa 5-enolpyruvylshikimate-3-phosp...   388   e-107   
sp|P17688|AROA_BRANA|AROA_BRANA 3-phosphoshikimate 1-carboxyvinyltransferas...   388   e-107   Brassica napus [oilseed rape]
sp|P05466|AROA_ARATH|AROA_ARATH 3-phosphoshikimate 1-carboxyvinyltransferas...   388   e-107   Arabidopsis thaliana [mouse-ear cress]
gb:AF440389_1800061 Orychophragmus violaceus 5-enolpyruvylshikim...   387   e-106   
gb:AY086717_1571761 Arabidopsis thaliana clone 270032 mRNA, comp...   386   e-106   
pir|D96526|D96526 hypothetical protein F27K7.11 [imported] - Ara...   386   e-106   Arabidopsis thaliana [mouse-ear cress]
gb:AY157642_1585428 Eleusine indica 5-enolpyruvylshikimate-3-pho...   384   e-105   
gb:AP002542_1822638 Oryza sativa (japonica cultivar-group) genom...   383   e-105   
gb:AB052962_1521265 Oryza sativa EPSPs, rps20 genes for 3-phosph...   383   e-105   
gb:AB016765_1512854 Oryza sativa (japonica cultivar-group) mRNA ...   383   e-105   
gb:AY157643_1585429 Eleusine indica 5-enolpyruvylshikimate-3-pho...   380   e-104   
gb:AY545659_1612937 Erigeron annuus 5-enol-pyruvylshikimate-phos...   334   1e-90   
gb:AF349754_1790244 Lolium rigidum 5-enolpyruvylshikimate 3-phos...   329   5e-89   
gb:AY545660_1612938 Erigeron annuus 5-enol-pyruvylshikimate-phos...   322   7e-87   
gb:AY545657_1612935 Amaranthus rudis 5-enol-pyruvylshikimate-pho...   318   1e-85   
gb:AE005674_70485 Shigella flexneri 2a str. 301, complete genome...   244   1e-63   
sp|Q9ZFF7|AROA_SHISO|AROA_SHISO 3-phosphoshikimate 1-carboxyvinyltransferas...   244   1e-63   Shigella sonnei
sp|O87006|AROA_SHIDY|AROA_SHIDY 3-phosphoshikimate 1-carboxyvinyltransferas...   244   1e-63   Shigella dysenteriae
sp|P07638|AROA_ECOLI|AROA_ECOLI 3-phosphoshikimate 1-carboxyvinyltransferas...   244   1e-63   Escherichia coli [E. coli]
gb:ECAROA_125066 E.coli gene aroA for 5-enolpyruvylshikimate 3-p...   244   2e-63   
gb:AE016920_358009 Chromobacterium violaceum ATCC 12472 section ...   243   5e-63   
gb:AY334546_610719 Escherichia coli 3-phosphoshikimate 1-carboxy...   241   1e-62   
sp|P19688|AROA_YEREN|AROA_YEREN 3-phosphoshikimate 1-carboxyvinyltransferas...   241   1e-62   Yersinia enterocolitica
sp|Q8FJB6|AROA_ECOL6|AROA_ECOL6 3-phosphoshikimate 1-carboxyvinyltransferas...   239   6e-62   
gb:BX936398_836060 Yersinia pseudotuberculosis IP32953 genome, c...   239   7e-62   
sp|P24497|AROA_KLEPN|AROA_KLEPN 3-phosphoshikimate 1-carboxyvinyltransferas...   239   7e-62   Klebsiella pneumoniae
gb:AE013881_301077 Yersinia pestis KIM section 281 of 415 of the...   238   1e-61   
sp|Q60112|AROA_YERPE|AROA_YERPE 3-phosphoshikimate 1-carboxyvinyltransferas...   238   1e-61   Yersinia pestis
sp|Q9KRB0|AROA_VIBCH|AROA_VIBCH 3-phosphoshikimate 1-carboxyvinyltransferas...   238   1e-61   
gb:BX571864_786477 Photorhabdus luminescens subsp. laumondii TTO...   238   2e-61   
gb:YEPAROA_211196 Yersinia pestis 5-enolpyruvylshikimate-3-phosp...   237   3e-61   
gb:CR378671_95812 Photobacterium profundum SS9; segment 9/12.         235   8e-61   
gb:CP000026_76619 Salmonella enterica subsp. enterica serovar Pa...   235   1e-60   
pir|A22566|XUEBVS 3-phosphoshikimate 1-carboxyvinyltransferase (...   234   1e-60   
sp|P07637|AROA_SALTY|AROA_SALTY 3-phosphoshikimate 1-carboxyvinyltransferas...   234   1e-60   Salmonella enterica subsp. enterica serovar Typhimurium
sp|P19786|AROA_SALTI|AROA_SALTI 3-phosphoshikimate 1-carboxyvinyltransferas...   234   1e-60   Salmonella enterica subsp. enterica serovar Typhi
sp|P22299|AROA_SALGL|AROA_SALGL 3-phosphoshikimate 1-carboxyvinyltransferas...   234   1e-60   Salmonella enterica subsp. enterica serovar Gallinarum
gb:CP000010_864857 Burkholderia mallei ATCC 23344 chromosome 1, ...   234   2e-60   
gb:BX571965_792312 Burkholderia pseudomallei strain K96243, chro...   234   2e-60   
sp|Q93ED4|AROA_YERRU|AROA_YERRU 3-phosphoshikimate 1-carboxyvinyltransferas...   233   3e-60   Yersinia ruckeri
gb:BX950851_841329 Erwinia carotovora subsp. atroseptica SCRI104...   233   4e-60   
gb:BA000037_723144 Vibrio vulnificus YJ016 DNA, chromosome I, co...   233   4e-60   
gb:AE016804_336767 Vibrio vulnificus CMCP6 chromosome I section ...   233   4e-60   
sp|Q8RLV9|AROA_XENNE|AROA_XENNE 3-phosphoshikimate 1-carboxyvinyltransferas...   232   7e-60   Xenorhabdus nematophila
pir|S12096|S12096 3-phosphoshikimate 1-carboxyvinyltransferase (...   232   9e-60   Salmonella enterica subsp. enterica serovar Typhi
gb:CR555306_105895 Azoarcus sp. EbN1 complete genome.                 231   1e-59   
sp|Q8VP65|AROA_PASPI|AROA_PASPI 3-phosphoshikimate 1-carboxyvinyltransferas...   231   1e-59   
sp|Q8EEH8|AROA_SHEON|AROA_SHEON 3-phosphoshikimate 1-carboxyvinyltransferas...   230   3e-59   Shewanella oneidensis
gb:CP000020_871937 Vibrio fischeri ES114 chromosome I, complete ...   228   1e-58   
sp|Q87QX9|AROA_VIBPA|AROA_VIBPA 3-phosphoshikimate 1-carboxyvinyltransferas...   228   1e-58   
sp|Q8Y0Y6|AROA_RALSO|AROA_RALSO 3-phosphoshikimate 1-carboxyvinyltransferas...   226   4e-58   Ralstonia solanacearum
sp|Q9X4H2|AROA_EDWIC|AROA_EDWIC 3-phosphoshikimate 1-carboxyvinyltransferas...   226   6e-58   Edwardsiella ictaluri
gb:AY324880_1599514 Oryza sativa (japonica cultivar-group) putat...   221   2e-56   
sp|P57396|AROA_BUCAI|AROA_BUCAI 3-phosphoshikimate 1-carboxyvinyltransferas...   216   7e-55   
gb:BX321862_774292 Nitrosomonas europaea ATCC 19718, complete ge...   215   9e-55   
gb:AE017340_457119 Idiomarina loihiensis L2TR, complete genome.       214   3e-54   
sp|Q59178|AROA_BUCAP|AROA_BUCAP 3-phosphoshikimate 1-carboxyvinyltransferas...   214   3e-54   
sp|P54220|AROA_PASHA|AROA_PASHA 3-phosphoshikimate 1-carboxyvinyltransferas...   210   4e-53   Mannheimia haemolytica
sp|Q04570|AROA_PASMU|AROA_PASMU 3-phosphoshikimate 1-carboxyvinyltransferas...   209   5e-53   Pasteurella multocida
sp|P52310|AROA_HAESO|AROA_HAESO 3-phosphoshikimate 1-carboxyvinyltransferas...   206   4e-52   Histophilus somni
gb:AE016827_343204 Mannheimia succiniciproducens MBEL55E, comple...   204   2e-51   
gb:PHU03068_158475 Pasteurella haemolytica NADC-D60 5-enolpyruvy...   204   2e-51   
gb:AE017154_392800 Haemophilus ducreyi strain 35000HP section 4 ...   201   1e-50   
sp|P59416|AROA_BUCBP|AROA_BUCBP 3-phosphoshikimate 1-carboxyvinyltransferas...   201   2e-50   
pir|JN0758|JN0758 3-phosphoshikimate 1-carboxyvinyltransferase (...   199   6e-50   Haemophilus influenzae
sp|P12421|AROA_BORPE|AROA_BORPE 3-phosphoshikimate 1-carboxyvinyltransferas...   198   1e-49   Bordetella pertussis
pir|S28063|S28063 3-phosphoshikimate 1-carboxyvinyltransferase (...   196   4e-49   Pasteurella multocida
gb:BX640432_811367 Bordetella parapertussis strain 12822, comple...   196   5e-49   
gb:AF182427_486303 Bordetella bronchiseptica prephenate dehydrat...   196   5e-49   
sp|Q9RND7|AROA_BORBR|AROA_BORBR 3-phosphoshikimate 1-carboxyvinyltransferas...   196   5e-49   Bordetella bronchiseptica
pir|A32007|XUBRVS 3-phosphoshikimate 1-carboxyvinyltransferase (...   196   7e-49   
sp|Q03421|AROA_HAEIN|AROA_HAEIN 3-phosphoshikimate 1-carboxyvinyltransferas...   195   9e-49   Haemophilus influenzae
sp|Q9JTT3|AROA_NEIMA|AROA_NEIMA 3-phosphoshikimate 1-carboxyvinyltransferas...   195   1e-48   
sp|Q9JYU1|AROA_NEIMB|AROA_NEIMB 3-phosphoshikimate 1-carboxyvinyltransferas...   194   2e-48   Neisseria meningitidis serogroup B
gb:BX248585_763992 Blochmannia floridanus complete genome; segme...   193   4e-48   
gb:AY758186_645375 Yersinia ruckeri 5-enolpyruvylshikimate-3-pho...   192   1e-47   
gb:AE004969_60627 Neisseria gonorrhoeae FA 1090, complete genome.     191   1e-47   
gb:AY545665_1612943 Plantago lanceolata 5-enol-pyruvylshikimate-...   180   4e-44   
gb:AY545663_1612941 Sarracenia purpurea 5-enol-pyruvylshikimate-...   179   9e-44   
gb:AY545661_1612939 Helianthus salicifolius 5-enol-pyruvylshikim...   175   1e-42   
gb:AY545662_1612940 Helianthus salicifolius 5-enol-pyruvylshikim...   172   8e-42   
gb:AY545658_1612936 Asimina triloba 5-enol-pyruvylshikimate-phos...   167   3e-40   
sp|Q9L213|ARA1_STRCO|ARA1_STRCO 3-phosphoshikimate 1-carboxyvinyltransferas...   161   1e-38   Streptomyces coelicolor
gb:AY496581_622020 Uncultured bacterium clone pELP182 putative 3...   154   2e-36   
sp|Q03321|AROA_AERSA|AROA_AERSA 3-phosphoshikimate 1-carboxyvinyltransferas...   154   2e-36   Aeromonas salmonicida
gb:AY775556_645908 Haemophilus parasuis AroA (aroA) gene, partia...   151   2e-35   
gb:AF440390_1800062 Orychophragmus violaceus 5-enolpyruvylshikim...   150   3e-35   
gb:AY775559_645911 Actinobacillus ureae AroA (aroA) gene, partia...   150   3e-35   
sp|Q8YMB5|AROA_ANASP|AROA_ANASP 3-phosphoshikimate 1-carboxyvinyltransferas...   150   3e-35   Anabaena sp.
gb:BX294136_766185 Pirellula sp. strain 1 complete genome; segme...   147   2e-34   
gb:AY545664_1612942 Nymphaea alba 5-enol-pyruvylshikimate-phosph...   147   4e-34   
gb:CR522870_101856 Desulfotalea psychrophila LSv54 chromosome.        145   1e-33   
gb:AP006627_563543 Bacillus clausii KSM-K16 DNA, complete genome.     132   7e-30   
pir|F64362|F64362 3-phosphoshikimate 1-carboxyvinyltransferase (...   131   2e-29   Methanocaldococcus jannaschii
sp|Q57925|AROA_METJA|AROA_METJA Probable 3-phosphoshikimate 1-carboxyvinylt...   131   2e-29   Methanocaldococcus jannaschii
gb:CR382137_1670221 Debaryomyces hansenii chromosome E of strain...   127   3e-28   
gb:AJ749949_531045 Francisella tularensis subsp. tularensis comp...   125   9e-28   
gb:AE016820_1750019 Ashbya gossypii (= Eremothecium gossypii) AT...   125   1e-27   
gb:CR380959_1654146 Candida glabrata strain CBS138 chromosome M ...   125   2e-27   
gb:NCB14H13_1689363 Neurospora crassa DNA linkage group II BAC c...   123   6e-27   
gb:BX957222_844458 Methanococcus maripaludis S2 complete genome;...   122   1e-26   
gb:AE017310_438719 Desulfovibrio vulgaris subsp. vulgaris str. H...   122   1e-26   
gb:AY775557_645909 Actinobacillus equuli AroA (aroA) gene, parti...   121   2e-26   
sp|Q9K9D5|ARA2_BACHD|ARA2_BACHD 3-phosphoshikimate 1-carboxyvinyltransferas...   119   6e-26   Bacillus halodurans
gb:CR382132_1665468 Yarrowia lipolytica chromosome F of strain C...   119   1e-25   
gb:AY746008_1626566 Sclerotinia sclerotiorum arom (arom) gene, c...   118   2e-25   
sp|P08566|ARO1_YEAST|ARO1_YEAST Pentafunctional AROM polypeptide [Includes:...   118   2e-25   Saccharomyces cerevisiae [brewer's yeast]
sp|Q12659|ARO1_PNECA|ARO1_PNECA Pentafunctional AROM polypeptide [Includes:...   117   2e-25   Pneumocystis carinii
sp|Q9HQC1|AROA_HALN1|AROA_HALN1 Probable 3-phosphoshikimate 1-carboxyvinylt...   117   4e-25   Halobacterium sp.
gb:AF496781_1805693 Zea mays cultivar DE811 3-phosphoshikimate 1...   116   5e-25   
gb:CR382126_1659229 Kluyveromyces lactis strain NRRL Y-1140 chro...   116   5e-25   
gb:A18838_1447806 aroA gene.                                          116   7e-25   
gb:AEOAROA_466713 Aeromonas salmonicida 3-phosphoshikimate-1-car...   116   7e-25   
pir|I39539|I39539 3-phosphoshikimate 1-carboxyvinyltransferase (...   116   7e-25   Aeromonas salmonicida
sp|Q97KM2|AROA_CLOAB|AROA_CLOAB 3-phosphoshikimate 1-carboxyvinyltransferas...   115   9e-25   Clostridium acetobutylicum
gb:AF496777_1805689 Zea mays cultivar CO109 3-phosphoshikimate 1...   114   2e-24   
sp|Q8XMJ2|AROA_CLOPE|AROA_CLOPE 3-phosphoshikimate 1-carboxyvinyltransferas...   114   3e-24   Clostridium perfringens
gb:AF496763_1805675 Zea mays cultivar F_6 3-phosphoshikimate 1-c...   113   6e-24   
gb:AY849805_1630796 Pichia pastoris AROM pentafunctional enzyme ...   113   6e-24   
gb:AF482690_1804023 Thanatephorus cucumeris arom polypeptide gen...   112   1e-23   
sp|Q9P7R0|ARO1_SCHPO|ARO1_SCHPO Pentafunctional AROM polypeptide [Includes:...   112   1e-23   Schizosaccharomyces pombe
gb:AF496762_1805674 Zea mays cultivar C_5 3-phosphoshikimate 1-c...   111   2e-23   
sp|Q8THH3|AROA_METAC|AROA_METAC Probable 3-phosphoshikimate 1-carboxyvinylt...   111   2e-23   Methanosarcina acetivorans
gb:AF496769_1805681 Zea mays cultivar F_3 3-phosphoshikimate 1-c...   111   2e-23   
gb:AF496776_1805688 Zea mays cultivar I_1 3-phosphoshikimate 1-c...   109   7e-23   
gb:AF170673_485249 Klebsiella pneumoniae strain TCVGH33 3-phosph...   109   9e-23   
gb:AF496790_1805702 Zea mays cultivar C_9 3-phosphoshikimate 1-c...   108   2e-22   
gb:AF496761_1805673 Zea mays cultivar H_1 3-phosphoshikimate 1-c...   108   2e-22   
gb:AF170670_485246 Klebsiella pneumoniae strain TCVGH12 3-phosph...   107   3e-22   
gb:AF170667_485243 Klebsiella pneumoniae strain TCVGH1 3-phospho...   107   3e-22   
gb:AY596297_631663 Haloarcula marismortui ATCC 43049 chromosome ...   106   6e-22   
gb:AY016733_584993 Klebsiella pneumoniae strain L51 3-phosphoshi...   106   6e-22   
gb:AF170671_485247 Klebsiella pneumoniae strain TCVGH23 3-phosph...   106   6e-22   
gb:AE017342_1754855 Cryptococcus neoformans var. neoformans JEC2...   105   1e-21   
gb:AF170674_485250 Klebsiella pneumoniae strain TCVGH35 3-phosph...   104   3e-21   
gb:AY775558_645910 Actinobacillus suis AroA (aroA) gene, partial...   103   4e-21   
gb:BX649607_1643501 Aspergillus fumigatus BAC pilot project supe...   102   1e-20   
sp|Q8TXN4|AROA_METKA|AROA_METKA Probable 3-phosphoshikimate 1-carboxyvinylt...   101   2e-20   Methanopyrus kandleri
sp|Q8PXI0|AROA_METMA|AROA_METMA Probable 3-phosphoshikimate 1-carboxyvinylt...   100   5e-20   Methanosarcina mazei
gb:BX908798_830438 Parachlamydia-related symbiont UWE25, complet...    96   1e-18   
sp|O26860|AROA_METTH|AROA_METTH Probable 3-phosphoshikimate 1-carboxyvinylt...    96   1e-18   Methanothermobacter thermautotrophicus
gb:APL012748_582273 Actinobacillus pleuropneumoniae aroA gene.         96   1e-18   
gb:AE016935_361554 Bacteroides thetaiotaomicron VPI-5482, sectio...    95   2e-18   
gb:AE017251_416728 Treponema denticola ATCC 35405, section 6 of ...    93   6e-18   
pir|A24962|BVASA1 3-dehydroquinate synthase (EC 4.2.3.4) - Emeri...    93   8e-18   
sp|P07547|ARO1_EMENI|ARO1_EMENI Pentafunctional AROM polypeptide [Includes:...    93   8e-18   
gb:AF496767_1805679 Zea mays cultivar H_5 3-phosphoshikimate 1-c...    92   2e-17   
gb:AP006618_560989 Nocardia farcinica IFM 10152 DNA, complete ge...    91   2e-17   
pir|H75438|H75438 3-phosphoshikimate-1-carboxyvinyltransferase -...    91   2e-17   Deinococcus radiodurans
sp|Q9RVD3|AROA_DEIRA|AROA_DEIRA 3-phosphoshikimate 1-carboxyvinyltransferas...    91   2e-17   Deinococcus radiodurans
gb:BA000045_741113 Gloeobacter violaceus PCC 7421 DNA, complete ...    91   4e-17   
gb:AP008231_580976 Synechococcus elongatus PCC 6301 DNA, complet...    91   4e-17   
gb:AE017283_431048 Propionibacterium acnes KPA171202, complete g...    91   4e-17   
gb:CP000001_853280 Bacillus cereus ZK, complete genome.                90   5e-17   
gb:AP006627_564222 Bacillus clausii KSM-K16 DNA, complete genome.      90   7e-17   
gb:AY142772_591955 Heliobacillus mobilis 3-phosphoshikimate 1-ca...    89   9e-17   
sp|Q8DLY3|AROA_SYNEL|AROA_SYNEL 3-phosphoshikimate 1-carboxyvinyltransferas...    89   9e-17   Synechococcus elongatus
gb:AP006841_571265 Bacteroides fragilis YCH46 DNA, complete genome.    89   1e-16   
gb:AE017033_383016 Bacillus anthracis str. Ames section 10 of 18...    89   1e-16   
gb:CP000002_858047 Bacillus licheniformis ATCC 14580, complete g...    89   2e-16   
gb:AE017355_463994 Bacillus thuringiensis serovar konkukian str....    89   2e-16   
gb:AE017333_448237 Bacillus licheniformis DSM 13, complete genome.     89   2e-16   
gb:BA000030_700928 Streptomyces avermitilis MA-4680 genomic DNA,...    88   2e-16   
gb:AE017273_424204 Bacillus cereus ATCC 10987, section 10 of 18 ...    88   2e-16   
gb:AE017178_398065 Porphyromonas gingivalis W83 section 7 of 8 o...    88   2e-16   
sp|P39915|AROA_BURPS|AROA_BURPS 3-phosphoshikimate 1-carboxyvinyltransferas...    88   2e-16   Burkholderia pseudomallei
gb:CP000027_79468 Dehalococcoides ethenogenes 195, complete genome.    88   3e-16   
gb:AE016961_367762 Coxiella burnetii strain RSA 493, section 2 o...    87   4e-16   
gb:BX251410_764398 Tropheryma whipplei TW08/27, complete genome;...    87   6e-16   
gb:AE016852_349091 Tropheryma whipplei str. Twist, section 3 of ...    87   6e-16   
sp|O28775|AROA_ARCFU|AROA_ARCFU Probable 3-phosphoshikimate 1-carboxyvinylt...    87   6e-16   Archaeoglobus fulgidus
gb:AP006878_575415 Thermococcus kodakaraensis strain KOD1 DNA, c...    86   8e-16   
gb:AE010600_264830 Fusobacterium nucleatum subsp. nucleatum ATCC...    86   8e-16   
sp|Q9V1H1|AROA_PYRAB|AROA_PYRAB Probable 3-phosphoshikimate 1-carboxyvinylt...    86   8e-16   Pyrococcus abyssi
sp|P20691|AROA_BACSU|AROA_BACSU 3-phosphoshikimate 1-carboxyvinyltransferas...    86   8e-16   Bacillus subtilis
gb:AE017007_377842 Bacillus cereus ATCC 14579 section 10 of 18 o...    86   1e-15   
gb:AE017180_400898 Geobacter sulfurreducens PCA, complete genome.      86   1e-15   
sp|Q9K4A7|ARA2_STRCO|ARA2_STRCO 3-phosphoshikimate 1-carboxyvinyltransferas...    85   2e-15   Streptomyces coelicolor
gb:AP006840_568608 Symbiobacterium thermophilum DNA, complete ge...    84   4e-15   
sp|Q9Z6M0|AROA_CHLPN|AROA_CHLPN 3-phosphoshikimate 1-carboxyvinyltransferas...    84   4e-15   Chlamydia pneumoniae
sp|Q822G0|AROA_CHLCV|AROA_CHLCV 3-phosphoshikimate 1-carboxyvinyltransferas...    84   5e-15   Chlamydia caviae
sp|O67494|AROA_AQUAE|AROA_AQUAE 3-phosphoshikimate 1-carboxyvinyltransferas...    84   5e-15   Aquifex aeolicus
sp|Q59975|AROA_SYNY3|AROA_SYNY3 3-phosphoshikimate 1-carboxyvinyltransferas...    83   7e-15   Synechocystis sp.
sp|Q9KCA6|ARA1_BACHD|ARA1_BACHD 3-phosphoshikimate 1-carboxyvinyltransferas...    82   1e-14   Bacillus halodurans
gb:FPS298919_136136 Flavobacterium psychrophilum aroA gene for 5...    82   2e-14   
gb:BX571660_778640 Wolinella succinogenes, complete genome; segm...    81   3e-14   
sp|Q9WYI0|AROA_THEMA|AROA_THEMA 3-phosphoshikimate 1-carboxyvinyltransferas...    80   6e-14   Thermotoga maritima
gb:AP008226_577914 Thermus thermophilus HB8 genomic DNA, complet...    79   2e-13   
gb:AE016859_350484 Pseudomonas syringae pv. tomato str. DC3000 s...    79   2e-13   
pir|AD2655|AD2655 3-phosphoshikimate 1-carboxyvinyltransferase [...    79   2e-13   Agrobacterium fabrum str. C58
gb:AE017301_435728 Thermus thermophilus HB27 section 1 of 7 of t...    77   5e-13   
gb:AY354515_612695 Streptomyces sp. HK803 PlmR5 (plmR5), PlmR4 (...    76   1e-12   
sp|Q8Y5Y0|AROA_LISMO|AROA_LISMO 3-phosphoshikimate 1-carboxyvinyltransferas...    75   1e-12   
gb:AE017239_414039 Mycobacterium avium subsp. paratuberculosis s...    75   2e-12   
gb:AE017328_444373 Listeria monocytogenes str. 4b F2365, section...    75   2e-12   
sp|P43905|AROA_LACLC|AROA_LACLC 3-phosphoshikimate 1-carboxyvinyltransferas...    75   2e-12   Lactococcus lactis subsp. cremoris
gb:BA000043_738773 Geobacillus kaustophilus HTA426 DNA, complete...    74   3e-12   
gb:BX572096_797740 Prochlorococcus marinus MIT9313 complete geno...    74   4e-12   
gb:AF114233_480032 Corynebacterium glutamicum 5-enolpyruvylshiki...    74   4e-12   
sp|Q9Z470|AROA_CORGL|AROA_CORGL 3-phosphoshikimate 1-carboxyvinyltransferas...    74   4e-12   Corynebacterium glutamicum
gb:AE017164_395504 Prochlorococcus marinus subsp. marinus str. C...    73   7e-12   
gb:BX572091_796239 Prochlorococcus marinus MED4 complete genome;...    73   9e-12   
sp|Q8RB11|AROA_THETN|AROA_THETN 3-phosphoshikimate 1-carboxyvinyltransferas...    73   9e-12   
sp|Q9CEU0|AROA_LACLA|AROA_LACLA 3-phosphoshikimate 1-carboxyvinyltransferas...    72   1e-11   Lactococcus lactis subsp. lactis
gb:AF481102_514468 Candidatus Tremblaya princeps MviN (mviN) gen...    72   2e-11   
gb:BX571965_790464 Burkholderia pseudomallei strain K96243, chro...    72   2e-11   
gb:BX248345_760613 Mycobacterium bovis subsp. bovis AF2122/97 co...    72   2e-11   
gb:AE010267_261266 Pyrococcus furiosus DSM 3638, section 142 of ...    72   2e-11   
sp|Q8U0A0|AROA_PYRFU|AROA_PYRFU Probable 3-phosphoshikimate 1-carboxyvinylt...    72   2e-11   Pyrococcus furiosus
sp|P22487|AROA_MYCTU|AROA_MYCTU 3-phosphoshikimate 1-carboxyvinyltransferas...    72   2e-11   Mycobacterium tuberculosis
gb:BX842655_826251 Bdellovibrio bacteriovorus complete genome, s...    71   3e-11   
gb:AE013598_296087 Xanthomonas oryzae pv. oryzae KACC10331, comp...    71   3e-11   
gb:CP000010_864682 Burkholderia mallei ATCC 23344 chromosome 1, ...    71   3e-11   
gb:AE016822_340868 Leifsonia xyli subsp. xyli str. CTCB07, compl...    71   3e-11   
sp|Q8DUV8|AROA_STRMU|AROA_STRMU 3-phosphoshikimate 1-carboxyvinyltransferas...    71   3e-11   Streptococcus mutans serotype C
sp|Q9PK28|AROA_CHLMU|AROA_CHLMU 3-phosphoshikimate 1-carboxyvinyltransferas...    71   3e-11   Chlamydia muridarum [agent of mouse pneumonitis]
sp|Q9YEK9|AROA_AERPE|AROA_AERPE Probable 3-phosphoshikimate 1-carboxyvinylt...    70   4e-11   Aeropyrum pernix
sp|Q96Y91|AROA_SULTO|AROA_SULTO Probable 3-phosphoshikimate 1-carboxyvinylt...    70   6e-11   Sulfurisphaera tokodaii
gb:AY375303_614303 Streptococcus suis putative RNA methyltransfe...    70   8e-11   
sp|Q92A85|AROA_LISIN|AROA_LISIN 3-phosphoshikimate 1-carboxyvinyltransferas...    70   8e-11   
sp|Q8PLY5|AROA_XANAC|AROA_XANAC 3-phosphoshikimate 1-carboxyvinyltransferas...    69   1e-10   Xanthomonas citri
gb:AE008692_241534 Zymomonas mobilis subsp. mobilis ZM4, complet...    69   1e-10   
gb:BX569691_775907 Synechococcus sp. WH8102 complete genome; seg...    69   2e-10   
gb:AE014295_311355 Bifidobacterium longum NCC2705, complete genome.    69   2e-10   
sp|Q87BU2|AROA_XYLFT|AROA_XYLFT 3-phosphoshikimate 1-carboxyvinyltransferas...    68   2e-10   Xylella fastidiosa
sp|Q8FRI2|AROA_COREF|AROA_COREF 3-phosphoshikimate 1-carboxyvinyltransferas...    68   2e-10   Corynebacterium efficiens
sp|O84371|AROA_CHLTR|AROA_CHLTR 3-phosphoshikimate 1-carboxyvinyltransferas...    68   3e-10   Chlamydia trachomatis
gb:CP000025_878725 Campylobacter jejuni RM1221, complete genome.       67   4e-10   
gb:AJ812018_533140 Pseudomonas putida aroA gene for 3-phosphoshi...    67   4e-10   
gb:AE009847_256446 Pyrobaculum aerophilum strain IM2 section 102...    67   4e-10   
gb:ECU31523_133949 Escherichia coli 5-enolpyruvylshikimate-3-pho...    67   4e-10   
pir|JC5338|JC5338 3-phosphoshikimate 1-carboxyvinyltransferase (...    67   4e-10   Campylobacter jejuni subsp. jejuni 81116
sp|P56197|AROA_HELPY|AROA_HELPY 3-phosphoshikimate 1-carboxyvinyltransferas...    67   4e-10   Helicobacter pylori
sp|P52312|AROA_CAMJE|AROA_CAMJE 3-phosphoshikimate 1-carboxyvinyltransferas...    67   4e-10   
gb:AY312991_608479 Alvinella pompejana epibiont 7G3 fosmid clone...    67   5e-10   
gb:AE016951_365614 Enterococcus faecalis V583, section 5 of 11 o...    67   5e-10   
sp|Q8PA95|AROA_XANCP|AROA_XANCP 3-phosphoshikimate 1-carboxyvinyltransferas...    67   5e-10   Xanthomonas campestris pv. campestris
gb:BX572593_799676 Rhodopseudomonas palustris CGA009 complete ge...    67   6e-10   
gb:AE016780_331204 Pseudomonas putida KT2440 section 7 of 21 of ...    67   6e-10   
sp|Q9CCI3|AROA_MYCLE|AROA_MYCLE 3-phosphoshikimate 1-carboxyvinyltransferas...    66   8e-10   Mycobacterium leprae
sp|Q8KB71|AROA_CHLTE|AROA_CHLTE 3-phosphoshikimate 1-carboxyvinyltransferas...    66   8e-10   Chlorobaculum tepidum
sp|Q89WF2|AROA_BRAJA|AROA_BRAJA 3-phosphoshikimate 1-carboxyvinyltransferas...    66   1e-09   Bradyrhizobium japonicum
gb:CP000003_860998 Streptococcus pyogenes MGAS10394, complete ge...    65   1e-09   
pir|E83250|E83250 still frameshift 3-PHOSPHOSHIKIMATE 1-CARBOXYV...    65   1e-09   Pseudomonas aeruginosa
sp|Q8E0U0|AROA_STRA5|AROA_STRA5 3-phosphoshikimate 1-carboxyvinyltransferas...    65   2e-09   
gb:BX248355_761998 Corynebacterium diphtheriae gravis NCTC13129,...    65   2e-09   
sp|Q8E6F8|AROA_STRA3|AROA_STRA3 3-phosphoshikimate 1-carboxyvinyltransferas...    65   2e-09   
sp|Q8EQC1|AROA_OCEIH|AROA_OCEIH 3-phosphoshikimate 1-carboxyvinyltransferas...    65   2e-09   Oceanobacillus iheyensis
sp|Q978S3|AROA_THEVO|AROA_THEVO Probable 3-phosphoshikimate 1-carboxyvinylt...    64   3e-09   Thermoplasma volcanium
gb:CP000023_874599 Streptococcus thermophilus LMG 18311, complet...    64   4e-09   
gb:CP000009_862620 Gluconobacter oxydans 621H, complete genome.        64   4e-09   
sp|Q88VL2|AROA_LACPL|AROA_LACPL 3-phosphoshikimate 1-carboxyvinyltransferas...    64   4e-09   Lactobacillus plantarum
gb:CP000024_876489 Streptococcus thermophilus CNRZ1066, complete...    64   5e-09   
sp|Q8P0H1|AROA_STRP8|AROA_STRP8 3-phosphoshikimate 1-carboxyvinyltransferas...    63   7e-09   Streptococcus pyogenes serotype M18
gb:BX897700_828336 Bartonella quintana str. Toulouse, complete g...    63   9e-09   
sp|Q9PB21|AROA_XYLFA|AROA_XYLFA 3-phosphoshikimate 1-carboxyvinyltransferas...    63   9e-09   Xylella fastidiosa
sp|Q8K719|AROA_STRP3|AROA_STRP3 3-phosphoshikimate 1-carboxyvinyltransferas...    63   9e-09   Streptococcus pyogenes serotype M3
gb:BX897699_826731 Bartonella henselae strain Houston-1, complet...    62   1e-08   
gb:BX571868_787626 Photorhabdus luminescens subsp. laumondii TTO...    62   2e-08   
pir|D98025|D98025 3-phosphoshikimate 1-carboxyvinyltransferase (...    62   2e-08   Streptococcus pneumoniae R6
sp|Q8CWQ7|AROA_STRR6|AROA_STRR6 3-phosphoshikimate 1-carboxyvinyltransferas...    62   2e-08   Streptococcus pneumoniae
sp|Q9S400|AROA_STRPN|AROA_STRPN 3-phosphoshikimate 1-carboxyvinyltransferas...    62   2e-08   
sp|Q9A2H2|AROA_CAUCR|AROA_CAUCR 3-phosphoshikimate 1-carboxyvinyltransferas...    62   2e-08   
gb:BX571856_780917 Staphylococcus aureus subsp. aureus strain MR...    62   2e-08   
gb:CP000046_91627 Staphylococcus aureus subsp. aureus COL, compl...    62   2e-08   
sp|Q8NWN5|AROA_STAAW|AROA_STAAW 3-phosphoshikimate 1-carboxyvinyltransferas...    62   2e-08   
sp|Q9ZKF7|AROA_HELPJ|AROA_HELPJ 3-phosphoshikimate 1-carboxyvinyltransferas...    62   2e-08   
gb:AF169483_485137 Streptococcus pneumoniae 5-enolpyruvylshikima...    61   3e-08   
sp|Q99Z83|AROA_STRPY|AROA_STRPY 3-phosphoshikimate 1-carboxyvinyltransferas...    61   3e-08   
gb:CP000032_87897 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...    60   5e-08   
gb:CR628337_114574 Legionella pneumophila str. Lens complete gen...    60   6e-08   
gb:AE017282_428169 Methylococcus capsulatus str. Bath, complete ...    60   8e-08   
sp|Q05615|AROA_STAAU|AROA_STAAU 3-phosphoshikimate 1-carboxyvinyltransferas...    60   8e-08   
gb:PCU31053_1699429 Pneumocystis carinii f. sp. muris (arom) gen...    59   1e-07   
gb:AE017354_459787 Legionella pneumophila subsp. pneumophila str...    59   1e-07   
gb:CR628336_111489 Legionella pneumophila str. Paris complete ge...    59   1e-07   
sp|Q99U25|AROA_STAAM|AROA_STAAM 3-phosphoshikimate 1-carboxyvinyltransferas...    59   1e-07   
gb:AE017144_389892 Helicobacter hepaticus ATCC 51449 section 1 o...    59   1e-07   
sp|Q92SV5|AROA_RHIME|AROA_RHIME 3-phosphoshikimate 1-carboxyvinyltransferas...    59   1e-07   
gb:CR543861_104114 Acinetobacter sp. ADP1 complete genome.             58   2e-07   
pir|S41329|S41329 5-enolpyruvylshikimate-3-phosphate synthase - ...    57   5e-07   
sp|Q98CC1|AROA_RHILO|AROA_RHILO 3-phosphoshikimate 1-carboxyvinyltransferas...    57   7e-07   
gb:AF464188_1801998 Glycine max CP4EPSPS gene, complete cds.>gb:...    56   1e-06   
sp|Q9R4E4|AROA_AGRSP|AROA_AGRSP 3-phosphoshikimate 1-carboxyvinyltransferas...    56   1e-06   
gb:PPAROA_159157 P.pseudomallei aro A gene.                            55   2e-06   
sp|P56952|AROA_PSES2|AROA_PSES2 3-phosphoshikimate 1-carboxyvinyltransferas...    55   2e-06   
gb:PCU31054_1699430 Pneumocystis carinii f. sp. oryctolagi (arom...    54   3e-06   
gb:AE017261_419619 Picrophilus torridus DSM 9790, complete genome.     52   1e-05   
pir|C72618|C72618 probable 3-phosphoshikimate 1-carboxyvinyltran...    52   2e-05   
pir|AG3491|AG3491 3-phosphoshikimate 1-carboxyvinyltransferase (...    52   2e-05   
sp|Q9HLE6|AROA_THEAC|AROA_THEAC Probable 3-phosphoshikimate 1-carboxyvinylt...    52   2e-05   
sp|Q980I5|AROA_SULSO|AROA_SULSO Probable 3-phosphoshikimate 1-carboxyvinylt...    52   2e-05   
sp|Q8YEG1|AROA_BRUME|AROA_BRUME 3-phosphoshikimate 1-carboxyvinyltransferas...    52   2e-05   
sp|Q8G3C4|AROA_BRUSU|AROA_BRUSU 3-phosphoshikimate 1-carboxyvinyltransferas...    52   2e-05   
gb:AF326475_500979 Brucella melitensis biovar Abortus 5-enolpyru...    51   3e-05   
sp|Q9AGV2|AROA_BRUAB|AROA_BRUAB 3-phosphoshikimate 1-carboxyvinyltransferas...    51   3e-05   
gb:PCU31057_1699433 Pneumocystis carinii f. sp. mustelae B (arom...    50   8e-05   
sp|Q8F6P5|AROA_LEPIN|AROA_LEPIN 3-phosphoshikimate 1-carboxyvinyltransferas...    50   8e-05   
gb:PCU31055_1699431 Pneumocystis carinii f. sp. hominis (arom) g...    49   1e-04   
gb:AE017296_434624 Leptospira interrogans serovar Copenhageni st...    49   1e-04   
gb:PCU31056_1699432 Pneumocystis carinii f. sp. mustelae A (arom...    47   4e-04   
sp|Q46550|AROA_BACNO|AROA_BACNO 3-phosphoshikimate 1-carboxyvinyltransferas...    45   0.003   
gb:AE016862_351180 Pseudomonas syringae pv. tomato str. DC3000 s...    43   0.010   
gb:AY314743_1318678 Toxoplasma gondii AROM polypeptide mRNA, com...    39   0.14    
sp|P38844|YHU3_YEAST|YHU3_YEAST Hypothetical 33.4 kDa protein in RPL44B-RPC...    38   0.32    
gb:AE017151_391840 Haemophilus ducreyi strain 35000HP section 1 ...    37   0.55    
sp|Q8Z0C4|MURA_ANASP|MURA_ANASP UDP-N-acetylglucosamine 1-carboxyvinyltrans...    37   0.55    
gb:AF003135_1230784 Caenorhabditis elegans cosmid W03F11, comple...    36   0.94    
pir|T29021|T29021 hypothetical protein W03F11.2 - Caenorhabditis...    36   0.94    
gb:BX842630_1643948 Neurospora crassa DNA linkage group I BAC co...    35   1.6     
gb:AE017330_444915 Listeria monocytogenes str. 4b F2365, section...    35   1.6     
sp|Q8Y4C4|MUA1_LISMO|MUA1_LISMO UDP-N-acetylglucosamine 1-carboxyvinyltrans...    35   1.6     
sp|Q927W7|MUA1_LISIN|MUA1_LISIN UDP-N-acetylglucosamine 1-carboxyvinyltrans...    35   1.6     
sp|Q9A5U7|MURA_CAUCR|MURA_CAUCR UDP-N-acetylglucosamine 1-carboxyvinyltrans...    35   2.7     
gb:AF181128_2209462 HIV-1 from United Kingdom isolate CR7281P po...    34   3.6     
gb:AE017346_1757207 Cryptococcus neoformans var. neoformans JEC2...    34   4.6     
gb:AF309776_1261145 Heterodera glycines guanylyl cyclase mRNA, p...    33   6.1     
sp|Q8R9G7|MUA2_THETN|MUA2_THETN UDP-N-acetylglucosamine 1-carboxyvinyltrans...    33   6.1     
gb:AE017260_418896 Wolbachia endosymbiont of Drosophila melanoga...    33   7.9     


>sp|P11043|AROA_PETHY 3-phosphoshikimate 1-carboxyvinyltransferase,
           chloroplast precursor (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase).>pir|A28198|XUPJVS 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19) precursor -
           garden petunia>gb:A82498_1450959 Sequence 1 from Patent
           WO9854330.>gb:PETAROA_1699833 P.hybrida
           5-enolpyruvylshikimate 3-phosphate synthase mRNA,
           complete cds.
          Length = 516

 Score =  414 bits (1065), Expect = e-114
 Identities = 200/231 (86%), Positives = 214/231 (92%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER G+SVEHS SWDRF +RGGQKYKSPG AFVEGDASSASYFL           VE
Sbjct: 286 LKLMERFGISVEHSSSWDRFFVRGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTITVE 345

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMGAEV+WTENSVTVKGPPR+ SGRKHLRAIDVNMNKMPDVA
Sbjct: 346 GCGTNSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRSSSGRKHLRAIDVNMNKMPDVA 405

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+ADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LN
Sbjct: 406 MTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLN 465

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT+IDTYDDHRMAMAFSLAACA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct: 466 VTDIDTYDDHRMAMAFSLAACADVPVTINDPGCTRKTFPNYFDVLQQYSKH 516



>gb:AY545666_1612944 Conyza canadensis
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS1)
           gene, complete cds.
          Length = 519

 Score =  414 bits (1064), Expect = e-114
 Identities = 201/231 (87%), Positives = 213/231 (92%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHSDSWD+F IRGGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 289 LKLMERFGVSVEHSDSWDQFFIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE 348

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVL +MGAEV+WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVA
Sbjct: 349 GCGTSSLQGDVKFAEVLGQMGAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVA 408

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+ADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LN
Sbjct: 409 MTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLN 468

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACA+VPVTIKDP CTRKTFPDYFEVLQ+F+KH
Sbjct: 469 VTAIDTYDDHRMAMAFSLAACADVPVTIKDPSCTRKTFPDYFEVLQRFAKH 519



>pir|B28198|XUTOVS 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) precursor - tomato
          Length = 520

 Score =  411 bits (1056), Expect = e-113
 Identities = 202/231 (87%), Positives = 210/231 (90%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHS  WDRFL++GGQKYKSPG AFVEGDASSASYFL           VE
Sbjct: 290 LKLMERFGVSVEHSSGWDRFLVKGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTVTVE 349

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVLEKMGAEV+WTENSVTVKGPPR  SG KHLRAIDVNMNKMPDVA
Sbjct: 350 GCGTSSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNKMPDVA 409

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LN
Sbjct: 410 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLN 469

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VTEIDTYDDHRMAMAFSLAACA+VPVTIK+PGCTRKTFPDYFEVLQK+SKH
Sbjct: 470 VTEIDTYDDHRMAMAFSLAACADVPVTIKNPGCTRKTFPDYFEVLQKYSKH 520



>sp|P23281|ARO2_TOBAC 3-phosphoshikimate 1-carboxyvinyltransferase 2
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase 2) (EPSP synthase 2)
           (Fragment).>pir|S18354|S18354 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19) - common
           tobacco>gb:TOBEPSPS2_1725419 N.tabacum
           5-enolpyruvylshikimate-3-phosphate synthase mRNA, 5'
           cds.
          Length = 338

 Score =  410 bits (1053), Expect = e-113
 Identities = 199/231 (86%), Positives = 212/231 (91%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER G+SVEHS SWDRF++RGGQKYKSPG A+VEGDASSASYFL           VE
Sbjct: 108 LKLMERFGISVEHSSSWDRFVVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE 167

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVLE+MGAEV+WTENSVTVKGPPR  S  KHLRAIDVNMNKMPDVA
Sbjct: 168 GCGTSSLQGDVKFAEVLEQMGAEVTWTENSVTVKGPPRNSSAMKHLRAIDVNMNKMPDVA 227

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LN
Sbjct: 228 MTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLN 287

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VTEIDTYDDHRMAMAFSLAACA+VPVTI DPGCTRKTFP+YF+VLQ++SKH
Sbjct: 288 VTEIDTYDDHRMAMAFSLAACADVPVTINDPGCTRKTFPNYFDVLQQYSKH 338



>gb:AY545667_1612945 Conyza canadensis
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS2)
           gene, complete cds.
          Length = 523

 Score =  409 bits (1052), Expect = e-113
 Identities = 198/231 (85%), Positives = 212/231 (91%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHSD+WDRF +RGGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 293 LKLMERFGVSVEHSDTWDRFHVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE 352

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVL +MGAEV+WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVA
Sbjct: 353 GCGTSSLQGDVKFAEVLGQMGAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVA 412

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+ADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LN
Sbjct: 413 MTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLN 472

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL++++KH
Sbjct: 473 VTAIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLERYTKH 523



>sp|P10748|AROA_LYCES 3-phosphoshikimate 1-carboxyvinyltransferase,
           chloroplast precursor (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase).>gb:TOMAROA_1725607 Tomato
           5-enolpyruvylshikimate-3-phosphate synthase mRNA,
           complete cds.
          Length = 520

 Score =  409 bits (1050), Expect = e-113
 Identities = 201/231 (87%), Positives = 209/231 (90%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GV VEHS  WDRFL++GGQKYKSPG AFVEGDASSASYFL           VE
Sbjct: 290 LKLMERFGVFVEHSSGWDRFLVKGGQKYKSPGKAFVEGDASSASYFLAGAAVTGGTVTVE 349

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVLEKMGAEV+WTENSVTVKGPPR  SG KHLRAIDVNMNKMPDVA
Sbjct: 350 GCGTSSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRNSSGMKHLRAIDVNMNKMPDVA 409

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LN
Sbjct: 410 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLN 469

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VTEIDTYDDHRMAMAFSLAACA+VPVTIK+PGCTRKTFPDYFEVLQK+SKH
Sbjct: 470 VTEIDTYDDHRMAMAFSLAACADVPVTIKNPGCTRKTFPDYFEVLQKYSKH 520



>sp|P23981|ARO1_TOBAC 3-phosphoshikimate 1-carboxyvinyltransferase
           1, chloroplast precursor (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase 1) (EPSP
           synthase 1).>pir|S18353|S18353 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19) precursor -
           common tobacco>gb:TOBEPSPS1_1725418 N.tabacum
           5-enolpyruvylshikimate-3-phosphate synthase mRNA,
           complete cds.
          Length = 518

 Score =  409 bits (1050), Expect = e-113
 Identities = 199/231 (86%), Positives = 212/231 (91%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEH+ SWD+FL+RGGQKYKSPG A+VEGDASSASYFL           VE
Sbjct: 288 LKLMERFGVSVEHTSSWDKFLVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE 347

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVLEKMGAEV+WTENSVTVKGPPR  SG KHLRA+DVNMNKMPDVA
Sbjct: 348 GCGTSSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRNSSGMKHLRAVDVNMNKMPDVA 407

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERMIA+CTELRKLGATV EG DYCIITPPE+LN
Sbjct: 408 MTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVVEGSDYCIITPPEKLN 467

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VTEIDTYDDHRMAMAFSLAACA+VPVTIKDPGCTRKTFP+YF+VLQ++SKH
Sbjct: 468 VTEIDTYDDHRMAMAFSLAACADVPVTIKDPGCTRKTFPNYFDVLQQYSKH 518



>gb:AF371966_1792436 Dicliptera chinensis
           5-enolpyruvylshikimate-3-phosphate synthase B mRNA,
           complete cds; nuclear gene for plastid product.
          Length = 516

 Score =  408 bits (1048), Expect = e-113
 Identities = 201/231 (87%), Positives = 211/231 (91%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GV VEH+D+WDRFLIRGGQKYKSPGNAFVEGDASSASYFL           VE
Sbjct: 287 LKLMERFGVYVEHTDNWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE 346

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVLEKMGA+VSWTENSVTV GPPR P G+KHLRAIDVNMNKMPDVA
Sbjct: 347 GCGTSSLQGDVKFAEVLEKMGAKVSWTENSVTVTGPPRVP-GKKHLRAIDVNMNKMPDVA 405

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LN
Sbjct: 406 MTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLN 465

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACA+VPVTIKDPGCTRKTFP+YF+VL  +S H
Sbjct: 466 VTAIDTYDDHRMAMAFSLAACADVPVTIKDPGCTRKTFPNYFDVLSTYSNH 516



>gb:AF371965_1792435 Dicliptera chinensis
           5-enolpyruvylshikimate-3-phosphate synthase mRNA,
           complete cds; nuclear gene for plastid product.
          Length = 516

 Score =  408 bits (1048), Expect = e-113
 Identities = 201/231 (87%), Positives = 211/231 (91%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GV VEH+D+WDRFLIRGGQKYKSPGNAFVEGDASSASYFL           VE
Sbjct: 287 LKLMERFGVYVEHTDNWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE 346

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVLEKMGA+VSWTENSVTV GPPR P G+KHLRAIDVNMNKMPDVA
Sbjct: 347 GCGTSSLQGDVKFAEVLEKMGAKVSWTENSVTVTGPPRVP-GKKHLRAIDVNMNKMPDVA 405

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYCIITPPE+LN
Sbjct: 406 MTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCIITPPEKLN 465

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACA+VPVTIKDPGCTRKTFP+YF+VL  +S H
Sbjct: 466 VTAIDTYDDHRMAMAFSLAACADVPVTIKDPGCTRKTFPNYFDVLSTYSNH 516



>gb:AY150520_1585085 Vitis vinifera
           5-enolpyruvylshikimate-3-phosphate synthase mRNA,
           partial cds.
          Length = 330

 Score =  399 bits (1026), Expect = e-110
 Identities = 197/231 (85%), Positives = 209/231 (90%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHS++WDRFLIRGGQKYKSPGNAFVEGDASSASYFL           VE
Sbjct: 101 LKLMERFGVSVEHSNTWDRFLIRGGQKYKSPGNAFVEGDASSASYFLAGAAVTGGTVTVE 160

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKF E L  MGA+VSWTENSVTV GPP+  SGRKHLRAIDVNMNKMPDVA
Sbjct: 161 GCGTSSLQGDVKFVEFLS-MGAKVSWTENSVTVTGPPQDSSGRKHLRAIDVNMNKMPDVA 219

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+A+GPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LN
Sbjct: 220 MTLAVVALYAEGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLN 279

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACA+VPVTIKDPGC RKT PDYFEVLQ+F+KH
Sbjct: 280 VTSIDTYDDHRMAMAFSLAACADVPVTIKDPGCIRKTSPDYFEVLQRFTKH 330



>gb:AY545668_1612946 Conyza canadensis
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS3)
           mRNA, partial cds.
          Length = 454

 Score =  395 bits (1014), Expect = e-109
 Identities = 191/231 (82%), Positives = 208/231 (90%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLM+R GVSVEHSD+ DRF +RGGQKYKSPGNA+VE DASSASYFL           VE
Sbjct: 224 LKLMQRFGVSVEHSDTLDRFHVRGGQKYKSPGNAYVESDASSASYFLAGAAITGGTVTVE 283

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVL +MGAEV+WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVA
Sbjct: 284 GCGTSSLQGDVKFAEVLGQMGAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVA 343

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+ADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYC+ TPPE+LN
Sbjct: 344 MTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCVTTPPEKLN 403

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAM FSLAACA+VPVTIKDPGCTRK+FPDYFEVL++++KH
Sbjct: 404 VTAIDTYDDHRMAMTFSLAACADVPVTIKDPGCTRKSFPDYFEVLERYTKH 454



>pir|H84888|H84888 hypothetical protein At2g45300 [imported] -
           Arabidopsis thaliana>gb:AC002387_1530592 Arabidopsis
           thaliana chromosome 2 clone F4L23 map CIC02E07, complete
           sequence.
          Length = 520

 Score =  393 bits (1010), Expect = e-108
 Identities = 188/231 (81%), Positives = 205/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 290 LKLMERFGVSVEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 349

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GPPR   G +HLRAIDVNMNKMPDVA
Sbjct: 350 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVA 409

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++ 
Sbjct: 410 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVK 469

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct: 470 TAEIDTYDDHRMAMAFSLAACADVPITINDPGCTRKTFPDYFQVLERITKH 520



>pir|S01061|XUMUVS 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) precursor - Arabidopsis thaliana
          Length = 520

 Score =  390 bits (1002), Expect = e-107
 Identities = 187/231 (80%), Positives = 204/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 290 LKLMERFGVSVEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 349

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GPPR   G +HLRAIDVNMNKMPDVA
Sbjct: 350 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVA 409

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++ 
Sbjct: 410 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVK 469

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VP+TI D GCTRKTFPDYF+VL++ +KH
Sbjct: 470 TAEIDTYDDHRMAMAFSLAACADVPITINDSGCTRKTFPDYFQVLERITKH 520



>gb:A69537_1450450 Sequence 5 from Patent WO9802562.
          Length = 445

 Score =  389 bits (998), Expect = e-107
 Identities = 190/231 (82%), Positives = 204/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFL           VE
Sbjct: 215 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE 274

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVA
Sbjct: 275 GCGTTSLQGDVKFAEVLEMMGAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVA 334

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 335 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 394

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 395 VTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 445



>gb:A69535_1450449 Sequence 3 from Patent WO9802562.
          Length = 445

 Score =  389 bits (998), Expect = e-107
 Identities = 190/231 (82%), Positives = 204/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFL           VE
Sbjct: 215 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE 274

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVA
Sbjct: 275 GCGTTSLQGDVKFAEVLEMMGAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVA 334

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 335 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 394

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 395 VTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 445



>gb:A59347_1449890 Sequence 4 from Patent
           WO9704114.>gb:A59406_1449903 Sequence 4 from Patent
           WO9704103.>gb:AX463795_1469075 Sequence 4 from Patent
           EP1217073.
          Length = 444

 Score =  389 bits (998), Expect = e-107
 Identities = 190/231 (82%), Positives = 204/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFL           VE
Sbjct: 214 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE 273

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVA
Sbjct: 274 GCGTTSLQGDVKFAEVLEMMGAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVA 333

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 334 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 393

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 394 VTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 444



>gb:A59345_1449889 Sequence 2 from Patent
           WO9704114.>gb:A59404_1449902 Sequence 2 from Patent
           WO9704103.>gb:AX463793_1469074 Sequence 2 from Patent
           EP1217073.>gb:ZMEPSPS_1731838 Z.mays mRNA for
           EPSP-synthase.
          Length = 444

 Score =  389 bits (998), Expect = e-107
 Identities = 190/231 (82%), Positives = 204/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFL           VE
Sbjct: 214 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE 273

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WTE SVTV GPPR P GRKHL+AIDVNMNKMPDVA
Sbjct: 274 GCGTTSLQGDVKFAEVLEMMGAKVTWTETSVTVTGPPREPFGRKHLKAIDVNMNKMPDVA 333

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 334 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 393

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 394 VTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 444



>gb:AY512663_1610475 Brassica rapa
           5-enolpyruvylshikimate-3-phosphate synthase (EPSP) mRNA,
           complete cds.
          Length = 514

 Score =  388 bits (997), Expect = e-107
 Identities = 187/231 (80%), Positives = 202/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 284 LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 343

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GP R   G +HLRA+DVNMNKMPDVA
Sbjct: 344 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVA 403

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++ 
Sbjct: 404 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVK 463

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct: 464 PAEIDTYDDHRMAMAFSLAACADVPVTIKDPGCTRKTFPDYFQVLESITKH 514



>sp|P17688|AROA_BRANA 3-phosphoshikimate 1-carboxyvinyltransferase,
           chloroplast precursor (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase).>pir|S12744|S12744 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19) precursor -
           rape>gb:BNEPSPG_1633533 Brassica napus
           5-enolpyruvylshikimate-3-phosphate synthase gene.
          Length = 516

 Score =  388 bits (997), Expect = e-107
 Identities = 187/231 (80%), Positives = 202/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 286 LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 345

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GP R   G +HLRA+DVNMNKMPDVA
Sbjct: 346 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVA 405

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++ 
Sbjct: 406 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVK 465

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct: 466 PAEIDTYDDHRMAMAFSLAACADVPVTIKDPGCTRKTFPDYFQVLESITKH 516



>sp|P05466|AROA_ARATH 3-phosphoshikimate 1-carboxyvinyltransferase,
           chloroplast precursor (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase).>gb:ATEPSPS_1548119 Arabidopsis thaliana gene
           for 5-enolpyruvylshikimate-3-phosphate synthase (EPSP).
          Length = 520

 Score =  388 bits (997), Expect = e-107
 Identities = 186/231 (80%), Positives = 203/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHSDSWDRF ++GGQKYKSPGNA+VEGDASSA YFL           VE
Sbjct: 290 LKLMERFGVSVEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSACYFLAGAAITGETVTVE 349

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GPPR   G +HLRAIDVNMNKMPDVA
Sbjct: 350 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPPRDAFGMRHLRAIDVNMNKMPDVA 409

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++ 
Sbjct: 410 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVK 469

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VP+TI D GCTRKTFPDYF+VL++ +KH
Sbjct: 470 TAEIDTYDDHRMAMAFSLAACADVPITINDSGCTRKTFPDYFQVLERITKH 520



>gb:AF440389_1800061 Orychophragmus violaceus
           5-enolpyruvylshikimate-3-phosphate synthase mRNA,
           complete cds.
          Length = 518

 Score =  387 bits (993), Expect = e-106
 Identities = 186/231 (80%), Positives = 202/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVS EHS+SWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 288 LKLMERFGVSAEHSESWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 347

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GP R   G +HLRA+DVNMNKMPDVA
Sbjct: 348 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPSRDAFGMRHLRAVDVNMNKMPDVA 407

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP ++ 
Sbjct: 408 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPAKVK 467

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VPVTIKDPGCTRKTFPDYF+VL+  +KH
Sbjct: 468 PAEIDTYDDHRMAMAFSLAACADVPVTIKDPGCTRKTFPDYFQVLESITKH 518



>gb:AY086717_1571761 Arabidopsis thaliana clone 270032 mRNA,
           complete sequence.
          Length = 521

 Score =  386 bits (992), Expect = e-106
 Identities = 185/231 (80%), Positives = 203/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVS EHS+SWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 291 LKLMERFGVSAEHSESWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 350

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GP R   G +HLRAIDVNMNKMPDVA
Sbjct: 351 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPSRDAFGMRHLRAIDVNMNKMPDVA 410

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++ 
Sbjct: 411 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVK 470

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct: 471 PAEIDTYDDHRMAMAFSLAACADVPITINDPGCTRKTFPDYFQVLERITKH 521



>pir|D96526|D96526 hypothetical protein F27K7.11 [imported] -
           Arabidopsis thaliana>gb:AE005173_892829 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY040065_1560562 Arabidopsis thaliana
           putative 5-enolpyruvylshikimate-3-phosphate synthase
           (At1g48860) mRNA, complete cds.>gb:AC084242_1733405
           Arabidopsis thaliana chromosome 1 BAC T24P22 genomic
           sequence, complete sequence.>gb:AC084414_1733647
           Arabidopsis thaliana chromosome 1 BAC F27K7 genomic
           sequence, complete sequence.>gb:AF360224_1791177
           Arabidopsis thaliana putative
           5-enolpyruvylshikimate-3-phosphate (EPSP) synthase
           (At1g48860) mRNA, complete cds.
          Length = 521

 Score =  386 bits (992), Expect = e-106
 Identities = 185/231 (80%), Positives = 203/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVS EHS+SWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 291 LKLMERFGVSAEHSESWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 350

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV GP R   G +HLRAIDVNMNKMPDVA
Sbjct: 351 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTVTGPSRDAFGMRHLRAIDVNMNKMPDVA 410

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPT IRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPP+++ 
Sbjct: 411 MTLAVVALFADGPTTIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPKKVK 470

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EIDTYDDHRMAMAFSLAACA+VP+TI DPGCTRKTFPDYF+VL++ +KH
Sbjct: 471 PAEIDTYDDHRMAMAFSLAACADVPITINDPGCTRKTFPDYFQVLERITKH 521



>gb:AY157642_1585428 Eleusine indica
           5-enolpyruvylshikimate-3-phosphate synthase (epsps-S)
           gene, partial cds; nuclear gene for plastid
           product.>gb:EIN417034_1676558 Eleusine indica plastid
           partial mRNA for 5-enolpyruvylshikimate-3-phosphate
           synthase (epsps-S gene).
          Length = 445

 Score =  384 bits (987), Expect = e-105
 Identities = 188/231 (81%), Positives = 203/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFL           VE
Sbjct: 215 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE 274

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WTE SVTV GP R P GRKHL+AIDVNMNKMPDVA
Sbjct: 275 GCGTTSLQGDVKFAEVLEMMGAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVA 334

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 335 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 394

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 395 VTAIDTYDDHRMAMAFSLAACADVPVTIRDPGCTRKTFPDYFDVLSTFVKN 445



>gb:AP002542_1822638 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0679C08.>gb:AP004234_1839073 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0001H02.
          Length = 515

 Score =  383 bits (984), Expect = e-105
 Identities = 183/231 (79%), Positives = 205/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFL           V+
Sbjct: 285 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ 344

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVA
Sbjct: 345 GCGTTSLQGDVKFAEVLEMMGAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVA 404

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 405 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 464

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           +T IDTYDDHRMAMAFSLAACA+VPVTI+DPGCTRKTFP+YF+VL  F ++
Sbjct: 465 ITAIDTYDDHRMAMAFSLAACADVPVTIRDPGCTRKTFPNYFDVLSTFVRN 515



>gb:AB052962_1521265 Oryza sativa EPSPs, rps20 genes for
           3-phosphoshikimate 1-carboxyvinyltransferase, 40S
           ribosomal protein S20, complete cds.>gb:AF413081_1797381
           Oryza sativa 5-enolpyruvylshikimate 3-phosphate synthase
           gene, complete cds.>gb:AF413082_1797382 Oryza sativa
           EPSP synthase mRNA, complete cds.
          Length = 511

 Score =  383 bits (984), Expect = e-105
 Identities = 183/231 (79%), Positives = 205/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFL           V+
Sbjct: 281 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ 340

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVA
Sbjct: 341 GCGTTSLQGDVKFAEVLEMMGAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVA 400

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 401 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 460

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           +T IDTYDDHRMAMAFSLAACA+VPVTI+DPGCTRKTFP+YF+VL  F ++
Sbjct: 461 ITAIDTYDDHRMAMAFSLAACADVPVTIRDPGCTRKTFPNYFDVLSTFVRN 511



>gb:AB016765_1512854 Oryza sativa (japonica cultivar-group) mRNA for
           3-phosphoshikimate 1-carboxyvinyltransferase, complete
           cds.
          Length = 391

 Score =  383 bits (984), Expect = e-105
 Identities = 183/231 (79%), Positives = 205/231 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFL           V+
Sbjct: 161 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ 220

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVA
Sbjct: 221 GCGTTSLQGDVKFAEVLEMMGAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVA 280

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEGPDYCIITPPE+LN
Sbjct: 281 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGPDYCIITPPEKLN 340

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           +T IDTYDDHRMAMAFSLAACA+VPVTI+DPGCTRKTFP+YF+VL  F ++
Sbjct: 341 ITAIDTYDDHRMAMAFSLAACADVPVTIRDPGCTRKTFPNYFDVLSTFVRN 391



>gb:AY157643_1585429 Eleusine indica
           5-enolpyruvylshikimate-3-phosphate synthase (epsps-R)
           gene, partial cds; nuclear gene for plastid
           product.>gb:EIN417033_1676557 Eleusine indica plastid
           partial mRNA for 5-enolpyruvylshikimate-3-phosphate
           synthase (epsps-R gene).
          Length = 445

 Score =  380 bits (977), Expect = e-104
 Identities = 187/231 (80%), Positives = 202/231 (87%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSP NA+VEGDASSASYFL           VE
Sbjct: 215 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPKNAYVEGDASSASYFLAGAAITGGTVTVE 274

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WTE SVTV GP R P GRKHL+AIDVNMNKMPDVA
Sbjct: 275 GCGTTSLQGDVKFAEVLEMMGAKVTWTETSVTVTGPQREPFGRKHLKAIDVNMNKMPDVA 334

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+ TEL KLGA+VEEG DYCIITPPE+LN
Sbjct: 335 MTLAVVALFADGPTAIRDVASWRVKETERMVAIRTELTKLGASVEEGLDYCIITPPEKLN 394

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           VT IDTYDDHRMAMAFSLAACA+VPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 395 VTAIDTYDDHRMAMAFSLAACADVPVTIRDPGCTRKTFPDYFDVLSTFVKN 445



>gb:AY545659_1612937 Erigeron annuus
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS) mRNA,
           partial cds.
          Length = 358

 Score =  334 bits (857), Expect = 1e-90
 Identities = 164/189 (86%), Positives = 172/189 (91%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHSDSWDRF IRGGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 170 LKLMERFGVSVEHSDSWDRFFIRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE 229

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVL +MGAEV+WTENSVTVKGPPR  SGRKHLRA+DVNMNKMPDVA
Sbjct: 230 GCGTSSLQGDVKFAEVLGQMGAEVTWTENSVTVKGPPRDSSGRKHLRAVDVNMNKMPDVA 289

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+ADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEGPDYC+ITPPE+LN
Sbjct: 290 MTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPDYCVITPPEKLN 349

Query: 371 VTEIDTYDD 345
           VT IDTYDD
Sbjct: 350 VTAIDTYDD 358



>gb:AF349754_1790244 Lolium rigidum 5-enolpyruvylshikimate
           3-phosphate synthase (epsp-s) mRNA, epsp-s-S allele,
           partial cds.
          Length = 347

 Score =  329 bits (843), Expect = 5e-89
 Identities = 159/195 (81%), Positives = 173/195 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV+ EHSDSWDRF I+GGQK KSPGNA+VEGDASSASYFL           V+
Sbjct: 153 LRLMERFGVTAEHSDSWDRFYIKGGQKXKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ 212

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WT+ SVTV GPPR P GRKHL+A+DVNMNKMPDVA
Sbjct: 213 GCGTTSLQGDVKFAEVLEMMGAKVTWTDTSVTVTGPPRQPFGRKHLKAVDVNMNKMPDVA 272

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVALFADGPTAIRDVASWRVKETERM+A+CTEL KLGATVEEGPDYCIITPPE+LN
Sbjct: 273 MTLAVVALFADGPTAIRDVASWRVKETERMVAICTELTKLGATVEEGPDYCIITPPEKLN 332

Query: 371 VTEIDTYDDHRMAMA 327
           VT IDTYDDHRMAMA
Sbjct: 333 VTAIDTYDDHRMAMA 347



>gb:AY545660_1612938 Erigeron annuus
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS2)
           mRNA, partial cds.
          Length = 360

 Score =  322 bits (825), Expect = 7e-87
 Identities = 157/189 (83%), Positives = 169/189 (89%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEH+D+WDRF +RGGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 172 LKLMERFGVSVEHNDTWDRFHVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE 231

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVL +MGAEV+WTENSVTVKGPPR  SGR HLR +DVNMNKMPDVA
Sbjct: 232 GCGTSSLQGDVKFAEVLGQMGAEVTWTENSVTVKGPPRNSSGRGHLRPVDVNMNKMPDVA 291

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+A+GPTAIRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN
Sbjct: 292 MTLAVVALYABGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGTDYCVITPPEKLN 351

Query: 371 VTEIDTYDD 345
           VT IDTYDD
Sbjct: 352 VTAIDTYDD 360



>gb:AY545657_1612935 Amaranthus rudis
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS1)
           mRNA, partial cds.
          Length = 357

 Score =  318 bits (814), Expect = 1e-85
 Identities = 155/188 (82%), Positives = 167/188 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           ++LMER GVSVEHSDSWDRF IRGGQKYKSPG A+VEGDASSASYFL           V+
Sbjct: 170 IRLMERFGVSVEHSDSWDRFFIRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVK 229

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGTSSLQGDVKFAEVLEKMG +V+WT+NSVTV GPPR  SGRKHLRAIDVNMNKMPDVA
Sbjct: 230 GCGTSSLQGDVKFAEVLEKMGCKVTWTDNSVTVTGPPRESSGRKHLRAIDVNMNKMPDVA 289

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAVVAL+ADGPTAIRDVASWRVKETERMIA+CTELRKLGATVEEG DYC+ITPPE+LN
Sbjct: 290 MTLAVVALYADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGSDYCVITPPEKLN 349

Query: 371 VTEIDTYD 348
            T I+TYD
Sbjct: 350 PTAIETYD 357



>gb:AE005674_70485 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016981_370867 Shigella flexneri 2a str.
           2457T section 4 of 16 of the complete
           genome.>gb:AE014073_995617 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 427

 Score =  244 bits (624), Expect = 1e-63
 Identities = 123/230 (53%), Positives = 160/230 (69%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIENQH-YQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA + W ++ ++          R  L AID++MN +PD A
Sbjct: 264 GIGRNSMQGDIRFADVLEKMGATICWGDDYISCT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPPE+LN
Sbjct: 316 MTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPEKLN 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 FAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 425



>sp|Q9ZFF7|AROA_SHISO 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AF101225_479160
           Shigella sonnei 3-enolpyruvylshikimate-5-phosphate
           synthetase (aroA) gene, complete cds.
          Length = 427

 Score =  244 bits (624), Expect = 1e-63
 Identities = 123/230 (53%), Positives = 160/230 (69%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIENQH-YQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA + W ++ ++          R  L AID++MN +PD A
Sbjct: 264 GIGRNSMQGDIRFADVLEKMGATICWGDDYISCT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPPE+LN
Sbjct: 316 MTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPEKLN 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 FAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 425



>sp|O87006|AROA_SHIDY 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:SDU82268_181882
           Shigella dysenteriae EPSP synthase AroA (aroA) gene,
           complete cds.
          Length = 427

 Score =  244 bits (624), Expect = 1e-63
 Identities = 123/230 (53%), Positives = 160/230 (69%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIENQH-YQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA + W ++ ++          R  L AID++MN +PD A
Sbjct: 264 GIGRNSMQGDIRFADVLEKMGATICWGDDYISCT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPPE+LN
Sbjct: 316 MTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPEKLN 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 FAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 425



>sp|P07638|AROA_ECOLI 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|C64830|XUECVS
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Escherichia coli (strain
           K-12)>pir|E85616|E85616
           5-enolpyruvylshikimate-3-phosphate synthetase [imported]
           - Escherichia coli (strain O157:H7, substrain
           EDL933)>pir|G90752|G90752
           5-enolpyruvylshikimate-3-phosphate synthetase [imported]
           - Escherichia coli (strain O157:H7, substrain RIMD
           0509952)>gb:AE005174_65326 Escherichia coli O157:H7
           EDL933, complete genome.>gb:D90728_121697 Escherichia
           coli K12 genomic DNA. (20.4 - 20.8
           min).>gb:D90729_121706 Escherichia coli K12 genomic DNA.
           (20.5 - 20.9 min).>gb:U00096_199983 Escherichia coli
           K-12 MG1655 complete genome.>gb:BA000007_659003
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 427

 Score =  244 bits (624), Expect = 1e-63
 Identities = 123/230 (53%), Positives = 160/230 (69%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIENQH-YQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA + W ++ ++          R  L AID++MN +PD A
Sbjct: 264 GIGRNSMQGDIRFADVLEKMGATICWGDDYISCT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPPE+LN
Sbjct: 316 MTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPEKLN 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 FAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 425



>gb:ECAROA_125066 E.coli gene aroA for 5-enolpyruvylshikimate
           3-phosphate synthase (EPSP synthase, EC 2.5.1.19,
           alternative name 3-phosphoshikimate
           1-carboxyvinyltransferase).
          Length = 427

 Score =  244 bits (623), Expect = 2e-63
 Identities = 123/230 (53%), Positives = 160/230 (69%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIENQH-YQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA + W ++ ++          R  L AID++MN +PD A
Sbjct: 264 GIGRNSMQGDIRFADVLEKMGATICWGDDYISCT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPPE+LN
Sbjct: 316 MTIATAALFAKGTTRLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPEKLN 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 FAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 425



>gb:AE016920_358009 Chromobacterium violaceum ATCC 12472 section 11
           of 16 of the complete genome.>gb:AE016825_1043163
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 456

 Score =  243 bits (619), Expect = 5e-63
 Identities = 129/226 (57%), Positives = 152/226 (67%), Gaps = 1/226 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GV VE  D W RF+I GGQ Y SPG  +VEGDASSASYFL           VE
Sbjct: 233 LNLMARFGVRVER-DGWQRFVIPGGQHYISPGEVYVEGDASSASYFLAAGALAGGPVRVE 291

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGDV+FAE LE+MGA V   +N +  +   R       L+AID++ N +PD A
Sbjct: 292 GVGEASIQGDVRFAEALERMGASVRLGDNWIEARAEGR-------LKAIDLDCNHIPDAA 344

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAV AL ADG T +R++ASWRVKET+R+ A+  ELRK+GATVEEGPDY  +TPP  L 
Sbjct: 345 MTLAVAALAADGTTTLRNIASWRVKETDRLSAMAAELRKVGATVEEGPDYIRVTPPAALT 404

Query: 371 V-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL 237
              EIDTYDDHRMAM FSL +    PV I DPGC  KTFP YF+ L
Sbjct: 405 PNAEIDTYDDHRMAMCFSLVSLLGAPVVINDPGCVAKTFPGYFQAL 450



>gb:AY334546_610719 Escherichia coli 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) gene, complete cds.
          Length = 427

 Score =  241 bits (615), Expect = 1e-62
 Identities = 122/230 (53%), Positives = 159/230 (69%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIENQH-YQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G   +S+QGD++FA+VLEKMGA + W ++ ++          R  L AID++MN +PD A
Sbjct: 264 GIVRNSMQGDIRFADVLEKMGATICWGDDYISCT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPPE+LN
Sbjct: 316 MTIATAALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPEKLN 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 FAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 425



>sp|P19688|AROA_YEREN 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|JQ0131|XUEBY
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) [validated] - Yersinia
           enterocolitica>gb:YEPSERCARO_211261 Y.enterocolitica
           5-enolpyruvylshikimate 3-phosphate synthase (aroA) and
           3-phosphoserine aminotransferase (serC) genes, complete
           cds.
          Length = 427

 Score =  241 bits (615), Expect = 1e-62
 Identities = 125/230 (54%), Positives = 157/230 (68%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV V H +++  F I+GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LHLMKAFGVDVVH-ENYQIFHIKGGQTYRSPGIYLVEGDASSASYFLAAAAIKGGTVRVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD KFA+VLEKMGA++SW ++ +           R  L+ ID++MN +PD A
Sbjct: 264 GIGKQSVQGDTKFADVLEKMGAKISWGDDYIECS--------RGELQGIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFADGPT IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP +L 
Sbjct: 316 MTIATTALFADGPTVIRNIYNWRVKETDRLSAMATELRKVGAEVEEGQDYIRVVPPAQLI 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 AAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARLSQ 425



>sp|Q8FJB6|AROA_ECOL6 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE016758_325085
           Escherichia coli CFT073 section 4 of 18 of the complete
           genome.>gb:AE014075_955669 Escherichia coli CFT073
           complete genome.
          Length = 427

 Score =  239 bits (610), Expect = 6e-62
 Identities = 120/230 (52%), Positives = 159/230 (69%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV +E+   + +F+++GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIENQH-YQQFVVKGGQSYQSPGTYLVEGDASSASYFLAAAAIRGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA + W ++ ++          R  L AID++MN +PD A
Sbjct: 264 GIGRNSMQGDIRFADVLEKMGATICWGDDYISCT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKE++R+ A+ TELRK+GA VEEG D+  ITPPE+L 
Sbjct: 316 MTIATAALFAKGTTTLRNIYNWRVKESDRLFAMATELRKVGAEVEEGHDFIRITPPEKLK 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 376 FAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 425



>gb:BX936398_836060 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 428

 Score =  239 bits (609), Expect = 7e-62
 Identities = 122/230 (53%), Positives = 155/230 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  G+ V H +++  F I+GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 206 LHLMKAFGIDVGH-ENYQIFHIKGGQTYRSPGTYLVEGDASSASYFLAAAAIKGGTVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD KFA+VLEKMGA+V+W ++ +           R  L+ ID++MN +PD A
Sbjct: 265 GIGKKSVQGDTKFADVLEKMGAKVTWGDDYIECS--------RGELQGIDMDMNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA GPT IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP +L 
Sbjct: 317 MTIATTALFATGPTTIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDYIRVVPPVQLT 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             +I TYDDHRMAM FSL A ++ PVTI DP CT KTFPDYFE   + S+
Sbjct: 377 AADIGTYDDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQFARLSQ 426



>sp|P24497|AROA_KLEPN 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|S13266|S13266
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Klebsiella pneumoniae>gb:KPAROA_139240
           K.pneumoniae aroA gene.
          Length = 427

 Score =  239 bits (609), Expect = 7e-62
 Identities = 124/229 (54%), Positives = 157/229 (68%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV VE+  ++ RF++RG Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 205 LHLMKTFGVEVENQ-AYQRFIVRGNQQYQSPGDYLVEGDASSASYFLAAGAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA V+W E+ +           R  L AID++MN +PD A
Sbjct: 264 GIGRNSVQGDIRFADVLEKMGATVTWGEDYIACT--------RGELNAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP  L 
Sbjct: 316 MTIATAALFARGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGEDYIRITPPLTLQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYF  L + S
Sbjct: 376 FAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFGQLARIS 424



>gb:AE013881_301077 Yersinia pestis KIM section 281 of 415 of the
           complete genome.>gb:AE009952_931260 Yersinia pestis KIM
           complete genome.
          Length = 443

 Score =  238 bits (608), Expect = 1e-61
 Identities = 122/230 (53%), Positives = 155/230 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  G+ V H +++  F I+GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 221 LHLMKAFGIDVGH-ENYQIFHIKGGQTYRSPGTYLVEGDASSASYFLAAAAIKGGTVRVT 279

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD KFA+VLEKMGA+V+W ++ +           R  L+ ID++MN +PD A
Sbjct: 280 GIGKKSVQGDTKFADVLEKMGAKVTWGDDYIECS--------RGELQGIDMDMNHIPDAA 331

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA GPT IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP +L 
Sbjct: 332 MTIATTALFATGPTTIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDYIRVVPPLQLT 391

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             +I TYDDHRMAM FSL A ++ PVTI DP CT KTFPDYFE   + S+
Sbjct: 392 AADIGTYDDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQFARLSQ 441



>sp|Q60112|AROA_YERPE 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|AH0169|AH0169
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) [imported] - Yersinia pestis (strain
           CO92)>gb:AE017131_387023 Yersinia pestis biovar
           Medievalis str. 91001 section 5 of 16 of the complete
           genome.>gb:AJ414148_523212 Yersinia pestis strain CO92
           complete genome; segment 8/20.>gb:AE017042_1143589
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.
          Length = 428

 Score =  238 bits (608), Expect = 1e-61
 Identities = 122/230 (53%), Positives = 155/230 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  G+ V H +++  F I+GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 206 LHLMKAFGIDVGH-ENYQIFHIKGGQTYRSPGTYLVEGDASSASYFLAAAAIKGGTVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD KFA+VLEKMGA+V+W ++ +           R  L+ ID++MN +PD A
Sbjct: 265 GIGKKSVQGDTKFADVLEKMGAKVTWGDDYIECS--------RGELQGIDMDMNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA GPT IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP +L 
Sbjct: 317 MTIATTALFATGPTTIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDYIRVVPPLQLT 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             +I TYDDHRMAM FSL A ++ PVTI DP CT KTFPDYFE   + S+
Sbjct: 377 AADIGTYDDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQFARLSQ 426



>sp|Q9KRB0|AROA_VIBCH 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|D82163|D82163
           3-phosphoshikimate 1-carboxyvinyltransferase VC1732
           [imported] - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004251_52112 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 159 of 251 of the
           complete chromosome.>gb:AE003852_1052886 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 426

 Score =  238 bits (608), Expect = 1e-61
 Identities = 122/230 (53%), Positives = 156/230 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +ME+ GV V + D +  F+I  GQ Y SPG   VEGDASSASYFL           V 
Sbjct: 206 LHIMEQFGVQVINHD-YQEFVIPAGQSYVSPGQFLVEGDASSASYFLAAAAIKGGEVKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+ LEKMGA++ W ++ V  +        R  L A+D++ N +PD A
Sbjct: 265 GIGKNSIQGDIQFADALEKMGAQIEWGDDYVIAR--------RGELNAVDLDFNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G TAIR+V +WRVKET+R+ A+ TELRK+GATVEEG D+ +ITPP +L 
Sbjct: 317 MTIATTALFAKGTTAIRNVYNWRVKETDRLAAMATELRKVGATVEEGEDFIVITPPTKLI 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              IDTYDDHRMAM FSL A ++ PVTI DP CT KTFPDYF+   + S+
Sbjct: 377 HAAIDTYDDHRMAMCFSLVALSDTPVTINDPKCTSKTFPDYFDKFAQLSR 426



>gb:BX571864_786477 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 6/17.
          Length = 428

 Score =  238 bits (606), Expect = 2e-61
 Identities = 125/230 (54%), Positives = 157/230 (68%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  G+++ H D +  F I+G Q+Y SPG+  VEGDASSASYFL           V 
Sbjct: 205 LALMKSFGITINH-DQYQIFHIKGRQQYVSPGHYLVEGDASSASYFLAAAAIKGGTVRVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +SLQGD KFA VLEKMGA++ W ++ V  +        R  L  ID++MN++PD A
Sbjct: 264 GIGKNSLQGDTKFANVLEKMGAKIRWGDDFVECE--------RGTLTGIDMDMNEIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP RL 
Sbjct: 316 MTIATTALFAAGETVIRNIYNWRVKETDRLHAMATELRKVGAEVEEGVDYIRITPPPRLL 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EI TY+DHRMAM FSL A ++ PVTI DPGCT KTFPDYF  L++ S+
Sbjct: 376 PAEIGTYNDHRMAMCFSLVALSDTPVTILDPGCTAKTFPDYFNQLERLSQ 425



>gb:YEPAROA_211196 Yersinia pestis
           5-enolpyruvylshikimate-3-phosphate synthetase (aroA)
           gene, complete cds.
          Length = 424

 Score =  237 bits (604), Expect = 3e-61
 Identities = 121/223 (54%), Positives = 152/223 (68%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  G+ V H +++  F I+GGQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 206 LHLMKAFGIDVGH-ENYQIFHIKGGQTYRSPGTYLVEGDASSASYFLAAAAIKGGTVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD KFA+VLEKMGA+V+W ++ +           R  L+ ID++MN +PD A
Sbjct: 265 GIGKKSVQGDTKFADVLEKMGAKVTWGDDYIECS--------RGELQGIDMDMNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA GPT IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP +L 
Sbjct: 317 MTIATTALFATGPTTIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDYIRVVPPLQLT 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
             +I TYDDHRMAM FSL A ++ PVTI DP CT KTFPDYFE
Sbjct: 377 AADIGTYDDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFE 419



>gb:CR378671_95812 Photobacterium profundum SS9; segment 9/12.
          Length = 428

 Score =  235 bits (600), Expect = 8e-61
 Identities = 122/230 (53%), Positives = 154/230 (66%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M + GV+VE+ D +  F I  GQ Y+  G+  VEGDASSASYFL           V 
Sbjct: 206 LHIMAQFGVTVENRD-YQEFFIPAGQTYQGAGDFLVEGDASSASYFLAAAAIKGGEVKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDV+FA  LE MGAE+ W +N V  +        R  L+A+D++ N +PD A
Sbjct: 265 GIGKKSIQGDVQFAHALEMMGAEIEWGDNYVIAR--------RGELKAVDMDFNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+AV ALFA+G T+IR+V +WRVKET+R+ A+ TELRK+GA VEEG DY  I PP +L 
Sbjct: 317 MTIAVAALFAEGTTSIRNVYNWRVKETDRLAAMATELRKVGAKVEEGNDYITIVPPTQLQ 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              IDTYDDHRMAM FSL A ++ PVTI DP CT KTFPDYF+ L + S+
Sbjct: 377 HATIDTYDDHRMAMCFSLVALSDTPVTINDPKCTSKTFPDYFDKLAELSQ 426



>gb:CP000026_76619 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 427

 Score =  235 bits (599), Expect = 1e-60
 Identities = 119/229 (51%), Positives = 156/229 (68%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV + +   + +F+++GGQ+Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIANHH-YQQFVVKGGQQYHSPGRYLVEGDASSASYFLAAGAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA+VLEKMGA ++W ++ +           R  L AID++MN +PD A
Sbjct: 264 GIGRKSMQGDIRFADVLEKMGATITWGDDFIACT--------RGELHAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP +L+
Sbjct: 316 MTIATTALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPAKLH 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             +I TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S
Sbjct: 376 HADIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARMS 424



>pir|A22566|XUEBVS 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Salmonella typhimurium>gb:STSERCARO_193646
           S.typhimurium serC and aroA genes.>gb:STYAROAPM_194183
           S.typhimurium aroA locus
           5-enolpyruvylshikimate-3-phosphate synthase (aroA
           protein) gene, complete cds.
          Length = 427

 Score =  234 bits (598), Expect = 1e-60
 Identities = 119/229 (51%), Positives = 155/229 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV + +   + +F+++GGQ+Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIANHH-YQQFVVKGGQQYHSPGRYLVEGDASSASYFLAAGAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA+VLEKMGA ++W ++ +           R  L AID++MN +PD A
Sbjct: 264 GIGRKSMQGDIRFADVLEKMGATITWGDDFIACT--------RGELHAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP +L 
Sbjct: 316 MTIATTALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPAKLQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             +I TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S
Sbjct: 376 HADIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARMS 424



>sp|P07637|AROA_SALTY 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE008742_242684
           Salmonella typhimurium LT2, section 48 of 220 of the
           complete genome.>gb:AE006468_999766 Salmonella
           typhimurium LT2, complete genome.
          Length = 427

 Score =  234 bits (598), Expect = 1e-60
 Identities = 119/229 (51%), Positives = 155/229 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV + +   + +F+++GGQ+Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIANHH-YQQFVVKGGQQYHSPGRYLVEGDASSASYFLAAGAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA+VLEKMGA ++W ++ +           R  L AID++MN +PD A
Sbjct: 264 GIGRKSMQGDIRFADVLEKMGATITWGDDFIACT--------RGELHAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP +L 
Sbjct: 316 MTIATTALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPAKLQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             +I TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S
Sbjct: 376 HADIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARMS 424



>sp|P19786|AROA_SALTI 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|AH0613|AH0613
           3-phosphoshikimate 1-carboxyvinyltransferase [imported]
           - Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016840_346037 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 7 of 16 of
           the complete genome.>gb:AL627268_541223 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 4/20.>gb:AE014613_983369
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 427

 Score =  234 bits (598), Expect = 1e-60
 Identities = 119/229 (51%), Positives = 155/229 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV + +   + +F+++GGQ+Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIANHH-YQQFVVKGGQQYHSPGRYLVEGDASSASYFLAAGAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA+VLEKMGA ++W ++ +           R  L AID++MN +PD A
Sbjct: 264 GIGRKSMQGDIRFADVLEKMGATITWGDDFIACT--------RGELHAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP +L 
Sbjct: 316 MTIATTALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPAKLQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             +I TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S
Sbjct: 376 HADIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARMS 424



>sp|P22299|AROA_SALGL 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|A49746|A49746
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Salmonella gallinarum>gb:STYSERARO_194955
           Salmonella gallinarum 3-phosphoserine aminotransferase
           (serC) and 5-enolpyruvylshikimate 3-phosphate synthase
           (aroA) genes, complete cds.
          Length = 427

 Score =  234 bits (598), Expect = 1e-60
 Identities = 119/229 (51%), Positives = 155/229 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV + +   + +F+++GGQ+Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIANHH-YQQFVVKGGQQYHSPGRYLVEGDASSASYFLAAGAIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA+VLEKMGA ++W ++ +           R  L AID++MN +PD A
Sbjct: 264 GIGRKSMQGDIRFADVLEKMGATITWGDDFIACT--------RGELHAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP +L 
Sbjct: 316 MTIATTALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPAKLQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             +I TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S
Sbjct: 376 HADIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARMS 424



>gb:CP000010_864857 Burkholderia mallei ATCC 23344 chromosome 1,
            complete sequence.
          Length = 673

 Score =  234 bits (596), Expect = 2e-60
 Identities = 123/226 (54%), Positives = 153/226 (67%), Gaps = 3/226 (1%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
            +KLM R GV+VE  D W RF +  G +Y+SPG   VEGDASSASYFL           VE
Sbjct: 446  IKLMARFGVTVER-DGWQRFTVPAGVRYRSPGTIMVEGDASSASYFLAAGALGGGPLRVE 504

Query: 731  GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKH--LRAIDVNMNKMPD 558
            G G +S+QGDV FA  L +MGA V+  ++ + V+G      G  H  L  ID++ N +PD
Sbjct: 505  GVGRASIQGDVGFANALMQMGANVTMGDDWIEVRG-----IGHDHGRLAPIDMDFNLIPD 559

Query: 557  VAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPER 378
             AMT+AV ALFADGP+ +R++ SWRVKET+R+ A+ TELRK+GATVEEG DY ++TPP +
Sbjct: 560  AAMTIAVAALFADGPSTLRNIGSWRVKETDRIAAMATELRKVGATVEEGADYLVVTPPAQ 619

Query: 377  LNV-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
            L     IDTYDDHRMAM FSL +   VPV I DP C  KTFPDYF+
Sbjct: 620  LTPNASIDTYDDHRMAMCFSLVSLGGVPVRINDPKCVGKTFPDYFD 665



>gb:BX571965_792312 Burkholderia pseudomallei strain K96243,
            chromosome 1, complete sequence.
          Length = 753

 Score =  234 bits (596), Expect = 2e-60
 Identities = 123/226 (54%), Positives = 153/226 (67%), Gaps = 3/226 (1%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
            +KLM R GV+VE  D W RF +  G +Y+SPG   VEGDASSASYFL           VE
Sbjct: 526  IKLMARFGVTVER-DGWQRFTVPAGVRYRSPGTIMVEGDASSASYFLAAGALGGGPLRVE 584

Query: 731  GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKH--LRAIDVNMNKMPD 558
            G G +S+QGDV FA  L +MGA V+  ++ + V+G      G  H  L  ID++ N +PD
Sbjct: 585  GVGRASIQGDVGFANALMQMGANVTMGDDWIEVRG-----IGHDHGRLAPIDMDFNLIPD 639

Query: 557  VAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPER 378
             AMT+AV ALFADGP+ +R++ SWRVKET+R+ A+ TELRK+GATVEEG DY ++TPP +
Sbjct: 640  AAMTIAVAALFADGPSTLRNIGSWRVKETDRIAAMATELRKVGATVEEGADYLVVTPPAQ 699

Query: 377  LNV-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
            L     IDTYDDHRMAM FSL +   VPV I DP C  KTFPDYF+
Sbjct: 700  LTPNASIDTYDDHRMAMCFSLVSLGGVPVRINDPKCVGKTFPDYFD 745



>sp|Q93ED4|AROA_YERRU 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AF360730_504824
           Yersinia ruckeri 5-enolpyruvylshikimate-3-phosphate
           synthase (aroA) gene, complete cds.
          Length = 427

 Score =  233 bits (595), Expect = 3e-60
 Identities = 124/229 (54%), Positives = 149/229 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM   GV V H + +  F I+GGQ Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LHLMRSFGVEVTHQN-YQVFHIQGGQTYHSPGEYLVEGDASSASYFLAAAAIKGGTVRVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD KFA+VLEKMGA + W ++ +           R  LR ID++MN +PD A
Sbjct: 264 GIGKKSVQGDTKFADVLEKMGAIIHWGDDYIECS--------RGELRDIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA GPT IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP  L 
Sbjct: 316 MTIATAALFAKGPTIIRNIYNWRVKETDRLSAMATELRKVGAEVEEGQDYIRVVPPAHLI 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S
Sbjct: 376 AAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARLS 424



>gb:BX950851_841329 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 429

 Score =  233 bits (594), Expect = 4e-60
 Identities = 121/231 (52%), Positives = 157/231 (67%), Gaps = 1/231 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M+  G+ V H +++ RF + G Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 206 LHMMKAFGIDVRH-ENYQRFFVAGRQQYRSPGDYLVEGDASSASYFLAAAAIKGGVVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA V W E+ +  +        R  L AID++MN +PD A
Sbjct: 265 GVGRNSVQGDIRFADVLEKMGAIVRWGEDYIECE--------RGELHAIDMDMNHIPDAA 316

Query: 551 MTLAVVALFADG-PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERL 375
           MT+A  ALFA G  T +R++ +WRVKET+R+ A+  ELRK+GA VEEG DY  ITPP +L
Sbjct: 317 MTIATAALFAQGGTTTLRNIYNWRVKETDRLAAMAIELRKVGAEVEEGNDYIRITPPAKL 376

Query: 374 NVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              EI TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 377 KAAEIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARLSE 427



>gb:BA000037_723144 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 428

 Score =  233 bits (594), Expect = 4e-60
 Identities = 122/230 (53%), Positives = 156/230 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M++ GV V ++ ++  F+I  GQ Y SPG   VEGDASSASYFL           V 
Sbjct: 206 LHIMKQFGVDVVNN-AYQEFIIPAGQSYVSPGQFLVEGDASSASYFLAAAAIKGGEIKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD+ FA+ LEKMGAE+ W E+ V  +       GR  L+ ID++ N +PD A
Sbjct: 265 GIGKNSIQGDIHFADALEKMGAEIEWGEDYVISR------VGR--LKGIDMDYNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G TAIR+V +WRVKET+R+ A+ TELRK+GA VEEG DY I+ PP++L 
Sbjct: 317 MTIATTALFAQGTTAIRNVYNWRVKETDRLSAMATELRKVGAEVEEGEDYLIVNPPQQLT 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              IDTYDDHR+AM FSL A ++ PVTI DP CT KTFPDYF+ L   S+
Sbjct: 377 HAAIDTYDDHRIAMCFSLVALSDTPVTINDPKCTSKTFPDYFDKLASLSE 426



>gb:AE016804_336767 Vibrio vulnificus CMCP6 chromosome I section 8
           of 11 of the complete sequence.>gb:AE016795_1046491
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 376

 Score =  233 bits (594), Expect = 4e-60
 Identities = 122/230 (53%), Positives = 156/230 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M++ GV V ++ ++  F+I  GQ Y SPG   VEGDASSASYFL           V 
Sbjct: 154 LHIMKQFGVDVVNN-AYQEFIIPAGQSYVSPGQFLVEGDASSASYFLAAAAIKGGEIKVT 212

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD+ FA+ LEKMGAE+ W E+ V  +       GR  L+ ID++ N +PD A
Sbjct: 213 GIGKNSIQGDIHFADALEKMGAEIEWGEDYVISR------VGR--LKGIDMDYNHIPDAA 264

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G TAIR+V +WRVKET+R+ A+ TELRK+GA VEEG DY I+ PP++L 
Sbjct: 265 MTIATTALFAQGTTAIRNVYNWRVKETDRLSAMATELRKVGAEVEEGEDYLIVNPPQQLR 324

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              IDTYDDHR+AM FSL A ++ PVTI DP CT KTFPDYF+ L   S+
Sbjct: 325 HAAIDTYDDHRIAMCFSLVALSDTPVTINDPKCTSKTFPDYFDKLASLSE 374



>sp|Q8RLV9|AROA_XENNE 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AY077462_587829
           Xenorhabdus nematophila strain ATCC 19061 phosphoserine
           aminotransferase (serC) and 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) genes, complete cds.
          Length = 428

 Score =  232 bits (592), Expect = 7e-60
 Identities = 123/231 (53%), Positives = 155/231 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV+VE+   +  F IRG Q+Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LALMKSFGVTVENHQ-YQVFYIRGRQQYLSPGQYLVEGDASSASYFLAAAAIKGGIVRVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +SLQGD KFA VLE+MGA + W ++ V  +        R  L  ID++MN +PD A
Sbjct: 264 GIGKNSLQGDTKFANVLEQMGATIRWGDDFVECE--------RGTLTGIDMDMNAIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PPE++ 
Sbjct: 316 MTIATTALFAQGETVIRNIYNWRVKETDRLNAMATELRKVGAEVEEGLDYIRVIPPEKIQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EI+TY+DHR+AM FSL A +  PVTI DPGCT KTFPDYF  L+K S++
Sbjct: 376 HAEIETYNDHRVAMCFSLVALSNTPVTILDPGCTAKTFPDYFNQLKKLSEY 426



>pir|S12096|S12096 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Salmonella typhi>gb:ST5E3PS_192021 S.typhi
           gene for 5-enolpyruvylshikimate 3-phosphate synthase (EC
           2.5.1.19).
          Length = 427

 Score =  232 bits (591), Expect = 9e-60
 Identities = 118/229 (51%), Positives = 154/229 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV + +   + +F+++GGQ+Y SPG   VEGDASSASYFL           V 
Sbjct: 205 LNLMKTFGVEIANHH-YQQFVVKGGQQYHSPGRYLVEGDASSASYFLAAGGIKGGTVKVT 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA+VL KMGA ++W ++ +           R  L AID++MN +PD A
Sbjct: 264 GIGGKSMQGDIRFADVLHKMGATITWGDDFIACT--------RGELHAIDMDMNHIPDAA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T +R++ +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP +L 
Sbjct: 316 MTIATTALFAKGTTTLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYIRITPPAKLQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             +I TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S
Sbjct: 376 HADIGTYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARMS 424



>gb:CR555306_105895 Azoarcus sp. EbN1 complete genome.
          Length = 646

 Score =  231 bits (590), Expect = 1e-59
 Identities = 121/230 (52%), Positives = 152/230 (66%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GV V+  + W RF + GG +Y+SPG  FVEGDASSASYFL           VE
Sbjct: 208 LDLMARFGVEVQR-EGWTRFTVPGGARYRSPGTLFVEGDASSASYFLAAGAIGGGPVRVE 266

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G SS+QGDV+FAE L ++GA V   +N +  + P    SGR  L+A D+++N +PD A
Sbjct: 267 GVGRSSIQGDVRFAEALAELGARVDIGDNWIEARAPE---SGR--LKAFDLDLNHIPDAA 321

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAV ALFADGP  +R++ASWRVKET+R+ A+  ELRK+GA VEEG D+  +TPP +L 
Sbjct: 322 MTLAVAALFADGPCTLRNIASWRVKETDRIAAMAKELRKVGAAVEEGADFLRVTPPAKLV 381

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              IDTYDDHRMAM FSL +     V I +P C  KTFP YFE     ++
Sbjct: 382 PAAIDTYDDHRMAMCFSLVSLGGCRVRINEPKCVNKTFPTYFECFASITR 431



>sp|Q8VP65|AROA_PASPI 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AY066024_587649
           Photobacterium damselae subsp. piscicida
           5-enolpyruvoylshikimate-3-phosphate synthase (aroA)
           gene, complete cds.
          Length = 426

 Score =  231 bits (590), Expect = 1e-59
 Identities = 119/230 (51%), Positives = 154/230 (66%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M + GV VE+ + + +F++  GQ Y+SPG   VEGDASSASYFL           V 
Sbjct: 206 LNIMAQFGVQVENQN-YQKFIVPAGQVYQSPGEFLVEGDASSASYFLAAGAIKGGEVKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+ LE MGAE+ W E+ +  +         + L AID++ N +PD A
Sbjct: 265 GIGKNSIQGDIQFADALEAMGAEIEWGEDYIIAR--------HRQLNAIDMDFNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T+IR+V +WRVKET+R+ A+ TELRKLGA VEEG DY  IT P +L 
Sbjct: 317 MTIATAALFAPGTTSIRNVYNWRVKETDRLHAMATELRKLGAEVEEGDDYITITSPTQLK 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              IDTYDDHRMAM FSL A ++  VTI DP CT KTFPDYF  L++ S+
Sbjct: 377 HVAIDTYDDHRMAMCFSLVALSDTAVTINDPKCTSKTFPDYFTKLEQLSR 426



>sp|Q8EEH8|AROA_SHEON 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE015681_316777
           Shewanella oneidensis MR-1 section 230 of 457 of the
           complete genome.>gb:AE014299_952374 Shewanella
           oneidensis MR-1 complete genome.
          Length = 426

 Score =  230 bits (587), Expect = 3e-59
 Identities = 120/222 (54%), Positives = 149/222 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM + GV V +   + RF I  GQ Y SPG   VEGDASSASYFL           V 
Sbjct: 206 LALMAQFGVKVINHH-YARFEIPAGQHYVSPGKVLVEGDASSASYFLAAGAIKGGEVKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDVKFA+VLEKMGA++ W ++ +  +G P        L A+D++MN +PD A
Sbjct: 265 GVGRLSIQGDVKFADVLEKMGADIEWGDDYIIARGAP--------LTAVDLDMNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T IR++ +WR+KET+R+ A+ TELRK+GA VEEG DY  ITPP  LN
Sbjct: 317 MTIATAALFAKGTTVIRNIYNWRIKETDRLAAMATELRKVGAEVEEGNDYIKITPPAVLN 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF 246
             +IDTY+DHRMAM FS+ A A+  +TI DP CT KTFPDYF
Sbjct: 377 TAQIDTYNDHRMAMCFSMLAFADCGITINDPDCTSKTFPDYF 418



>gb:CP000020_871937 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 426

 Score =  228 bits (582), Expect = 1e-58
 Identities = 117/229 (51%), Positives = 150/229 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV +E+ + +  F++   Q Y +PG+  VEGDASSASYFL           V 
Sbjct: 206 LDIMATFGVKIENQN-YQTFVVPANQTYVAPGDFLVEGDASSASYFLAAAAIKGGEVKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDV+FA+ L  MG E+ W ++ V  +        +  L AID++ N +PD A
Sbjct: 265 GIGKKSIQGDVQFADALAAMGTEIEWGDDYVIAR--------KGELNAIDMDFNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA G T+IR+V +WRVKET+R+ A+ TELRK+GA VEEG DY  ITPP  L 
Sbjct: 317 MTIATAALFAKGTTSIRNVYNWRVKETDRLAAMATELRKVGAVVEEGEDYITITPPASLQ 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
              IDTYDDHRMAM FSL A ++ PVTI DPGCT KTFPDYF+ L++ S
Sbjct: 377 HASIDTYDDHRMAMCFSLVALSDTPVTINDPGCTSKTFPDYFDKLKELS 425



>sp|Q87QX9|AROA_VIBPA 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:BA000031_706480
           Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1,
           complete sequence.
          Length = 426

 Score =  228 bits (582), Expect = 1e-58
 Identities = 120/229 (52%), Positives = 154/229 (67%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M++ GV V ++D +  F+I  GQ Y +PG+  VEGDASSASYFL           V 
Sbjct: 206 LHIMKQFGVEVINND-YQEFVIPAGQHYVAPGDFLVEGDASSASYFLAAAAIKGGEVKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+ LEKMGAE+ W ++ V         S    L+ ID++ N +PD A
Sbjct: 265 GIGKNSIQGDIQFADALEKMGAEIEWGDDYVI--------SRVGKLKGIDMDYNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA+G TAIR+V +WRVKET+R+ A+ TELRK+GA VEEG DY I+ P   L 
Sbjct: 317 MTIATTALFAEGTTAIRNVYNWRVKETDRLSAMATELRKVGAEVEEGEDYIIVKPVPHLK 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
              IDTYDDHRMAM FSL A ++ PVTI DP CT KTFPDYF+ L+  S
Sbjct: 377 HAAIDTYDDHRMAMCFSLLALSDTPVTINDPKCTSKTFPDYFDKLKALS 425



>sp|Q8Y0Y6|AROA_RALSO 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AL646061_545835
           Ralstonia solanacearum GMI1000 chromosome, complete
           sequence; segment 5/19.
          Length = 436

 Score =  226 bits (577), Expect = 4e-58
 Identities = 123/224 (54%), Positives = 148/224 (66%), Gaps = 2/224 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GV VE +  W  F +  G  Y++PG  FVEGDASSASYFL           VE
Sbjct: 209 LNLMARFGVQVERN-GWASFSVPTGVAYRAPGEIFVEGDASSASYFLAAGALGGGPVRVE 267

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G SS+QGDV+FA+ L +MGA V   +N + V+G  R   G+ H  A++++ N +PD A
Sbjct: 268 GVGMSSIQGDVRFADALNRMGANVMAGDNWIEVRGVER-DDGKLH--ALELDCNHIPDAA 324

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLAV ALFADG T + ++ SWRVKET+R+ A+ TELRKLGA VEEG DY  +TPP    
Sbjct: 325 MTLAVAALFADGTTTLTNIGSWRVKETDRLTAMATELRKLGAAVEEGTDYIRVTPPSHWT 384

Query: 371 VTE--IDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF 246
                IDTYDDHRMAMAFSLAA   VPV I DP C  KTFP+YF
Sbjct: 385 APAGGIDTYDDHRMAMAFSLAAFGPVPVRINDPRCVAKTFPEYF 428



>sp|Q9X4H2|AROA_EDWIC 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AF110153_479847
           Edwardsiella ictaluri phosphoserine transaminase (serC)
           gene, partial cds; and
           5-enolpyruvoylshikimate-3-phosphate synthase (aroA)
           gene, complete cds.
          Length = 428

 Score =  226 bits (575), Expect = 6e-58
 Identities = 115/222 (51%), Positives = 148/222 (66%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV VE+  ++  F++RGGQ Y++P +  VEGDASSASYFL           V 
Sbjct: 206 LAMMRAFGVEVENH-AYRHFVVRGGQVYQAPSDYLVEGDASSASYFLAGAAIAGGTVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD+ FA+VLEKMGA+V W  + +           R  L  ID++MN +PD A
Sbjct: 265 GIGRHSMQGDIHFADVLEKMGAQVEWGNDYIACT--------RDSLHGIDMDMNAIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA GPT +R++ +WRVKET+R+ A+ +ELRK+GA VEEG D+  I PP +L 
Sbjct: 317 MTIATTALFAKGPTTLRNIYNWRVKETDRLAAMASELRKVGAVVEEGTDFLRIEPPAQLQ 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF 246
             +I TY+DHRMAM FSL A +  PVTI DPGCT KTFPDYF
Sbjct: 377 AAQIATYNDHRMAMCFSLVALSGTPVTICDPGCTAKTFPDYF 418



>gb:AY324880_1599514 Oryza sativa (japonica cultivar-group) putative
           EPSP1 mRNA, partial cds.
          Length = 331

 Score =  221 bits (563), Expect = 2e-56
 Identities = 107/138 (77%), Positives = 118/138 (85%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+LMER GV  EHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFL           V+
Sbjct: 161 LRLMERFGVKAEHSDSWDRFYIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVQ 220

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           GCGT+SLQGDVKFAEVLE MGA+V+WT+ SVTV GPPR P G+KHL+A+DVNMNKMPDVA
Sbjct: 221 GCGTTSLQGDVKFAEVLEMMGAKVTWTDTSVTVTGPPREPYGKKHLKAVDVNMNKMPDVA 280

Query: 551 MTLAVVALFADGPTAIRD 498
           MTLAVVALFADGPTAIRD
Sbjct: 281 MTLAVVALFADGPTAIRD 298



>sp|P57396|AROA_BUCAI 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|C84966|C84966
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653673 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 427

 Score =  216 bits (549), Expect = 7e-55
 Identities = 112/230 (48%), Positives = 152/230 (66%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L L++  GV++EH DS++ F I+G Q+YK+PG   +EGDASSASYFL           V 
Sbjct: 206 LNLIKIFGVNIEH-DSYNVFYIKGKQQYKTPGKYTIEGDASSASYFLAAAAIKGGSIKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA +LEKMGA + W + S+T          R  L AID++MN +PD A
Sbjct: 265 GVGKKSIQGDIEFANILEKMGATIFWEDYSITCT--------RNKLNAIDLDMNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A++ALF+ G T IR++ +WRVKET+R+ A+  ELRK+GA VEEG D+  I+PP    
Sbjct: 317 MTVAILALFSKGTTIIRNIYNWRVKETDRLSAMTIELRKIGAIVEEGRDFLSISPPIFFQ 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            + I+TY+DHRMAM FSL + + V V I +P C  KTFP YF+     SK
Sbjct: 377 YSSIETYNDHRMAMCFSLISLSGVGVNILNPNCISKTFPSYFKDFLSISK 426



>gb:BX321862_774292 Nitrosomonas europaea ATCC 19718, complete
           genome; segment 7/10.
          Length = 431

 Score =  215 bits (548), Expect = 9e-55
 Identities = 124/239 (51%), Positives = 151/239 (63%), Gaps = 6/239 (2%)
 Frame = -2

Query: 902 MERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCG 723
           M R GV V+  +SW RF++   Q Y+SPG   VEGDASSASYFL           +EG G
Sbjct: 207 MARFGVQVKQ-ESWQRFMLPENQTYRSPGKIAVEGDASSASYFLAAGAIAGGPVRIEGAG 265

Query: 722 TSSLQGDVKFAEVLEKMGAEVS----WTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDV 555
           + S QGD++F E LE MGA +S    W E+         AP G   L+AID + N +PD 
Sbjct: 266 SDSCQGDIRFVEALEAMGARISMGSDWIESG--------APDGGA-LKAIDFDCNHIPDA 316

Query: 554 AMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERL 375
           AMTLA +ALFA G T +R++ASWRVKET+R+ A+  ELRKLGA VE G D+  ITPP+  
Sbjct: 317 AMTLATMALFARGTTTLRNIASWRVKETDRIAAMSAELRKLGARVEAGDDFLRITPPDGP 376

Query: 374 NVTE--IDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH*RFPF 204
              +  IDTYDDHRMAM FSL + + VPV I DPGC  KTFPDYFE   KF+     PF
Sbjct: 377 LTADAVIDTYDDHRMAMCFSLVSLS-VPVRINDPGCVAKTFPDYFE---KFAAITHTPF 431



>gb:AE017340_457119 Idiomarina loihiensis L2TR, complete genome.
          Length = 429

 Score =  214 bits (544), Expect = 3e-54
 Identities = 114/222 (51%), Positives = 151/222 (68%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+++   G+S++  DS   + I GGQ Y+SPG  +VEGDAS+ASY++           + 
Sbjct: 207 LQMLSDFGISIKE-DSPQCYAIPGGQCYQSPGEYWVEGDASAASYWMAAALLGKGPVEII 265

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD +FAEV+E MGA VS+ +NS+TV       SG   ++ ID + N +PD A
Sbjct: 266 GVGKNSIQGDKRFAEVIEAMGASVSYRKNSMTV-------SGTGSVQGIDQDFNDIPDAA 318

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A +ALFA+ PT IR+VA+WRVKET+R+ A+ TELRKLGATV+EG D+  I P +   
Sbjct: 319 MTVAPLALFANKPTTIRNVANWRVKETDRLHAMATELRKLGATVDEGEDFLRIEPLKHWR 378

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF 246
              IDTYDDHRMAM FSL A +   VTI DPGC  KT+PDYF
Sbjct: 379 HIAIDTYDDHRMAMCFSLVAFSSAGVTINDPGCCAKTYPDYF 420



>sp|Q59178|AROA_BUCAP 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE014106_303215
           Buchnera aphidicola str. Sg (Schizaphis graminum)
           section 31 of 57 of the complete
           genome.>gb:BUHTPIA_757299 Buchnera aphidicola
           aspartyl-tRNA synthetase (aspS), thioredoxin reductase
           (trxB), seryl-tRNA synthase (serS), phosphoserine
           aminotransferase (serC),
           3-enolpyruvylshikimate-5-phosphate synthetase (aroA),
           ribosomal protein S1 (rpsA), integration host factor
           beta subunit (himD), and triosephosphate isomerase
           (tpiA) genes, complete cds.>gb:AE013218_935193 Buchnera
           aphidicola str. Sg (Schizaphis graminum) complete
           genome.
          Length = 428

 Score =  214 bits (544), Expect = 3e-54
 Identities = 111/230 (48%), Positives = 148/230 (64%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV++ + D +  F I+G QKY+SPGN  VEGDASSASYFL           V 
Sbjct: 206 LNLMKSFGVNIVN-DCYKSFYIKGNQKYESPGNYLVEGDASSASYFLAAAAIKGGSVKVV 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD+KFA+VLEKMGA + W ++ +  +           L  ID++MN +PD A
Sbjct: 265 GVGKKSVQGDIKFADVLEKMGAIIDWGDSFIVCR--------HNKLEKIDLDMNHIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A+VALFA G + I+++ +WRVKET+R+ A+  EL+K+GA ++EG D   ITPP    
Sbjct: 317 MTIAIVALFAKGTSIIKNIYNWRVKETDRLSAMSKELKKVGAIIKEGRDCLSITPPNFFK 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             EIDTY+DHRMAM FSL   + + V I +P C  KTFP YFE   K S+
Sbjct: 377 FAEIDTYNDHRMAMCFSLICLSGISVRILNPNCISKTFPSYFENFLKISR 426



>sp|P54220|AROA_PASHA 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:PHU89948_158522
           Pasteurella haemolytica serotype 2 aroA gene, complete
           cds.
          Length = 432

 Score =  210 bits (534), Expect = 4e-53
 Identities = 115/232 (49%), Positives = 150/232 (64%), Gaps = 3/232 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSP-GNAFVEGDASSASYFLXXXXXXXXXXXV 735
           L +M   G++VE+ D +  FL++G Q Y +P GN  VEGDASSASYFL            
Sbjct: 209 LSMMNDFGITVENRD-YKTFLVKGKQGYVAPQGNYLVEGDASSASYFLASGAIKGKVKVT 267

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDV 555
            G G  S+QGD  FA+VLEKMGA+++W E+ +  +  P        L+ +D++MN +PD 
Sbjct: 268 -GIGKKSIQGDRLFADVLEKMGAKITWGEDFIQAEQSP--------LKGVDMDMNHIPDA 318

Query: 554 AMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP--PE 381
           AMT+A  ALFA+G T IR++ +WRVKET+R+ A+ TELRK+GA VEEG D+  I P   E
Sbjct: 319 AMTIATTALFAEGETVIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDFIRIQPLALE 378

Query: 380 RLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
                EI+TY+DHRMAM FSL A +   VTI DP CT KTFP YF  L+K S
Sbjct: 379 NFQHAEIETYNDHRMAMCFSLIALSNTEVTILDPNCTAKTFPTYFRELEKLS 430



>sp|Q04570|AROA_PASMU 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE006122_215727
           Pasteurella multocida subsp. multocida str. Pm70 section
           89 of 204 of the complete genome.>gb:AE004439_1118457
           Pasteurella multocida subsp. multocida str. Pm70,
           complete genome.
          Length = 440

 Score =  209 bits (533), Expect = 5e-53
 Identities = 110/231 (47%), Positives = 154/231 (66%), Gaps = 2/231 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LK+M+  GV VE+  ++ RFL++G Q+Y+SP    VEGDASSASYFL             
Sbjct: 216 LKMMQTFGVEVENQ-AYQRFLVKGHQQYQSPHRFLVEGDASSASYFLAAAAIKGKVKVT- 273

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA+VLEKMGA ++W ++ + V+        + +L+ ID++MN +PD A
Sbjct: 274 GVGKNSIQGDRLFADVLEKMGAHITWGDDFIQVE--------KGNLKGIDMDMNHIPDAA 325

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE--R 378
           MT+A  ALFA+G T IR++ +WRVKET+R+ A+ TELRK+GA VEEG D+  I P    +
Sbjct: 326 MTIATTALFAEGETVIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDFIRIQPLNLAQ 385

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
               EI+TY+DHRMAM F+L A ++  VTI DP CT KTFP +F+   + +
Sbjct: 386 FQHAEIETYNDHRMAMCFALIALSQTSVTILDPSCTAKTFPTFFDTFLRLT 436



>sp|P52310|AROA_HAESO 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:HEA3P1C_136736
           Haemophilus somnus 3-phosphoshikimate
           1-carboxyvinyltransferase gene, complete cds.
          Length = 432

 Score =  206 bits (525), Expect = 4e-52
 Identities = 112/231 (48%), Positives = 151/231 (65%), Gaps = 2/231 (0%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
           +M+  G++V+  + + RFLI+G Q Y SP    VEGDASSASYFL             G 
Sbjct: 211 MMKDFGINVDDYN-YQRFLIKGKQYYISPQTYLVEGDASSASYFLAAAAIKGKVKVT-GI 268

Query: 725 GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMT 546
           G +S+QGD  FA+VL +MGA+V+W E+ + V+        +  L+ ID++MN +PD AMT
Sbjct: 269 GRNSIQGDRLFADVLAQMGAKVTWGEDFIQVE--------KSELKGIDMDMNHIPDAAMT 320

Query: 545 LAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP--PERLN 372
           +A+ ALFA G T IR++ +WRVKET+R+ A+ TELRKLGA VEEG D+  I P   ++  
Sbjct: 321 IAITALFAQGETVIRNIYNWRVKETDRLTAIATELRKLGAEVEEGEDFIRIQPLALDKFK 380

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             EI TY+DHR+AM FSL A ++  VTI DP CT KTFP YF   +K SK+
Sbjct: 381 HAEIATYNDHRIAMCFSLIALSDTSVTILDPACTAKTFPTYFSEFEKISKN 431



>gb:AE016827_343204 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 433

 Score =  204 bits (520), Expect = 2e-51
 Identities = 109/225 (48%), Positives = 148/225 (65%), Gaps = 2/225 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M+   V V++ + + RF+++G Q+Y+SP    VEGDASSASYFL             
Sbjct: 211 LNMMKIFAVDVDNQN-YQRFVVKGNQQYQSPNIFLVEGDASSASYFLAAGAIKGKVRVT- 268

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FAEVLEKMGA+++W E+ +  +        R  L  ID++MN +PD A
Sbjct: 269 GVGKNSIQGDRLFAEVLEKMGAKITWGEDYIEAE--------RGELNGIDMDMNHIPDAA 320

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP--ER 378
           MT+A  ALFA G T IR++ +WRVKET+R+ A+ TELRK+GA VEEG D+  I PP  ++
Sbjct: 321 MTIATTALFAQGETVIRNIYNWRVKETDRLSAMATELRKVGAEVEEGEDFIRIQPPASDQ 380

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
               EI+TY+DHRMAM F+L A +   VTI DP CT KTFP +F+
Sbjct: 381 FKHAEIETYNDHRMAMCFALVALSNTAVTICDPKCTAKTFPTFFD 425



>gb:PHU03068_158475 Pasteurella haemolytica NADC-D60
           5-enolpyruvylshikimate 3-phosphate synthase (aroA) gene,
           complete cds.
          Length = 434

 Score =  204 bits (520), Expect = 2e-51
 Identities = 115/235 (48%), Positives = 150/235 (63%), Gaps = 6/235 (2%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSP-GNAFVEGDASSASYFLXXXXXXXXXXXV 735
           L +M   G++VE+ D +  FL++G Q Y +P GN  VEGDASSASYFL            
Sbjct: 209 LSMMNDFGITVENRD-YKTFLVKGKQGYVAPQGNYLVEGDASSASYFLASGAIKAGKVT- 266

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDV 555
            G G  S+QGD  FA+VLEKMGA+++W E+ +  +  P        L+ +D++MN +PD 
Sbjct: 267 -GIGKKSIQGDRLFADVLEKMGAKITWGEDFIQAEQSP--------LKGVDMDMNHIPDA 317

Query: 554 AMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATV---EEGPDYCIITP- 387
           AMT+A  ALFA+G T IR++ +WRVKET+R+ A+ TELRK+GA V   EEG D+  I P 
Sbjct: 318 AMTIATTALFAEGETVIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEEGEDFIRIQPL 377

Query: 386 -PERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
             E     EI+TY+DHRMAM FSL A +   VTI DP CT KTFP YF  L+K S
Sbjct: 378 ALENFQHAEIETYNDHRMAMCFSLIALSNTEVTILDPNCTAKTFPTYFRDLEKLS 432



>gb:AE017154_392800 Haemophilus ducreyi strain 35000HP section 4 of
           6 of the complete genome.>gb:AE017143_1027062
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 435

 Score =  201 bits (512), Expect = 1e-50
 Identities = 112/229 (48%), Positives = 148/229 (64%), Gaps = 2/229 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV V++++ +  F ++  Q Y SPG  +VEGDASSASYFL             
Sbjct: 212 LAMMRDFGVVVQNNN-YQSFFVQAQQCYLSPGQYWVEGDASSASYFLAAAAIKGKVKV-N 269

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA+VL KMGA +SW E+ +  +        +  LR IDV++N +PD A
Sbjct: 270 GIGKNSIQGDRLFADVLAKMGANISWGEDFIQAE--------KSVLRGIDVDLNHIPDAA 321

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP--PER 378
           +T+A+VALFA+  T IR+V +WRVKET+R+ A+ TELRKLGATVEEG D+  I P     
Sbjct: 322 ITIAIVALFAETETIIRNVYNWRVKETDRLSAMATELRKLGATVEEGQDFIRIQPLALTD 381

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
               EI+TY+DHR+AM FSL A +   VTI DP CTRKTFP+YF   +K
Sbjct: 382 FETAEIETYNDHRIAMCFSLIALSNTAVTILDPQCTRKTFPNYFAEFEK 430



>sp|P59416|AROA_BUCBP 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE014017_302697
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 2 of 2 of the complete
           genome.>gb:AE016826_981298 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 427

 Score =  201 bits (511), Expect = 2e-50
 Identities = 105/231 (45%), Positives = 149/231 (64%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L L+ + G+ + H D + +F ++G QKY SP    +EGDASSASYFL           V 
Sbjct: 206 LNLISKFGIKIIHKD-YTKFNVQGRQKYISPKEYSIEGDASSASYFLAAAAIKGGSVKVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGDVKFA VL+KMGA +++ ++ +  K        +K L  ID++MN +PD A
Sbjct: 265 GIGLNSIQGDVKFANVLKKMGAYITFGKDFIVCK--------KKDLIGIDLDMNDIPDAA 316

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A+VALF+ G T IR++ +WRVKET+R+ A+  EL+K+GA V EG DY  I PP    
Sbjct: 317 MTIAIVALFSKGKTVIRNIYNWRVKETDRLSAMTNELKKIGAQVIEGNDYIEILPPINFV 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
             +I+TYDDHR+AM F+L A + + VT+ +  C  KTFPDYF+ L+    +
Sbjct: 377 YAKINTYDDHRIAMCFALIALSGIKVTLLNYKCVNKTFPDYFQKLKSICSY 427



>pir|JN0758|JN0758 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Haemophilus influenzae>gb:HEAAROAUR_136742
           Haemophilus influenzae
           enolpyruvylshikimatephosphatesynthase (aroA) gene,
           complete cds and glycinimide ribonucleotide
           transformylase (purN) gene, 3' end.
          Length = 432

 Score =  199 bits (506), Expect = 6e-50
 Identities = 108/229 (47%), Positives = 143/229 (62%), Gaps = 2/229 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV VE+   + +F ++G Q Y SP    VEGDASSASYFL             
Sbjct: 209 LAMMRDFGVKVENHH-YQKFQVKGNQSYISPNKYLVEGDASSASYFLAAGAIKGKVKVT- 266

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA+VLEKMGA+++W E+ +  +           L  ID++MN +PD A
Sbjct: 267 GIGKNSIQGDRLFADVLEKMGAKITWGEDFIQAE--------HAELNGIDMDMNHIPDAA 318

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP--PER 378
           MT+A  ALF++G T IR++ +WRVKET+R+ A+ TELRK+GA VEEG D+  I P    +
Sbjct: 319 MTIATTALFSNGETVIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDFIRIQPLALNQ 378

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
                I+TY+DHRMAM FSL A +  PVTI DP CT KTFP +F   +K
Sbjct: 379 FKHANIETYNDHRMAMCFSLIALSNTPVTILDPKCTAKTFPTFFNEFEK 427



>sp|P12421|AROA_BORPE 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:BX640413_805378
           Bordetella pertussis strain Tohama I, complete genome;
           segment 3/12.
          Length = 442

 Score =  198 bits (503), Expect = 1e-49
 Identities = 111/226 (49%), Positives = 135/226 (59%), Gaps = 2/226 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GVSV   D W  F I     Y+ PG   +EGDAS+ASYFL           V 
Sbjct: 211 LNLMARFGVSVRR-DGWRAFTIARDAVYRGPGRMAIEGDASTASYFLALGAIGGGPVRVT 269

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDV FA  L  MGA+V +    +  +G   A  GR  L+A D + N +PD A
Sbjct: 270 GVGEDSIQGDVAFAATLAAMGADVRYGPGWIETRGVRVAEGGR--LKAFDADFNLIPDAA 327

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE--R 378
           MT A +AL+ADGP  +R++ SWRVKET+R+ A+ TEL KLGA V+ G D+  + PPE   
Sbjct: 328 MTAATLALYADGPCRLRNIGSWRVKETDRIHAMHTELEKLGAGVQSGADWLEVAPPEPGG 387

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEV 240
                I T+DDHRMAM FSLAA     V I DPGC  KTFPDYF+V
Sbjct: 388 WRDAHIGTWDDHRMAMCFSLAAFGPAAVRILDPGCVSKTFPDYFDV 433



>pir|S28063|S28063 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Pasteurella multocida>gb:PMAROA_158788
           P.multocida aroA gene.
          Length = 441

 Score =  196 bits (499), Expect = 4e-49
 Identities = 107/225 (47%), Positives = 147/225 (65%), Gaps = 4/225 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LK+M+  GV VE+  ++ RFL++G Q+Y+SP    VEGDASSASYFL             
Sbjct: 216 LKMMQTFGVEVENQ-AYQRFLVKGHQQYQSPHRFLVEGDASSASYFLAAAAIKGKVKVT- 273

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA+VLEKMGA ++W ++ + V+        + +L+ ID++MN +PD A
Sbjct: 274 GVGKNSIQGDRLFADVLEKMGAHITWGDDFIQVE--------KGNLKGIDMDMNHIPDAA 325

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA+G T IR++ +WRVKET+R+ A+ TELRK+GA VEEG D+  I P   LN
Sbjct: 326 MTIATTALFAEGETVIRNIYNWRVKETDRLTAMATELRKVGAEVEEGEDFIRIQP---LN 382

Query: 371 VTEID----TYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDY 249
           + +         DHRMAM F+L A ++  VTI DP CT KTFP +
Sbjct: 383 LAQFQHAELNIHDHRMAMCFALIALSKTSVTILDPSCTAKTFPTF 427



>gb:BX640432_811367 Bordetella parapertussis strain 12822, complete
           genome; segment 10/14.
          Length = 442

 Score =  196 bits (498), Expect = 5e-49
 Identities = 110/226 (48%), Positives = 134/226 (59%), Gaps = 2/226 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GVSV   D W  F I     Y+ PG   +EGDAS+ASYFL           V 
Sbjct: 211 LNLMARFGVSVRR-DGWRAFTIARDAAYRGPGRMAIEGDASTASYFLALGAIGGGPVRVT 269

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDV FA  L  MGA+V +    +  +G   A  GR  L+A D + N +PD A
Sbjct: 270 GVGEDSIQGDVAFAATLAAMGADVRYGPGWIETRGVRVAEGGR--LKAFDADFNLIPDAA 327

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE--R 378
           MT A +AL+ADGP  +R++ SWRVKET+R+ A+ TEL KLGA V+ G D+  + PP    
Sbjct: 328 MTAATLALYADGPCRLRNIGSWRVKETDRIHAMHTELEKLGAGVQSGADWLEVAPPAPGG 387

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEV 240
                I T+DDHRMAM FSLAA     V I DPGC  KTFPDYF+V
Sbjct: 388 WRDAHIGTWDDHRMAMCFSLAAFGPAAVRILDPGCVSKTFPDYFDV 433



>gb:AF182427_486303 Bordetella bronchiseptica prephenate dehydratase
           (pheA) gene, partial cds; prephenate dehydrogenase
           (tyrA), 5-enolpyruvylshikimate-3-phosphate synthase
           (aroA), and cytidine monophosphate kinase (cmk) genes,
           complete cds; and ribosomal protein S1 (rpsA) gene,
           partial cds.
          Length = 442

 Score =  196 bits (498), Expect = 5e-49
 Identities = 110/226 (48%), Positives = 134/226 (59%), Gaps = 2/226 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GVSV   D W  F I     Y+ PG   +EGDAS+ASYFL           V 
Sbjct: 211 LNLMARFGVSVRR-DGWRAFTIARDAAYRGPGRMAIEGDASTASYFLALGAIGGGPVRVT 269

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDV FA  L  MGA+V +    +  +G   A  GR  L+A D + N +PD A
Sbjct: 270 GVGEDSIQGDVAFAATLAAMGADVRYGPGWIETRGVRVAEGGR--LKAFDADFNLIPDAA 327

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE--R 378
           MT A +AL+ADGP  +R++ SWRVKET+R+ A+ TEL KLGA V+ G D+  + PP    
Sbjct: 328 MTAATLALYADGPCRLRNIGSWRVKETDRIHAMHTELEKLGAGVQSGADWLEVAPPAPGG 387

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEV 240
                I T+DDHRMAM FSLAA     V I DPGC  KTFPDYF+V
Sbjct: 388 WRDAHIGTWDDHRMAMCFSLAAFGPAAVRILDPGCVSKTFPDYFDV 433



>sp|Q9RND7|AROA_BORBR 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:BX640447_816115
           Bordetella bronchiseptica strain RB50, complete genome;
           segment 11/16.
          Length = 442

 Score =  196 bits (498), Expect = 5e-49
 Identities = 110/226 (48%), Positives = 134/226 (59%), Gaps = 2/226 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GVSV   D W  F I     Y+ PG   +EGDAS+ASYFL           V 
Sbjct: 211 LNLMARFGVSVRR-DGWRAFTIARDAAYRGPGRMAIEGDASTASYFLALGAIGGGPVRVT 269

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDV FA  L  MGA+V +    +  +G   A  GR  L+A D + N +PD A
Sbjct: 270 GVGEDSIQGDVAFAATLAAMGADVRYGPGWIETRGVRVAEGGR--LKAFDADFNLIPDAA 327

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE--R 378
           MT A +AL+ADGP  +R++ SWRVKET+R+ A+ TEL KLGA V+ G D+  + PP    
Sbjct: 328 MTAATLALYADGPCRLRNIGSWRVKETDRIHAMHTELEKLGAGVQSGADWLEVAPPAPGG 387

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEV 240
                I T+DDHRMAM FSLAA     V I DPGC  KTFPDYF+V
Sbjct: 388 WRDAHIGTWDDHRMAMCFSLAAFGPAAVRILDPGCVSKTFPDYFDV 433



>pir|A32007|XUBRVS 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Bordetella pertussis>gb:BPEAROA_749735
           B.pertussis 5-enolpyruvylshikimate-3-phosphate synthase
           (aroA) gene, complete cds.
          Length = 442

 Score =  196 bits (497), Expect = 7e-49
 Identities = 110/226 (48%), Positives = 134/226 (59%), Gaps = 2/226 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM R GVSV   D W  F I     Y+ PG   +EGDAS+ASYFL           V 
Sbjct: 211 LNLMARFGVSVRR-DGWRAFTIARDAVYRGPGRMAIEGDASTASYFLALGAIGGGPVRVT 269

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGDV FA  L  MGA+V +    +  +G   A  GR  L+A D + N +PD A
Sbjct: 270 GVGEDSIQGDVAFAATLAAMGADVRYGPGWIETRGVRVAEGGR--LKAFDADFNLIPDAA 327

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE--R 378
           MT A +AL+ADGP  +R++ SWRVKET+R+ A+ TEL KLGA V+ G D+  + PPE   
Sbjct: 328 MTAATLALYADGPCRLRNIGSWRVKETDRIHAMHTELEKLGAGVQSGADWLEVAPPEPGG 387

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEV 240
                I T+DDHRMAM F LAA     V I DPGC  KTFPDYF+V
Sbjct: 388 WRDAHIGTWDDHRMAMCFLLAAFGPAAVRILDPGCVSKTFPDYFDV 433



>sp|Q03421|AROA_HAEIN 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:U32833_205248
           Haemophilus influenzae Rd KW20 section 148 of 163 of the
           complete genome.>gb:L42023_1097797 Haemophilus
           influenzae Rd KW20 complete genome.
          Length = 432

 Score =  195 bits (496), Expect = 9e-49
 Identities = 107/229 (46%), Positives = 141/229 (61%), Gaps = 2/229 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV VE+   + +F ++G Q Y SP    VEGDASSASYFL             
Sbjct: 209 LAMMRDFGVQVENHH-YQKFQVKGNQSYISPNKYLVEGDASSASYFLAAGAIKGKVKVT- 266

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA+VLEKMGA+++W E+ +  +           L  ID++MN +PD A
Sbjct: 267 GIGKNSIQGDRLFADVLEKMGAKITWGEDFIQAE--------HAELNGIDMDMNHIPDAA 318

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII--TPPER 378
           MT+A  ALFA+  T IR++ +WRVKET+R+ A+ TELRK+GA VE G D+  I   P  +
Sbjct: 319 MTIATTALFANSETVIRNIYNWRVKETDRLTAMATELRKVGAEVEGGEDFIRIQPLPLNQ 378

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
                I+TY+DHRMAM FSL A +  PVTI DP CT KTFP +F   +K
Sbjct: 379 FKHANIETYNDHRMAMCFSLIALSNTPVTILDPKCTAKTFPTFFNEFEK 427



>sp|Q9JTT3|AROA_NEIMA 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|H81858|H81858
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) NMA1644 [imported] - Neisseria meningitidis
           (strain Z2491 serogroup A)>gb:NMA5Z2491_154528 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 5/7.
          Length = 433

 Score =  195 bits (495), Expect = 1e-48
 Identities = 112/231 (48%), Positives = 140/231 (60%), Gaps = 1/231 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLM + GV V + + +  F I     Y +P +  VEGDASSASYFL           V 
Sbjct: 206 LKLMAQFGVQVIN-EGYRVFKIPADAHYHAPEHLHVEGDASSASYFLAAGLIAATPVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGDV FA  LEK+GA+V W EN V V  P       + +RA D++ N +PD A
Sbjct: 265 GIGANSIQGDVAFACELEKIGADVVWGENFVEVSRPKE-----RAVRAFDLDANHIPDAA 319

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLA+VAL       +R++ SWRVKET+R+ A+  ELRKLGA V E  +   ITPPE   
Sbjct: 320 MTLAIVALATGQTCTLRNIGSWRVKETDRIAAMANELRKLGAKVAEEAEAIHITPPETPT 379

Query: 371 V-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
               IDTYDDHRMAM FSL +  +VPV I DP CT KTFP YF+V    ++
Sbjct: 380 PDAVIDTYDDHRMAMCFSLVSLLDVPVVINDPKCTHKTFPTYFDVFSSLTE 430



>sp|Q9JYU1|AROA_NEIMB 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|A81085|A81085
           3-phosphoshikimate 1-carboxyvinyltransferase NMB1432
           [imported] - Neisseria meningitidis (strain MC58
           serogroup B)>gb:AE002492_46845 Neisseria meningitidis
           serogroup B strain MC58 section 134 of 206 of the
           complete genome.>gb:AE002098_896958 Neisseria
           meningitidis serogroup B strain MC58 complete genome.
          Length = 433

 Score =  194 bits (494), Expect = 2e-48
 Identities = 111/231 (48%), Positives = 140/231 (60%), Gaps = 1/231 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLM + GV V + + +  F I     Y +P +  VEGDASSASYFL           V 
Sbjct: 206 LKLMAQFGVQVIN-EGYRVFKIPADAHYHAPEHLHVEGDASSASYFLAAGLIAATPVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGDV FA  LEK+GA+V W EN V V  P       + +++ D++ N +PD A
Sbjct: 265 GIGANSIQGDVAFARELEKIGADVVWGENFVEVSRPKE-----RAVQSFDLDANHIPDAA 319

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLA+VAL       +R++ SWRVKET+R+ A+  ELRKLGA V E  +   ITPPE L 
Sbjct: 320 MTLAIVALATGQTCTLRNIGSWRVKETDRIAAMANELRKLGAKVVEEAEAIHITPPETLT 379

Query: 371 V-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
               IDTYDDHRMAM FSL +   VPV I DP CT KTFP YF+V    ++
Sbjct: 380 PDAVIDTYDDHRMAMCFSLVSLLGVPVVINDPKCTHKTFPTYFDVFSSLTE 430



>gb:BX248585_763992 Blochmannia floridanus complete genome; segment
           2/3.
          Length = 433

 Score =  193 bits (491), Expect = 4e-48
 Identities = 100/225 (44%), Positives = 142/225 (63%), Gaps = 2/225 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   G+ V+H   +  F   G + YK+P    +EGDASSASYFL           V 
Sbjct: 207 LSVMRAFGICVQHDKDYKFFYCEGNRIYKAPQEYVIEGDASSASYFLAAAAIKGGTIRVL 266

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S QGD+KFA +LE+MG+ ++W +N +         S    L++ID+++N +PD A
Sbjct: 267 GVGKNSKQGDIKFANILERMGSIITWGDNYIEC-------SKGIMLKSIDIDVNDIPDAA 319

Query: 551 MTLAVVALFADG--PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPER 378
           MTLAV+ALF     P  +R++ +WRVKE++R+ A+ TELRK+GA V EG DY  I PP +
Sbjct: 320 MTLAVIALFTTNNLPMILRNIYNWRVKESDRLHAMATELRKVGAIVSEGYDYLHIVPPVQ 379

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
           +    I+TY+DHR+AM F+L A + V VTI +P C  KTFPD+F+
Sbjct: 380 IQSAFINTYNDHRIAMCFALVALSNVSVTINNPKCVCKTFPDFFD 424



>gb:AY758186_645375 Yersinia ruckeri
           5-enolpyruvylshikimate-3-phosphate synthetase (aroA)
           gene, partial cds.
          Length = 393

 Score =  192 bits (487), Expect = 1e-47
 Identities = 104/198 (52%), Positives = 126/198 (63%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM   GV V H + +  F I+GGQ Y SPG   VEGDASSASYFL           V 
Sbjct: 204 LHLMRSFGVEVTHQN-YQVFHIQGGQTYHSPGEYLVEGDASSASYFLAAAAIKGGTVRVT 262

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD KFA+VLEKMGA + W ++ +           R  L  ID++MN +PD A
Sbjct: 263 GIGKKSVQGDTKFADVLEKMGAIIHWGDDYIECS--------RGELCGIDMDMNHIPDAA 314

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MT+A  ALFA GPT IR++ +WRVKET+R+ A+ TELRK+GA VEEG DY  + PP  L 
Sbjct: 315 MTIATAALFAKGPTIIRNIYNWRVKETDRLSAMATELRKVGAEVEEGQDYIRVVPPAHLI 374

Query: 371 VTEIDTYDDHRMAMAFSL 318
             EI TY+DHRMAM FSL
Sbjct: 375 AAEIGTYNDHRMAMCFSL 392



>gb:AE004969_60627 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 433

 Score =  191 bits (486), Expect = 1e-47
 Identities = 113/231 (48%), Positives = 138/231 (59%), Gaps = 1/231 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLM + GV V + + +  F I     Y +P +  VEGDAS ASYFL           V 
Sbjct: 206 LKLMAQFGVQVAN-EGYRVFKIPADAHYHAPEHLHVEGDASGASYFLAAGLIAATPVRVT 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGDV FA  LEK+GA+V W EN V V      P GR  ++A D++ N +PD A
Sbjct: 265 GIGANSIQGDVAFARELEKIGADVVWGENFVEVS----RPKGRA-VQAFDLDANHIPDAA 319

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           MTLA+VAL       +R++ SWRVKET R+ A+  ELRKLGA V E  +   ITPPE   
Sbjct: 320 MTLAIVALATRQTCTLRNIGSWRVKETGRIAAMANELRKLGAKVVEEAEAIHITPPETPT 379

Query: 371 V-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
               IDTYDDHRMAM FSL +   VPV I DP CT KTFP YFEV    ++
Sbjct: 380 PDAVIDTYDDHRMAMCFSLISLLGVPVVINDPKCTHKTFPTYFEVFSSLTE 430



>gb:AY545665_1612943 Plantago lanceolata
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS) mRNA,
           partial cds.
          Length = 265

 Score =  180 bits (456), Expect = 4e-44
 Identities = 89/109 (81%), Positives = 93/109 (85%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GV VEH+DSWDRFL+RGGQKYKSPG A+VEGDASSASYFL           VE
Sbjct: 157 LKLMERFGVYVEHTDSWDRFLVRGGQKYKSPGKAYVEGDASSASYFLAGAAVTGGTVTVE 216

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI 585
           GCGTSSLQGDVKFAEVLEKMGAEV+WTENSVTVKGPPR  SGRKHLRAI
Sbjct: 217 GCGTSSLQGDVKFAEVLEKMGAEVTWTENSVTVKGPPRNSSGRKHLRAI 265



>gb:AY545663_1612941 Sarracenia purpurea
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS) mRNA,
           partial cds.
          Length = 265

 Score =  179 bits (453), Expect = 9e-44
 Identities = 87/109 (79%), Positives = 96/109 (88%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLM+R GVSVEH+DSWD+FLIRGGQKYKSPG+A+VEGDASSASYFL           VE
Sbjct: 157 LKLMKRFGVSVEHTDSWDKFLIRGGQKYKSPGSAYVEGDASSASYFLAGAAVTGGTITVE 216

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI 585
           GCGTSSLQGDVKFAEVLEKMGA+V+WTENSVTV+GPPR+ SGRKHLRAI
Sbjct: 217 GCGTSSLQGDVKFAEVLEKMGAKVTWTENSVTVRGPPRSSSGRKHLRAI 265



>gb:AY545661_1612939 Helianthus salicifolius
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS1)
           mRNA, partial cds.
          Length = 264

 Score =  175 bits (443), Expect = 1e-42
 Identities = 85/109 (77%), Positives = 92/109 (84%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           +KLMER GVSVEHSDSWDRF I+GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 156 IKLMERFGVSVEHSDSWDRFFIKGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTITVE 215

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI 585
           GCGTSSLQGDVKFAEVL +MGAEV+WTENSVTV+GPPR  SGRKHL A+
Sbjct: 216 GCGTSSLQGDVKFAEVLGQMGAEVTWTENSVTVRGPPRNASGRKHLHAV 264



>gb:AY545662_1612940 Helianthus salicifolius
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS2)
           mRNA, partial cds.
          Length = 264

 Score =  172 bits (436), Expect = 8e-42
 Identities = 84/109 (77%), Positives = 91/109 (83%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVSVEHSDSWD+F +RGGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 156 LKLMERFGVSVEHSDSWDKFYVRGGQKYKSPGNAYVEGDASSASYFLAGAAITGGTVTVE 215

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI 585
           GCGTSSLQGDVKFAEVL +MGAEV+WTENSVTV+GPPR  SGR HLR +
Sbjct: 216 GCGTSSLQGDVKFAEVLGQMGAEVTWTENSVTVRGPPRNASGRGHLRPV 264



>gb:AY545658_1612936 Asimina triloba
           5-enol-pyruvylshikimate-phosphate synthase (EPSPS) mRNA,
           partial cds.
          Length = 264

 Score =  167 bits (423), Expect = 3e-40
 Identities = 84/109 (77%), Positives = 87/109 (79%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVS EHS SWDRFL+RGGQKYKSPG AFVEGDASSASYFL           VE
Sbjct: 156 LKLMERFGVSAEHSGSWDRFLVRGGQKYKSPGTAFVEGDASSASYFLAGAAVTGGTVTVE 215

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI 585
           GCGTSSLQGDVKFAEVLEKMGA+VSWTENSVTV GPP  PS +K L  I
Sbjct: 216 GCGTSSLQGDVKFAEVLEKMGAKVSWTENSVTVTGPPLDPSRKKRLHGI 264



>sp|Q9L213|ARA1_STRCO 3-phosphoshikimate 1-carboxyvinyltransferase 1
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase 1) (EPSP synthase 1) (EPSPS
           1).>gb:SCO939129_180486 Streptomyces coelicolor A3(2)
           complete genome; segment 26/29.
          Length = 440

 Score =  161 bits (408), Expect = 1e-38
 Identities = 95/218 (43%), Positives = 124/218 (56%)
 Frame = -2

Query: 890 GVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSL 711
           GVSV+  D + RF +  GQ+ +  G   VE DAS  SYFL           + G G  S 
Sbjct: 223 GVSVDR-DGYRRFTVPSGQQARG-GQVTVEPDASGMSYFLAAAAILQSRVVIPGIGAGSH 280

Query: 710 QGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVA 531
           QGDV   + LE+MG      ++S+TV G P        LR ID++M  MPDV  +LA+VA
Sbjct: 281 QGDVHLVQALERMGCRTEVGDDSITVTGGP--------LRGIDIDMEAMPDVVPSLAIVA 332

Query: 530 LFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTY 351
            +A+G T I ++AS RVKE +R+ AV TELRK+G  VEE  D   IT         IDTY
Sbjct: 333 AYAEGTTRITNIASLRVKECDRIAAVTTELRKMGIDVEEHSDAMYITGGTPHGAV-IDTY 391

Query: 350 DDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL 237
           DDHR+AM F++       V IKDPGC  K+FP +++ L
Sbjct: 392 DDHRIAMTFAIGGLRTEGVVIKDPGCVAKSFPAFWQTL 429



>gb:AY496581_622020 Uncultured bacterium clone pELP182 putative
           3-phosphoshikimate 1-carboxyvinyltransferase gene,
           partial cds; and lipase/esterase gene, complete cds.
          Length = 272

 Score =  154 bits (389), Expect = 2e-36
 Identities = 94/227 (41%), Positives = 128/227 (56%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+R G + +   +    ++ GGQ+Y++  +  VE DAS ASYF            + 
Sbjct: 55  LTLMDRWGATSDVKGNV--IVVPGGQRYRAI-DFMVEPDASGASYFAAAAALIGGTVTLA 111

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
                S+QGD+    VLE+MGA   W  +S+ V G  R       L  +DV+MN MPD+ 
Sbjct: 112 RLNAGSVQGDLGLLRVLERMGARTQWNRDSIEVIGTGR-------LAGVDVDMNAMPDMV 164

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
            TLA +A FA  PT IR+VA  R  E++R+ A+ TELR+LGATV E  D   I  P  L 
Sbjct: 165 PTLAAIAPFASSPTRIRNVAFIRHHESDRLRALATELRRLGATVNEFEDGLGI-EPSVLK 223

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
              I+TYDDHR+AMAFS+       V IK+PGC  KT+P +F+ L +
Sbjct: 224 PATIETYDDHRIAMAFSVVGLKLAGVRIKNPGCVSKTYPGFFDDLAR 270



>sp|Q03321|AROA_AERSA 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).
          Length = 428

 Score =  154 bits (389), Expect = 2e-36
 Identities = 93/231 (40%), Positives = 127/231 (54%), Gaps = 1/231 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV +EH D++  F I+G Q   SPG+  VEGDASSASYFL             
Sbjct: 207 LHIMNSSGVVIEH-DNYKLFYIKGNQSIVSPGDFLVEGDASSASYFLAAGAIKGKVRVT- 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+ GD+ FA+VLE+MGA ++W ++ +  +  P        L  +D++MN +PDVA
Sbjct: 265 GIGKHSI-GDIHFADVLERMGARITWGDDFIEAEQGP--------LHGVDMDMNHIPDVA 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATV-EEGPDYCIITPPERL 375
           MT+AV      G   IR++ +WRVKET+R        R+  A V EEG  +      +  
Sbjct: 316 MTIAVSRTVCRGSHLIRNIYNWRVKETDRCTPCTHGHRRAQAGVSEEGTTFITRDAADPA 375

Query: 374 NVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
                      R+AM FSL A +++ VTI DPGCT KTFPDYF+ L   S+
Sbjct: 376 QARRDRHLQRSRIAMCFSLVALSDIAVTINDPGCTSKTFPDYFDKLASVSQ 426



>gb:AY775556_645908 Haemophilus parasuis AroA (aroA) gene, partial
           cds.
          Length = 329

 Score =  151 bits (381), Expect = 2e-35
 Identities = 82/175 (46%), Positives = 115/175 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M+  GV VE+ + +  F+++G Q Y SP    VEGDASSASYFL             
Sbjct: 160 LAMMKDFGVKVENRN-YQTFVVKGNQSYLSPEKYLVEGDASSASYFLAAGAIKGKVKVT- 217

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA VLE MGA+++W ++ +      +A  G+  L+ +D++MN +PD A
Sbjct: 218 GIGKNSIQGDRLFANVLEAMGAKITWGDDFI------QAEQGK--LKGVDMDMNHIPDAA 269

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
           MT+A  ALFA+G T IR++ +WRVKET+R+ A+ TELRK+GATVEEG D+  I P
Sbjct: 270 MTIATAALFAEGETVIRNIYNWRVKETDRLTAMATELRKVGATVEEGEDFIRIQP 324



>gb:AF440390_1800062 Orychophragmus violaceus
           5-enolpyruvylshikimate-3-phosphate synthase gene,
           partial cds.>gb:AF440391_1800063 Orychophragmus
           violaceus 5-enolpyruvylshikimate-3-phosphate synthase
           gene, partial cds.
          Length = 170

 Score =  150 bits (380), Expect = 3e-35
 Identities = 73/93 (78%), Positives = 78/93 (83%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GVS EHSDSWDRF ++GGQKYKSPGNA+VEGDASSASYFL           VE
Sbjct: 78  LKLMERFGVSAEHSDSWDRFFVKGGQKYKSPGNAYVEGDASSASYFLAGAAITGETVTVE 137

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTV 633
           GCGT+SLQGDVKFAEVLEKMG +VSWTENSVTV
Sbjct: 138 GCGTTSLQGDVKFAEVLEKMGCKVSWTENSVTV 170



>gb:AY775559_645911 Actinobacillus ureae AroA (aroA) gene, partial
           cds.
          Length = 338

 Score =  150 bits (380), Expect = 3e-35
 Identities = 80/175 (45%), Positives = 114/175 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M+  GV+VE+ + +  F+++G Q Y SP    VEGDASSASYFL             
Sbjct: 168 LAMMKDFGVNVENQN-YQTFVVKGNQSYISPEKYLVEGDASSASYFLAAGAIKGKVKVT- 225

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA VLE MGA+++W ++ +  +        +  L+ +D++MN +PD A
Sbjct: 226 GIGKNSIQGDRLFANVLEAMGAKITWGDDFIQAE--------QGELKGVDMDMNHIPDAA 277

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
           MT+A  ALFA+G T IR++ +WRVKET+R+ A+ TELRK+GATVEEG D+  I P
Sbjct: 278 MTIATTALFAEGETVIRNIYNWRVKETDRLAAMATELRKVGATVEEGEDFIRIQP 332



>sp|Q8YMB5|AROA_ANASP 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|AC2433|AC2433
           3-phosphoshikimate 1-carboxyvinyltransferase [imported]
           - Nostoc sp. (strain PCC 7120)>gb:BA000019_686008 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 425

 Score =  150 bits (379), Expect = 3e-35
 Identities = 92/221 (41%), Positives = 124/221 (56%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEG 729
           +LM   GV V  +D  ++F I+ GQ+Y++  +  +E DAS+ASYF            V  
Sbjct: 207 RLMADFGVDVTQTDD-NQFHIKAGQRYQAR-HYTIEPDASNASYFFAAAAVTGGRVRVNH 264

Query: 728 CGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAM 549
               S QGD+ +  VLE+MG +V    +   V GP       + L+ ID++MN M D+  
Sbjct: 265 LTKQSCQGDILWLNVLEQMGCQVIEGADYTEVIGP-------EQLQGIDIDMNDMSDLVQ 317

Query: 548 TLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNV 369
           TL  +A +A  P  IR+V   R KETER+ AV TELR+LG  VEE  D   I P   +  
Sbjct: 318 TLGAIAPYASSPVIIRNVEHIRYKETERIRAVVTELRRLGVKVEEFADGMKIEPTP-ITP 376

Query: 368 TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYF 246
             I+TY DHRMAMAF++       + I+DPGCT KTFPDYF
Sbjct: 377 AAIETYHDHRMAMAFAVTGLKTPGIVIQDPGCTAKTFPDYF 417



>gb:BX294136_766185 Pirellula sp. strain 1 complete genome; segment
           4/24.
          Length = 501

 Score =  147 bits (372), Expect = 2e-34
 Identities = 94/232 (40%), Positives = 135/232 (58%), Gaps = 8/232 (3%)
 Frame = -2

Query: 902 MERXGVSVE---HSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           M+  G SVE    + + D  L++    Y + G + +E DAS+ASYF            V 
Sbjct: 263 MQVFGASVELQWPAAAQDDVLVQISGDYDAIGWS-IEPDASAASYFWAAAAISGGDVTVN 321

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G   ++ QGDV F +VLE MG ++   E+S+ V      P G+  LR +DV+MN + D  
Sbjct: 322 GLSRAATQGDVAFVDVLEMMGCQIEEGEDSIRVIAT-NLPGGQ--LRGVDVDMNAISDTV 378

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
            TLA+VALFA+ PT +R VA  R KET+R+  + +ELRKLGAT++E  D   I P     
Sbjct: 379 QTLAMVALFANSPTRVRGVAHNRFKETDRIGDLASELRKLGATIQEHDDGMTIHPLSEPA 438

Query: 371 VTE-----IDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
           V++     +DTY DHRMAM+FSLA      + I++P CT KT+P+Y+  L++
Sbjct: 439 VSDESPVRLDTYHDHRMAMSFSLAGLRLGGIEIENPACTGKTYPNYWSDLEQ 490



>gb:AY545664_1612942 Nymphaea alba 5-enol-pyruvylshikimate-phosphate
           synthase (EPSPS) mRNA, partial cds.
          Length = 264

 Score =  147 bits (370), Expect = 4e-34
 Identities = 76/109 (69%), Positives = 84/109 (77%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           LKLMER GV+VEH   WDRFLIRG Q Y SPG+A+VEGDASSASYFL           VE
Sbjct: 157 LKLMERFGVAVEHGGGWDRFLIRGRQMYMSPGSAYVEGDASSASYFLAGAAITGGTVTVE 216

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI 585
           GCGTSSLQGDVKFAEVLEKMGA+V+W++NSVTV GPP+  S R  LR I
Sbjct: 217 GCGTSSLQGDVKFAEVLEKMGAKVTWSQNSVTVTGPPKDGS-RTRLRDI 264



>gb:CR522870_101856 Desulfotalea psychrophila LSv54 chromosome.
          Length = 451

 Score =  145 bits (365), Expect = 1e-33
 Identities = 97/229 (42%), Positives = 127/229 (55%), Gaps = 6/229 (2%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLI-RG---GQKYKSPGNAFVEGDASSASYFLXXXXXXXXX 744
           L +M R G+ VE+S  +  F I RG   GQ Y       VEGDASSASYF          
Sbjct: 230 LDVMSRFGIHVEYSSDYKYFKIPRGIYRGQDYS------VEGDASSASYFWAAAAVTGGR 283

Query: 743 XXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKM 564
             VE    SSLQGDVK   +L +MG  +S     +T+     A +G   L  I V+M  M
Sbjct: 284 VRVENVSVSSLQGDVKLVPLLGRMGCGLSIEGGGITL-----ASTGM--LEGISVDMADM 336

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII--T 390
           PDV  TLAVVA FA+G T I+++   R+KE +R+ AV TEL ++GA VEE  D  +I   
Sbjct: 337 PDVVPTLAVVAAFAEGKTHIQNIGHLRIKECDRLHAVVTELTRMGAEVEEHSDSMVIHGK 396

Query: 389 PPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
               L+   I+TYDDHRMAM+ ++A      V I   GC  K+FPD+++
Sbjct: 397 GGRDLHGATIETYDDHRMAMSMAVAGLKVPGVEISGEGCVAKSFPDFWQ 445



>gb:AP006627_563543 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 446

 Score =  132 bits (333), Expect = 7e-30
 Identities = 81/225 (36%), Positives = 113/225 (50%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           + LM   GV V+ +  W   L+          +  +E DAS+A YFL           + 
Sbjct: 219 IDLMAAFGVEVKAAPDWS--LLEVNPSPYVANDIAIEADASTACYFLALAAITAGKIRIR 276

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
              T + Q D+ F  +L++MG       + V  +GP R   G        VNMN++ D A
Sbjct: 277 HFSTKTSQPDILFVSILKRMGCNFEIGPSFVEGEGPTRLRGG------FTVNMNELSDQA 330

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
           +TLA ++ FADGP AI  V   R  E +R+ A+CTEL +LG  VEE  D   + P +   
Sbjct: 331 LTLAAISPFADGPIAIEGVGHIRHHECDRIRAICTELSRLGIRVEERHDGLTVYPGQP-K 389

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL 237
            T ++TYDDHRMAMA +L       + + DPGC  KT P YF +L
Sbjct: 390 PTVVNTYDDHRMAMALALIGAKVDGIELDDPGCVAKTCPSYFSML 434



>pir|F64362|F64362 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Methanococcus jannaschii
          Length = 436

 Score =  131 bits (330), Expect = 2e-29
 Identities = 76/227 (33%), Positives = 130/227 (57%), Gaps = 1/227 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L ++ + G+ ++ +D+   FL+ G QKYK P +  VEGD SSASY +           +E
Sbjct: 211 LDILNKFGIKIDKTDNG--FLVYGNQKYK-PIDYIVEGDYSSASYLIAAGVLINSNITIE 267

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
               +S QGD     ++++MGA++   ++ V ++G          L+ IDV++  +PD+ 
Sbjct: 268 NLFANSKQGDKAIINIVKEMGADIKVKKDKVIIEG-------EYSLKGIDVDVKDIPDLV 320

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
            T+AV+  FA+G T I +    R+KE +R+ A   EL+K+GA +EE PD  II   ++L 
Sbjct: 321 PTIAVLGCFAEGKTEIYNGEHVRLKECDRLRACAVELKKMGADIEEKPDGLIIRGVKKLK 380

Query: 371 VTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQ 234
             +++TY DHR+ MAF++A   AE    I+     + +FP++ +V++
Sbjct: 381 GAKLNTYHDHRLVMAFTIAGLKAEGETIIEGEEAVKISFPNFVDVMK 427



>sp|Q57925|AROA_METJA Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>gb:U67500_206597 Methanocaldococcus
           jannaschii DSM 2661 section 42 of 150 of the complete
           genome.>gb:L77117_1099355 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 429

 Score =  131 bits (330), Expect = 2e-29
 Identities = 76/227 (33%), Positives = 130/227 (57%), Gaps = 1/227 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L ++ + G+ ++ +D+   FL+ G QKYK P +  VEGD SSASY +           +E
Sbjct: 204 LDILNKFGIKIDKTDNG--FLVYGNQKYK-PIDYIVEGDYSSASYLIAAGVLINSNITIE 260

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
               +S QGD     ++++MGA++   ++ V ++G          L+ IDV++  +PD+ 
Sbjct: 261 NLFANSKQGDKAIINIVKEMGADIKVKKDKVIIEG-------EYSLKGIDVDVKDIPDLV 313

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
            T+AV+  FA+G T I +    R+KE +R+ A   EL+K+GA +EE PD  II   ++L 
Sbjct: 314 PTIAVLGCFAEGKTEIYNGEHVRLKECDRLRACAVELKKMGADIEEKPDGLIIRGVKKLK 373

Query: 371 VTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQ 234
             +++TY DHR+ MAF++A   AE    I+     + +FP++ +V++
Sbjct: 374 GAKLNTYHDHRLVMAFTIAGLKAEGETIIEGEEAVKISFPNFVDVMK 420



>gb:CR382137_1670221 Debaryomyces hansenii chromosome E of strain
            CBS767 of Debaryomyces hansenii.
          Length = 1570

 Score =  127 bits (319), Expect = 3e-28
 Identities = 89/240 (37%), Positives = 128/240 (53%), Gaps = 15/240 (6%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
            + +M+  G++V  S + +         Y +P    +E DASSA+Y L           V 
Sbjct: 606  ISMMKSFGINVTRSTTEEHTYHIPKGAYVNPSEYVIESDASSATYPLAFAAMTGTSCTVP 665

Query: 731  GCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI-DVNMNKMPD 558
              G+SSLQGD +FA +VL+ MG +V  T  S TV GPP+       L+ +  V+M  M D
Sbjct: 666  NIGSSSLQGDARFAVDVLKPMGCKVDQTATSTTVTGPPKG-----QLKPLPHVDMEPMTD 720

Query: 557  VAMTLAVVALFADGP---TAIRDVASWRVKETERMIAVCTELRKLGATVEE--------G 411
              +T +VVA  A+ P   T+I  +A+ RVKE  R+ A+ TEL K G   +E        G
Sbjct: 721  AFLTASVVAAIANDPYQSTSITGIANQRVKECNRIEAMITELAKFGVKADELPDGIRING 780

Query: 410  PDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA--CAEVPVTIKDPGCTRKTFPDYFEVL 237
             DY  +T P  +    I  YDDHR+AM+FSL A  C   PV I++  CT KT+P ++++L
Sbjct: 781  IDYHNLTTPS-IKARGIKAYDDHRVAMSFSLLAGMCVN-PVLIQERSCTGKTWPGWWDIL 838



>gb:AJ749949_531045 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 425

 Score =  125 bits (315), Expect = 9e-28
 Identities = 78/223 (34%), Positives = 115/223 (51%), Gaps = 1/223 (0%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEG 729
           K+M   GV+V+  ++          +Y SP N  VE D S+ASYF            V  
Sbjct: 206 KVMAEFGVTVDIDEN---IYTANKSQYISPSNYVVEPDVSTASYFWAFAAITGSTIKVMH 262

Query: 728 CGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAM 549
              +S QGD+KF EVLEK+G +V++  + + V       +G   LR I VNM    D  M
Sbjct: 263 VTKNSKQGDIKFLEVLEKIGCQVNYYNDGIEV-------TGNNQLRGIQVNMRNFSDTFM 315

Query: 548 TLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP-ERLN 372
           TLA +A FA G T I  ++  R +E++R+ A+   L KLG  VE   D  +I+P   +  
Sbjct: 316 TLAAIACFAKGDTHISGLSHTRGQESDRIAAMAEGLSKLGIYVETTQDSILISPARSKFK 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
             E+D+++DHR+AM+ +L       V + +     KT PDYF+
Sbjct: 376 PAEVDSHNDHRIAMSLALLGLKYQGVIVNNAAAVSKTCPDYFD 418



>gb:AE016820_1750019 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VII, complete sequence.
          Length = 1577

 Score =  125 bits (314), Expect = 1e-27
 Identities = 92/247 (37%), Positives = 129/247 (52%), Gaps = 22/247 (8%)
 Frame = -2

Query: 911  LKLMERXGVSVEHS-DSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXV 735
            +++ME+ G+ VE S D    + I  GQ Y +P    +E DASSA+Y L           +
Sbjct: 616  IRMMEKFGIKVEKSNDELYTYHIPRGQ-YVNPAEYVIESDASSATYPLAFAALTGTTVTI 674

Query: 734  EGCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPD 558
               G  SLQGD +FA +VL+ MG  V  T  S TV GP   P   K L  +D  M  M D
Sbjct: 675  PNIGHDSLQGDSRFACDVLKPMGCTVQQTATSTTVTGP--EPGTLKPLEHVD--MEPMTD 730

Query: 557  VAMTLAVVALFADGPTA-------IRDVASWRVKETERMIAVCTELRKLGATVEEGPDYC 399
              +T  VVA  A  P +       I  +A+ RVKE  R++A+ T+L K G T EE PD  
Sbjct: 731  AFLTACVVAAAAHSPESKCKNIITITGIANQRVKECNRILAMVTQLSKFGVTAEELPDGI 790

Query: 398  IITPPERLNVTE----IDTYDDHRMAMAFSL---------AACAEVPVTIKDPGCTRKTF 258
             +   E+L+  +    ++TYDDHR+AM+FSL         A  +  P+ I +  CT KT+
Sbjct: 791  QVHGVEQLSQLKVPDAVETYDDHRVAMSFSLLAGMVNYGQAPSSCRPIKILERRCTGKTW 850

Query: 257  PDYFEVL 237
            P +++VL
Sbjct: 851  PGWWDVL 857



>gb:CR380959_1654146 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 1579

 Score =  125 bits (313), Expect = 2e-27
 Identities = 90/254 (35%), Positives = 125/254 (49%), Gaps = 29/254 (11%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
            +K+ME+ G+ VE S + +   I     Y +P    +E DASSA+Y L           V 
Sbjct: 608  IKMMEKFGIKVEKSTTEEYTYIIPKGHYVNPAEYVIESDASSATYPLAFAALTGTTVTVP 667

Query: 731  GCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI-DVNMNKMPD 558
              G++SLQGD +FA +VL+ MG  V+ T  S TV GPP       HL+ +  V+M  M D
Sbjct: 668  NIGSASLQGDARFATDVLQPMGCSVTQTATSTTVTGPPVG-----HLKPLKHVDMEPMTD 722

Query: 557  VAMTLAVVALFA-------DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYC 399
              +T  VVA  A          T I  +A+ RVKE  R+ A+CT+L K G    E PD  
Sbjct: 723  AFLTACVVAAVAHDNDPTSKNTTTIEGIANQRVKECNRIEAMCTQLAKFGVRTNELPDGI 782

Query: 398  IITPPERLNVTEID----------TYDDHRMAMAFSLAA----------CAEVPVTIKDP 279
             +     +N  ++           TYDDHR+AM+FSL A              PV I + 
Sbjct: 783  QVHGLHSINDLKVPSIGNEAVGVCTYDDHRVAMSFSLLAGMVNSEQPNSSNPTPVRILER 842

Query: 278  GCTRKTFPDYFEVL 237
             CT KT+P +++VL
Sbjct: 843  HCTGKTWPGWWDVL 856



>gb:NCB14H13_1689363 Neurospora crassa DNA linkage group II BAC clone
            B14H13.
          Length = 1563

 Score =  123 bits (308), Expect = 6e-27
 Identities = 92/238 (38%), Positives = 128/238 (53%), Gaps = 8/238 (3%)
 Frame = -2

Query: 911  LKLMERXGVSVEHS-DSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXV 735
            + +M   GV V+ S +  + + I  G  YK+P    VE DASSA+Y L           V
Sbjct: 602  IAMMASFGVQVQRSAEDPNTYYIPQGT-YKNPETYVVESDASSATYPLAIAAITGTTCTV 660

Query: 734  EGCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI-DVNMNKMP 561
               G+ SLQGD +FA EVL  MG  V  T+ S TV GPP        L+AI  V+M  M 
Sbjct: 661  PNIGSKSLQGDARFAIEVLRPMGCTVEQTDVSTTVTGPPIGT-----LKAIPHVDMEPMT 715

Query: 560  DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGA---TVEEGPDYCIIT 390
            D  +T +V+A  A G T I  +A+ RVKE  R++A+  +L K G     +E+G +   I 
Sbjct: 716  DAFLTASVLAAVASGTTQITGIANQRVKECNRILAMKDQLAKFGVHCNELEDGIEVIGIP 775

Query: 389  PPERLNVTE-IDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              E  N TE I  YDDHR+AM+FS L+  +  PV I +  CT KT+P +++ +  + K
Sbjct: 776  YTELKNPTEGIYCYDDHRVAMSFSVLSTISPHPVLILERECTGKTWPGWWDTMSNYFK 833



>gb:BX957222_844458 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 429

 Score =  122 bits (306), Expect = 1e-26
 Identities = 72/234 (30%), Positives = 127/234 (54%), Gaps = 3/234 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDR--FLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXX 738
           + ++++ GV +   +  ++  + I+G Q YK P +  +EGD SSASY +           
Sbjct: 200 IDVLDKFGVKIGKIEEKNKSGYKIKGNQTYK-PCDYTIEGDYSSASYLVAAGVLLNSDIV 258

Query: 737 VEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPD 558
           ++     S QGD +  E+++KMGA+V   +++V + GP         L  I++++  +PD
Sbjct: 259 IKNVFKDSKQGDREIIEIVKKMGADVEINDDNVKITGP-------YELNGIEIDVTDIPD 311

Query: 557 VAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPER 378
           +  T+AV+  FA G T + +    R+KE +R+ A   EL K+GA +EE  D  IIT   +
Sbjct: 312 LVPTIAVLGCFAKGKTVVYNGEHVRLKECDRLAACTAELSKMGARIEEKKDGLIITGVHK 371

Query: 377 LNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           LN  ++ TY DHR+ MAF++A   A+    I+     + +FPD+ + ++    +
Sbjct: 372 LNGAKLKTYHDHRLVMAFTIAGMLADGETIIEGEDSVKISFPDFVDKMKSIGSN 425



>gb:AE017310_438719 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 2 of 12 of the complete
           genome.>gb:AE017285_1071880 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 439

 Score =  122 bits (305), Expect = 1e-26
 Identities = 80/215 (37%), Positives = 111/215 (51%), Gaps = 6/215 (2%)
 Frame = -2

Query: 857 RFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLE 678
           RF +R G  Y++ G+  VEGD S ASYFL           VEG    SLQGD    ++L 
Sbjct: 236 RFRVRPGM-YRA-GSYRVEGDWSGASYFLAAGAVGPRPVRVEGLRVDSLQGDRALLDILT 293

Query: 677 KMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRD 498
            MGA++   E  V V   P        L  ++V+M   PD+  T+A VA FA G T +R+
Sbjct: 294 AMGADIRPGEGHVVVHPAP--------LHGVEVDMGHCPDLVPTVAAVAAFATGRTVVRN 345

Query: 497 VASWRVKETERMIAVCTELRKLGATVEEGPDYCII------TPPERLNVTEIDTYDDHRM 336
           VA  R+KE++R+ A   ELR+ G   EE  D  ++      T P  L       + DHRM
Sbjct: 346 VAHLRIKESDRIAAPVGELRRAGVNAEERADGLVVQGGALATEPGTL----FSAHGDHRM 401

Query: 335 AMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
           AM+ +L     V V + DP C  K+FP ++E+ +K
Sbjct: 402 AMSLALLGLGGVDVRLDDPSCVSKSFPHFWELWEK 436



>gb:AY775557_645909 Actinobacillus equuli AroA (aroA) gene, partial
           cds.
          Length = 297

 Score =  121 bits (304), Expect = 2e-26
 Identities = 65/152 (42%), Positives = 96/152 (63%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M+  GV+VE+ + +  F+++G Q Y SP    VEGDASSASYFL             
Sbjct: 156 LAMMKDFGVNVENQN-YQTFVVKGNQSYISPEKYLVEGDASSASYFLAAGAIKGKVKVT- 213

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA VLE MGA+++W ++ +  +        +  L+ +D++MN +PD A
Sbjct: 214 GIGKNSIQGDRLFANVLEAMGAKITWGDDFIQAE--------QGELKGVDMDMNHIPDAA 265

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIA 456
           MT+A  ALFA+G T IR++ +WRVKET+R+ A
Sbjct: 266 MTIATTALFAEGETIIRNIYNWRVKETDRLAA 297



>sp|Q9K9D5|ARA2_BACHD 3-phosphoshikimate 1-carboxyvinyltransferase 2
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase 2) (EPSP synthase 2) (EPSPS
           2).>pir|A83989|A83989 3-phosphoshikimate
           1-carboxyvinyltransferase BH2713 [imported] - Bacillus
           halodurans (strain C-125)>gb:BA000004_656659 Bacillus
           halodurans C-125 DNA, complete genome.
          Length = 447

 Score =  119 bits (299), Expect = 6e-26
 Identities = 74/231 (32%), Positives = 115/231 (49%), Gaps = 4/231 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSP---GNAFVEGDASSASYFLXXXXXXXXXX 741
           L LM+  G  VE+       ++     + +P    +  +E DAS+A YFL          
Sbjct: 220 LHLMKSFGAQVEYDQQLQTIVV-----HPTPYTCQDIDLEADASTACYFLALAALTKGRI 274

Query: 740 XVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMP 561
            +     S+ Q D+    V EKMG  V+   + + ++G  +   G        ++MN+M 
Sbjct: 275 RLNNLTASTTQPDLHMLTVFEKMGCTVTRGSSFIELEGVSQLKGG------FQISMNEMS 328

Query: 560 DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP-P 384
           D A+TLA +A FADGP  I DV   R  E++R+  +C  L +LG  V+E  D   + P  
Sbjct: 329 DQALTLAAIAPFADGPITITDVEHIRYHESDRIAVICEALTRLGIQVDEFEDGLTVYPGT 388

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
            +  +  + TYDDHR+AM+ SL       + + DPGC  KT P YF++L++
Sbjct: 389 PKPTLHPLSTYDDHRVAMSLSLIGTKVKGLRLNDPGCVAKTCPSYFQLLEQ 439



>gb:CR382132_1665468 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1556

 Score =  119 bits (297), Expect = 1e-25
 Identities = 77/203 (37%), Positives = 111/203 (54%), Gaps = 5/203 (2%)
 Frame = -2

Query: 830  YKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFA-EVLEKMGAEVSW 654
            Y +P    VE DASSA+Y L           V   G+ SLQGD +FA +VL+ MG  V  
Sbjct: 636  YTNPEEYVVESDASSATYPLAYAAMTGHTVTVPNIGSKSLQGDARFAIDVLKAMGCTVEQ 695

Query: 653  TENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKE 474
            T  S TV G P       +L+AI V+M  M D  +T  VVA  ++G T I  +A+ RVKE
Sbjct: 696  TATSTTVTGVP-------NLKAIAVDMEPMTDAFLTACVVAAVSEGTTVITGIANQRVKE 748

Query: 473  TERMIAVCTELRKLGAT---VEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFS-LAACA 306
              R+ A+  +L K G     +E+G +   I+  +      + +YDDHR+AM+FS L++  
Sbjct: 749  CNRIEAMRVQLAKYGVVCRELEDGIEVDGISRSDLKTPVSVHSYDDHRVAMSFSLLSSIM 808

Query: 305  EVPVTIKDPGCTRKTFPDYFEVL 237
              PV I++  C  KT+P +++VL
Sbjct: 809  AAPVAIEERRCVEKTWPGWWDVL 831



>gb:AY746008_1626566 Sclerotinia sclerotiorum arom (arom) gene,
            complete cds.
          Length = 1590

 Score =  118 bits (295), Expect = 2e-25
 Identities = 85/232 (36%), Positives = 120/232 (51%), Gaps = 7/232 (3%)
 Frame = -2

Query: 905  LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
            +M   G+ V  S + +         YK+P    VE DASSA+Y L           +   
Sbjct: 611  MMAAFGIHVVRSQTGEHTYHIPQGVYKNPEEYVVESDASSATYPLAVAATSGTTCTIPNI 670

Query: 725  GTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI-DVNMNKMPDVA 552
            G  S+QGD +FA +VL+  G +V  T+ S TV GPP        L+AI +V+M  M D  
Sbjct: 671  GCKSIQGDARFAIDVLKPTGCKVVQTDYSTTVTGPPIG-----SLQAIEEVDMEPMTDAF 725

Query: 551  MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII--TPPER 378
            +T +V+   A G T IR +A+ RVKE  R+ A+  EL K G T  E  D   +   P + 
Sbjct: 726  LTASVLGAVAKGTTKIRGIANQRVKECNRIKAMKDELAKFGVTCRELEDGIEVDGVPIKD 785

Query: 377  LN--VTEIDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
            L      I  YDDHR+AM+FS L+  A  PV I++  C  KT+P ++++L K
Sbjct: 786  LKHPAEGIHCYDDHRVAMSFSVLSVAASQPVLIEERECVGKTWPGWWDILSK 837



>sp|P08566|ARO1_YEAST Pentafunctional AROM polypeptide [Includes:
            3-dehydroquinate synthase (EC 4.2.3.4); 3-dehydroquinate
            dehydratase (EC 4.2.1.10) (3- dehydroquinase); Shikimate
            5-dehydrogenase (EC 1.1.1.25); Shikimate kinase (EC
            2.7.1.71); 3-phosphoshikimate 1-carboxyvinyltransferase
            (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate
            synthase) (EPSP synthase) (EPSPS)].>pir|A32519|BVBYA1
            3-dehydroquinate synthase (EC 4.2.3.4) - yeast
            (Saccharomyces cerevisiae)>gb:SC9302X_1705785
            S.cerevisiae chromosome IV cosmid 9302.>gb:SCARO1_1706520
            Yeast ARO1 gene for arom multifunctional enzyme.
          Length = 1588

 Score =  118 bits (295), Expect = 2e-25
 Identities = 90/255 (35%), Positives = 128/255 (50%), Gaps = 30/255 (11%)
 Frame = -2

Query: 911  LKLMERXGVSVEHS--DSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXX 738
            +K+ME+ G++VE S  + +  ++ +G   Y +P    +E DASSA+Y L           
Sbjct: 617  IKMMEKFGINVETSTTEPYTYYIPKG--HYINPSEYVIESDASSATYPLAFAAMTGTTVT 674

Query: 737  VEGCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMP 561
            V   G  SLQGD +FA +VL+ MG +++ T  S TV GPP      K L+ +D  M  M 
Sbjct: 675  VPNIGFESLQGDARFARDVLKPMGCKITQTATSTTVSGPPVGTL--KPLKHVD--MEPMT 730

Query: 560  DVAMTLAVVALFAD-------GPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDY 402
            D  +T  VVA  +          T I  +A+ RVKE  R++A+ TEL K G    E PD 
Sbjct: 731  DAFLTACVVAAISHDSDPNSANTTTIEGIANQRVKECNRILAMATELAKFGVKTTELPDG 790

Query: 401  CII----------TPPERLNVTEIDTYDDHRMAMAFSLAACA--------EV--PVTIKD 282
              +           P +      + TYDDHR+AM+FSL A          EV  PV I +
Sbjct: 791  IQVHGLNSIKDLKVPSDSSGPVGVCTYDDHRVAMSFSLLAGMVNSQNERDEVANPVRILE 850

Query: 281  PGCTRKTFPDYFEVL 237
              CT KT+P +++VL
Sbjct: 851  RHCTGKTWPGWWDVL 865



>sp|Q12659|ARO1_PNECA Pentafunctional AROM polypeptide [Includes:
            3-dehydroquinate synthase (EC 4.2.3.4); 3-dehydroquinate
            dehydratase (EC 4.2.1.10) (3- dehydroquinase); Shikimate
            5-dehydrogenase (EC 1.1.1.25); Shikimate kinase (EC
            2.7.1.71); 3-phosphoshikimate 1-carboxyvinyltransferase
            (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate
            synthase) (EPSP synthase) (EPSPS)].>pir|T30832|T30832
            pentafunctional enzyme - Pneumocystis
            carinii>gb:PMCAROMX_1700716 Pneumocystis carinii
            pentafunctional enzyme (arom) gene, complete cds.
          Length = 1581

 Score =  117 bits (294), Expect = 2e-25
 Identities = 80/242 (33%), Positives = 122/242 (50%), Gaps = 12/242 (4%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
            + +M   G+ V  S S +         Y  P    +EGDA+SA+Y L           + 
Sbjct: 608  ISMMSSFGIKVTRSHSKENTYYIPKGCYTCPSEYIIEGDATSATYPLAIAAITGGSCTIS 667

Query: 731  GCGTSSLQGDVKFAE-VLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI-DVNMNKMPD 558
              G++SLQGD KF+E +L+ MG EV  +  +  +KGPP+       L+++  +NM  M D
Sbjct: 668  NVGSASLQGDSKFSEYILKPMGCEVVQSPTTTYIKGPPKG-----KLKSLGSINMESMTD 722

Query: 557  VAMTLAVVALFA-----DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII 393
              +T AV+A  A        T I  +++ R+KE  R+ A+  EL+K G    E PD   +
Sbjct: 723  TFLTAAVLASVAYEESKPYVTKITGISNQRIKECNRINAMVCELKKFGIEAGELPDGIYV 782

Query: 392  TPPERLN----VTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKF 228
                  N    V  I+ Y+DHR+AM+FS+ AC +  P TI D  C  KT+P ++++L   
Sbjct: 783  KALNTSNLPYSVEGINCYNDHRIAMSFSVLACISSKPTTILDKACVNKTWPYWWDILNST 842

Query: 227  SK 222
             K
Sbjct: 843  FK 844



>sp|Q9HQC1|AROA_HALN1 Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>pir|F84278|F84278 3-phosphoshikimate
           1-carboxyvinyltransferase [imported] - Halobacterium sp.
           NRC-1>gb:AE005049_62754 Halobacterium sp. NRC-1 section
           80 of 170 of the complete genome.>gb:AE004437_887673
           Halobacterium sp. NRC-1 complete genome.
          Length = 439

 Score =  117 bits (292), Expect = 4e-25
 Identities = 83/233 (35%), Positives = 119/233 (51%), Gaps = 8/233 (3%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAF-VEGDASSASYFLXXXXXXXXXXXV 735
           L +++  GV    S++   + +RGGQ Y   G  + V GD SSASY L            
Sbjct: 209 LDVLDAFGVGA--SETAAGYRVRGGQAYAPSGAEYAVPGDFSSASYLLAAGALAAADGAA 266

Query: 734 ---EGCGTSSLQGDVKFAEVLEKMGAEVSWTENS--VTVKGPPRAPSGRKHLRAIDVNMN 570
              EG   S+ QGD    +VLE+MGA++ W   S  +TV+        R  L  ++V + 
Sbjct: 267 VVVEGMHPSA-QGDAAIVDVLERMGADIDWDTESGVITVQ--------RSELSGVEVGVA 317

Query: 569 KMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIIT 390
             PD+  T+AV+   ADG T I D    R KET+R+ A+   L KLGA+VEE PD  ++ 
Sbjct: 318 DTPDLLPTIAVLGAAADGTTRITDAEHVRYKETDRVAAMAESLSKLGASVEERPDELVVR 377

Query: 389 PPE-RLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVL 237
             +  L+   +D   DHR+ MA ++A   A+   TI        +FPD+FEVL
Sbjct: 378 GGDTELSGASVDGRGDHRLVMALAVAGLVADGETTIAGSEHVDVSFPDFFEVL 430



>gb:AF496781_1805693 Zea mays cultivar DE811 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496785_1805697 Zea mays cultivar D_7
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496786_1805698 Zea mays cultivar
           Mo17 3-phosphoshikimate 1-carboxyvinyltransferase gene,
           3'UTR and partial cds.
          Length = 61

 Score =  116 bits (291), Expect = 5e-25
 Identities = 53/61 (86%), Positives = 57/61 (93%)
 Frame = -2

Query: 401 CIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
           CIITPPE+LNVT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K
Sbjct: 1   CIITPPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVK 60

Query: 221 H 219
           +
Sbjct: 61  N 61



>gb:CR382126_1659229 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 1578

 Score =  116 bits (291), Expect = 5e-25
 Identities = 89/246 (36%), Positives = 125/246 (50%), Gaps = 21/246 (8%)
 Frame = -2

Query: 911  LKLMERXGVSVEHS--DSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXX 738
            +K+M+  G+ V  S  + +   + +G   Y +P    +E DASSA+Y L           
Sbjct: 618  IKMMDAFGIKVTTSTTEPFTYHIPKGN--YINPAEYTIESDASSATYPLSFAAITGTTVT 675

Query: 737  VEGCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMP 561
            V   G++SLQGD +FA +VL  MG EV+ T  S TV GPPR     K L+ +D  M  M 
Sbjct: 676  VPNIGSASLQGDARFAVDVLRPMGCEVTQTATSTTVTGPPRGQ--LKPLKHVD--MEPMT 731

Query: 560  DVAMTLAVVALFAD----GPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII 393
            D  +T +VVA   +      T I  +A+ RVKE  R+ A+ T+L K G    E PD   I
Sbjct: 732  DAFLTASVVAAICNNGTTNTTTIEGIANQRVKECNRIEAMVTQLAKFGVRANELPDGIQI 791

Query: 392  TPPERLNVTE------IDTYDDHRMAMAFSLAACA--------EVPVTIKDPGCTRKTFP 255
                 ++         I+TYDDHR+AM+FSL A          E  V I +  CT KT+P
Sbjct: 792  HGVNSISELRQPSDAGIETYDDHRVAMSFSLLAGMVNSDKKDDESSVRILERQCTGKTWP 851

Query: 254  DYFEVL 237
             +++VL
Sbjct: 852  GWWDVL 857



>gb:A18838_1447806 aroA gene.
          Length = 427

 Score =  116 bits (290), Expect = 7e-25
 Identities = 77/230 (33%), Positives = 109/230 (47%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV +EH D++  F I+G Q   SPG+  VEGDASSASYFL             
Sbjct: 207 LHIMNSSGVVIEH-DNYKLFYIKGNQSIVSPGDFLVEGDASSASYFLAAGAIKGKVRVT- 264

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+ GD+ FA+VLE+MGA ++W ++ +  +  P        L  +D++MN +PDV 
Sbjct: 265 GIGKHSI-GDIHFADVLERMGARITWGDDFIEAEQGP--------LHGVDMDMNHIPDVG 315

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
              +  +                V++           R      EEG  +      +   
Sbjct: 316 HDHSGQSHCLPRVPPHSQHLQLAVRDDRCTPCTHGHRRAQAGVSEEGTTFITRDAADPAQ 375

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
                     R+AM FSL A +++ VTI DPGCT KTFPDYF+ L   S+
Sbjct: 376 ARRDRHLQASRIAMCFSLVALSDIAVTINDPGCTSKTFPDYFDKLASVSQ 425



>gb:AEOAROA_466713 Aeromonas salmonicida
           3-phosphoshikimate-1-carboxyvinyltransferase (aroA)
           gene, 3' end cds.
          Length = 426

 Score =  116 bits (290), Expect = 7e-25
 Identities = 77/230 (33%), Positives = 109/230 (47%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV +EH D++  F I+G Q   SPG+  VEGDASSASYFL             
Sbjct: 206 LHIMNSSGVVIEH-DNYKLFYIKGNQSIVSPGDFLVEGDASSASYFLAAGAIKGKVRVT- 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+ GD+ FA+VLE+MGA ++W ++ +  +  P        L  +D++MN +PDV 
Sbjct: 264 GIGKHSI-GDIHFADVLERMGARITWGDDFIEAEQGP--------LHGVDMDMNHIPDVG 314

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
              +  +                V++           R      EEG  +      +   
Sbjct: 315 HDHSGQSHCLPRVPPHSQHLQLAVRDDRCTPCTHGHRRAQAGVSEEGTTFITRDAADPAQ 374

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
                     R+AM FSL A +++ VTI DPGCT KTFPDYF+ L   S+
Sbjct: 375 ARRDRHLQRSRIAMCFSLVALSDIAVTINDPGCTSKTFPDYFDKLASVSQ 424



>pir|I39539|I39539 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Aeromonas salmonicida (fragment)
          Length = 426

 Score =  116 bits (290), Expect = 7e-25
 Identities = 77/230 (33%), Positives = 109/230 (47%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M   GV +EH D++  F I+G Q   SPG+  VEGDASSASYFL             
Sbjct: 206 LHIMNSSGVVIEH-DNYKLFYIKGNQSIVSPGDFLVEGDASSASYFLAAGAIKGKVRVT- 263

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+ GD+ FA+VLE+MGA ++W ++ +  +  P        L  +D++MN +PDV 
Sbjct: 264 GIGKHSI-GDIHFADVLERMGARITWGDDFIEAEQGP--------LHGVDMDMNHIPDVG 314

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
              +  +                V++           R      EEG  +      +   
Sbjct: 315 HDHSGQSHCLPRVPPHSQHLQLAVRDDRCTPCTHGHRRAQAGVSEEGTTFITRDAADPAQ 374

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
                     R+AM FSL A +++ VTI DPGCT KTFPDYF+ L   S+
Sbjct: 375 ARRDRHLQRSRIAMCFSLVALSDIAVTINDPGCTSKTFPDYFDKLASVSQ 424



>sp|Q97KM2|AROA_CLOAB 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|D97010|D97010
           5-enolpyruvylshikimate-3-phosphate synthase [imported] -
           Clostridium acetobutylicum>gb:AE007605_228232
           Clostridium acetobutylicum ATCC 824 section 93 of 356 of
           the complete genome.>gb:AE001437_1091187 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 428

 Score =  115 bits (289), Expect = 9e-25
 Identities = 76/229 (33%), Positives = 127/229 (55%), Gaps = 2/229 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAF-VEGDASSASYFLXXXXXXXXXXXV 735
           + ++++ G+ +E+  ++  F I+G QK K  G  + VEGD S A+++L            
Sbjct: 202 IDMLKKFGIEIENK-AYKSFFIKGNQKCK--GTKYKVEGDFSQAAFWLSAGILNGNINCK 258

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDV 555
           +    SSLQGD    ++L+KMG  +   E S + K        + H   I ++ ++ PD+
Sbjct: 259 D-LNISSLQGDKVILDILKKMGGAID--EKSFSSK--------KSHTHGIVIDASQCPDL 307

Query: 554 AMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERL 375
              L+VVA  ++G T I + A  R+KE++R+ A+ TEL KLGA V E  D  +I   E+L
Sbjct: 308 VPILSVVAALSEGTTKIVNAARLRIKESDRLKAMATELNKLGAEVVELEDGLLIEGKEKL 367

Query: 374 NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQK 231
              E+++++DHR+AMA  +AA   E  VTI    C  K++P ++  L++
Sbjct: 368 KGGEVESWNDHRIAMALGIAALRCEESVTINGSECVSKSYPQFWSDLKQ 416



>gb:AF496777_1805689 Zea mays cultivar CO109 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496783_1805695 Zea mays cultivar B84
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496787_1805699 Zea mays cultivar
           F_1 3-phosphoshikimate 1-carboxyvinyltransferase gene,
           3'UTR and partial cds.>gb:AF496788_1805700 Zea mays
           cultivar D_6 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial cds.
          Length = 61

 Score =  114 bits (286), Expect = 2e-24
 Identities = 52/61 (85%), Positives = 56/61 (91%)
 Frame = -2

Query: 401 CIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
           CIITPPE+LNVT IDTYDDHRMAMAFSLAACAEVPV I+DPGCTRKTFPDYF+VL  F K
Sbjct: 1   CIITPPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVAIRDPGCTRKTFPDYFDVLSTFVK 60

Query: 221 H 219
           +
Sbjct: 61  N 61



>sp|Q8XMJ2|AROA_CLOPE 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:BA000016_673736
           Clostridium perfringens str. 13 DNA, complete genome.
          Length = 424

 Score =  114 bits (285), Expect = 3e-24
 Identities = 75/225 (33%), Positives = 126/225 (56%), Gaps = 2/225 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L ++E+ GV++++++ +  FLI+G Q YK P N  VEGD S A+++            ++
Sbjct: 199 LDMIEKFGVTIKNNN-YREFLIKGNQSYK-PMNYKVEGDYSQAAFYFSAGALGSEINCLD 256

Query: 731 GCGTSSLQGDVKFAEVLEKMGAE-VSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDV 555
               SS QGD +  E+LE MGA  +   E S+++            L    ++ ++ PD+
Sbjct: 257 -LDLSSYQGDKECIEILEGMGARLIESQERSLSII--------HGDLNGTIIDASQCPDI 307

Query: 554 AMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERL 375
              L VVA  + G T I +    R+KE +R+ A+CTEL KLGA ++E  D  II   + L
Sbjct: 308 IPVLTVVAALSKGETRIINGERLRIKECDRLNAICTELNKLGADIKELKDGLIINGVKDL 367

Query: 374 NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFE 243
              E+ ++ DHR+AM+ ++A+   +  V IK+P C +K++P ++E
Sbjct: 368 IGGEVYSHKDHRIAMSLAIASTRCKKEVIIKEPDCVKKSYPGFWE 412



>gb:AF496763_1805675 Zea mays cultivar F_6 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496765_1805677 Zea mays cultivar 647
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496766_1805678 Zea mays cultivar
           J40 3-phosphoshikimate 1-carboxyvinyltransferase gene,
           3'UTR and partial cds.>gb:AF496768_1805680 Zea mays
           cultivar F_5 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496770_1805682 Zea mays cultivar F_4
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496771_1805683 Zea mays cultivar
           H_4 3-phosphoshikimate 1-carboxyvinyltransferase gene,
           3'UTR and partial cds.>gb:AF496775_1805687 Zea mays
           cultivar B73 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496778_1805690 Zea mays cultivar IVANA
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496779_1805691 Zea mays cultivar
           D71-4HT 3-phosphoshikimate 1-carboxyvinyltransferase
           gene, 3'UTR and partial cds.>gb:AF496782_1805694 Zea
           mays cultivar H60 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496784_1805696 Zea mays cultivar TX601
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496789_1805701 Zea mays cultivar
           D_9 3-phosphoshikimate 1-carboxyvinyltransferase gene,
           3'UTR and partial cds.
          Length = 60

 Score =  113 bits (282), Expect = 6e-24
 Identities = 52/60 (86%), Positives = 56/60 (93%)
 Frame = -2

Query: 398 IITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           IITPPE+LNVT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 1   IITPPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 60



>gb:AY849805_1630796 Pichia pastoris AROM pentafunctional enzyme
            (ARO1) gene, partial cds.
          Length = 1539

 Score =  113 bits (282), Expect = 6e-24
 Identities = 80/211 (37%), Positives = 114/211 (54%), Gaps = 13/211 (6%)
 Frame = -2

Query: 830  YKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFA-EVLEKMGAEVSW 654
            Y +P    +E DASSA+Y L           +   G+SSLQGD +FA +VL+ MG +V  
Sbjct: 626  YVNPAEYVIESDASSATYPLAFAAMNGTQVTIPNIGSSSLQGDARFAVDVLKPMGCKVEQ 685

Query: 653  TENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADG---PTAIRDVASWR 483
            T  S TV+GP +     K L  +D  M  M D  +T +VVA  A+     T+I  +++ R
Sbjct: 686  TATSTTVQGPTKGT--LKPLPLVD--MEPMTDAFLTASVVAAIANDTNQSTSIVGISNQR 741

Query: 482  VKETERMIAVCTELRKLGATVEE--------GPDYCIITPPERLNVTEIDTYDDHRMAMA 327
            VKE  R+ A+ T+L K G   +E        G DY  +  P       + TYDDHR+AM+
Sbjct: 742  VKECNRIEAMITQLAKFGVRAKELEDGIEVFGIDYHHLKTPS----DGVYTYDDHRVAMS 797

Query: 326  FS-LAACAEVPVTIKDPGCTRKTFPDYFEVL 237
             S LA  AE PV I++  CT KT+P ++++L
Sbjct: 798  LSLLAGLAESPVLIQERHCTGKTWPGWWDIL 828



>gb:AF482690_1804023 Thanatephorus cucumeris arom polypeptide gene,
            complete cds.
          Length = 1618

 Score =  112 bits (279), Expect = 1e-23
 Identities = 89/247 (36%), Positives = 123/247 (49%), Gaps = 22/247 (8%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIR----GGQKYKSPGNAFVEGDASSASYFLXXXXXXXXX 744
            L +M+  GV V    + D  L+        +Y +P    +E DASSA+Y L         
Sbjct: 627  LAMMKTFGVEVTRRKAEDGTLLDIYDIPRAQYTNPEKYAIESDASSATYPLAVAAITGTT 686

Query: 743  XXVEGCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAID-VNMN 570
              +E  GTSSLQGD  FA  VL++MG +V  +EN  TV GPP        L+AI  V+M 
Sbjct: 687  CTIENIGTSSLQGDAGFAVNVLKRMGCKVEQSENETTVTGPPIG-----QLKAIGLVDME 741

Query: 569  KMPDVAMTLAVVA----------LFADGP---TAIRDVASWRVKETERMIAVCTELRKLG 429
             M D  +T  VVA          L +D P   T I  +A+ RVKE  R+ A+  EL K G
Sbjct: 742  TMTDAFLTAVVVAAVCGEGSAEGLESDVPKNTTRILGIANQRVKECNRIRAMIDELAKFG 801

Query: 428  ATVEEGPDYCII--TPPERLNV-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTF 258
               +E  D   +   P E LN    +  YDDHR+AMAFS+ A       +++  C  KT+
Sbjct: 802  VKTKELDDGLEVYGQPIETLNKNVSVHCYDDHRVAMAFSVLATVVPGTILEEKRCVEKTW 861

Query: 257  PDYFEVL 237
            P++++ L
Sbjct: 862  PNWWDDL 868



>sp|Q9P7R0|ARO1_SCHPO Pentafunctional AROM polypeptide [Includes:
            3-dehydroquinate synthase (EC 4.2.3.4); 3-dehydroquinate
            dehydratase (EC 4.2.1.10) (3- dehydroquinase); Shikimate
            5-dehydrogenase (EC 1.1.1.25); Shikimate kinase (EC
            2.7.1.71); 3-phosphoshikimate 1-carboxyvinyltransferase
            (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate
            synthase) (EPSP synthase) (EPSPS)].>pir|T50113|T50113
            3-dehydroquinate synthase (EC 4.2.3.4) - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC1834_1716817 S.pombe
            chromosome I cosmid c1834.
          Length = 1573

 Score =  112 bits (279), Expect = 1e-23
 Identities = 88/243 (36%), Positives = 121/243 (49%), Gaps = 16/243 (6%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
            + +M   GV+V  S + +        KY++P +  +E DASSA+Y L           V 
Sbjct: 605  IAMMASFGVNVTKSTTEENTYNIPCGKYQNPPHYEIESDASSATYPLAIAAITGTKCTVP 664

Query: 731  GCGTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDV 555
              G++SLQGD +FA +VL  MG  V  T  S TV+GPP+     K L +ID  M  M D 
Sbjct: 665  NIGSASLQGDARFACDVLRPMGCTVEQTATSTTVQGPPKGT--LKPLESID--METMTDA 720

Query: 554  AMTLAVVALFA------DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEE------- 414
             +T +VVA  A      D  T I  +A+ RVKE  R+ A+  EL K G    E       
Sbjct: 721  FLTASVVAAVACNVSEGDPVTRITGIANQRVKECNRIAAMVHELAKFGVRTGELEDGIYI 780

Query: 413  -GPDYCIITPPERLNVTEIDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEV 240
             G +Y  +  PE      I TYDDHR+AM+FS L+        I D  C  KT+P +++V
Sbjct: 781  FGKNYKELKKPEE----GIYTYDDHRIAMSFSVLSLICPSRTLIIDKACVEKTWPYWWDV 836

Query: 239  LQK 231
            L +
Sbjct: 837  LHQ 839



>gb:AF496762_1805674 Zea mays cultivar C_5 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496764_1805676 Zea mays cultivar B_1
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496772_1805684 Zea mays cultivar
           B_6 3-phosphoshikimate 1-carboxyvinyltransferase gene,
           3'UTR and partial cds.>gb:AF496773_1805685 Zea mays
           cultivar G_1 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial
           cds.>gb:AF496774_1805686 Zea mays cultivar F_2
           3-phosphoshikimate 1-carboxyvinyltransferase gene, 3'UTR
           and partial cds.>gb:AF496780_1805692 Zea mays cultivar
           684 3-phosphoshikimate 1-carboxyvinyltransferase gene,
           3'UTR and partial cds.
          Length = 59

 Score =  111 bits (278), Expect = 2e-23
 Identities = 51/59 (86%), Positives = 55/59 (93%)
 Frame = -2

Query: 395 ITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           ITPPE+LNVT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 1   ITPPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 59



>sp|Q8THH3|AROA_METAC Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>gb:AE011175_269819 Methanosarcina
           acetivorans str. C2A, section 520 of 534 of the complete
           genome.>gb:AE010299_910378 Methanosarcina acetivorans
           str. C2A, complete genome.
          Length = 430

 Score =  111 bits (278), Expect = 2e-23
 Identities = 79/227 (34%), Positives = 118/227 (51%), Gaps = 4/227 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSD--SWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXX 738
           ++++E  GV + H+D  +  +F+I G QKY       + GD SSASY L           
Sbjct: 199 IEMLELAGVKI-HTDENNGTKFIIPGKQKYDLKEYT-IPGDFSSASYLLAAAAMTEGSEI 256

Query: 737 VEGCGTSSLQGDVKFAEVLEKMGAEVSWTENS--VTVKGPPRAPSGRKHLRAIDVNMNKM 564
                  S QGD    E L++MGA+++W   +  VTV+G      GRK L+A+  +    
Sbjct: 257 TVKNLFPSKQGDKLIIETLKQMGADITWDREAGIVTVRG------GRK-LKAVTFDAGAT 309

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
           PD+  T+AV+A  A+G + I +    R KET+R+ A+ TEL KLG  ++E  D   IT  
Sbjct: 310 PDLVPTVAVLAAVAEGTSRIENAEHVRYKETDRLSALATELPKLGVKLKEEKDSLTITGG 369

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
           E L   E+  +DDHR+ M+ +LA       TI        ++PD+FE
Sbjct: 370 E-LKGAEVHGWDDHRIVMSLALAGMVAGNTTIDTTESVAISYPDFFE 415



>gb:AF496769_1805681 Zea mays cultivar F_3 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial cds.
          Length = 60

 Score =  111 bits (277), Expect = 2e-23
 Identities = 51/60 (85%), Positives = 55/60 (91%)
 Frame = -2

Query: 398 IITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           IITPPE+LNVT IDTYDDHRMAMAFSLAACAEVPV I+DPGCTRKTFPDYF+VL  F K+
Sbjct: 1   IITPPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVAIRDPGCTRKTFPDYFDVLSTFVKN 60



>gb:AF496776_1805688 Zea mays cultivar I_1 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial cds.
          Length = 59

 Score =  109 bits (273), Expect = 7e-23
 Identities = 50/59 (84%), Positives = 54/59 (91%)
 Frame = -2

Query: 395 ITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           ITPPE+LNVT IDTYDDHRMAMAFSLAACAEVPV I+DPGCTRKTFPDYF+VL  F K+
Sbjct: 1   ITPPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVAIRDPGCTRKTFPDYFDVLSTFVKN 59



>gb:AF170673_485249 Klebsiella pneumoniae strain TCVGH33
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, partial cds.
          Length = 153

 Score =  109 bits (272), Expect = 9e-23
 Identities = 59/124 (47%), Positives = 81/124 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV V++  S+ RF++RG Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 39  LHLMKTFGVEVDNQ-SYQRFVVRGKQQYQSPGDYLVEGDASSASYFLAAGAIKGGTVKVT 97

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G  S+QGD++FA+VLEKMGA V+W ++ +           R  L+AID++MN +PD A
Sbjct: 98  GIGRGSVQGDIRFADVLEKMGATVTWGDDFIACT--------RGELKAIDMDMNHIPDAA 149

Query: 551 MTLA 540
           MT+A
Sbjct: 150 MTIA 153



>gb:AF496790_1805702 Zea mays cultivar C_9 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial cds.
          Length = 57

 Score =  108 bits (269), Expect = 2e-22
 Identities = 49/57 (85%), Positives = 53/57 (92%)
 Frame = -2

Query: 389 PPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           PPE+LNVT IDTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 1   PPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 57



>gb:AF496761_1805673 Zea mays cultivar H_1 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial cds.
          Length = 58

 Score =  108 bits (269), Expect = 2e-22
 Identities = 49/58 (84%), Positives = 53/58 (91%)
 Frame = -2

Query: 392 TPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           TPPE+LNVT IDTYDDHRMAMAFSLAACAEVPV I+DPGCTRKTFPDYF+VL  F K+
Sbjct: 1   TPPEKLNVTAIDTYDDHRMAMAFSLAACAEVPVAIRDPGCTRKTFPDYFDVLSTFVKN 58



>gb:AF170670_485246 Klebsiella pneumoniae strain TCVGH12
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, partial cds.>gb:AY016731_584991 Klebsiella
           pneumoniae strain L25 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) gene, aroA4 allele,
           partial cds.
          Length = 153

 Score =  107 bits (267), Expect = 3e-22
 Identities = 57/124 (45%), Positives = 81/124 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV V++  S+ RF++RG Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 39  LHLMKTFGVEVDNQ-SYQRFVVRGKQQYQSPGDYLVEGDASSASYFLAAGAIKGGTVKVT 97

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA V+W ++ +              L+A+D++MN +PD A
Sbjct: 98  GIGRNSVQGDIRFADVLEKMGATVTWGDDFIACT--------HGELKAVDMDMNHIPDAA 149

Query: 551 MTLA 540
           MT+A
Sbjct: 150 MTIA 153



>gb:AF170667_485243 Klebsiella pneumoniae strain TCVGH1
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, partial cds.>gb:AF170668_485244 Klebsiella
           pneumoniae strain TCVGH6 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) gene, partial
           cds.>gb:AF170669_485245 Klebsiella pneumoniae strain
           TCVGH7 3-phosphoshikimate 1-carboxyvinyltransferase
           (aroA) gene, partial cds.>gb:AF170672_485248 Klebsiella
           pneumoniae strain TCVGH25 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) gene, aroA-9 allele,
           partial cds.>gb:AF170675_485251 Klebsiella pneumoniae
           strain PCH1 3-phosphoshikimate 1-carboxyvinyltransferase
           (aroA) gene, aroA-12 allele, partial
           cds.>gb:AF170676_485252 Klebsiella pneumoniae strain
           KSCGH7 3-phosphoshikimate 1-carboxyvinyltransferase
           (aroA) gene, partial cds.>gb:AF170677_485253 Klebsiella
           pneumoniae strain NTUH2 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) gene, partial
           cds.>gb:AY016728_584988 Klebsiella pneumoniae strain L1
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, aroA1 allele, partial cds.>gb:AY016729_584989
           Klebsiella pneumoniae strain L10 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) gene, aroA2 allele,
           partial cds.>gb:AY016730_584990 Klebsiella pneumoniae
           strain L11 3-phosphoshikimate 1-carboxyvinyltransferase
           (aroA) gene, aroA3 allele, partial
           cds.>gb:AY016732_584992 Klebsiella pneumoniae strain L27
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, aroA5 allele, partial cds.>gb:AY016734_584994
           Klebsiella pneumoniae strain L65 3-phosphoshikimate
           1-carboxyvinyltransferase (aroA) gene, aroA7 allele,
           partial cds.>gb:AY016735_584995 Klebsiella pneumoniae
           strain CCH6 3-phosphoshikimate 1-carboxyvinyltransferase
           (aroA) gene, aroA11 allele, partial
           cds.>gb:AY016736_584996 Klebsiella pneumoniae strain P8
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, aroA13 allele, partial cds.
          Length = 153

 Score =  107 bits (267), Expect = 3e-22
 Identities = 57/124 (45%), Positives = 81/124 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV V++  S+ RF++RG Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 39  LHLMKTFGVEVDNQ-SYQRFVVRGKQQYQSPGDYLVEGDASSASYFLAAGAIKGGTVKVT 97

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA V+W ++ +              L+A+D++MN +PD A
Sbjct: 98  GIGRNSVQGDIRFADVLEKMGATVTWGDDFIACT--------HGELKAVDMDMNHIPDAA 149

Query: 551 MTLA 540
           MT+A
Sbjct: 150 MTIA 153



>gb:AY596297_631663 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 429

 Score =  106 bits (265), Expect = 6e-22
 Identities = 74/230 (32%), Positives = 112/230 (48%), Gaps = 5/230 (2%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAF-VEGDASSASYFLXXXXXXXXXXXV 735
           L++++  GV  E +D+   F + GGQ Y   G  + V GD SS SY L            
Sbjct: 201 LEVLDAFGVDAEKTDAG--FTVDGGQTYVPDGGDYNVPGDFSSMSYLLAAGALAAEDGLQ 258

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTEN--SVTVKGPPRAPSGRKHLRAIDVNMNKMP 561
                 S QGD    ++L++MGA++ W E    +TV         +  L  I+V +   P
Sbjct: 259 VTSAFPSAQGDAAIVDILDRMGADLDWDEEHGEITVS--------QSELTGIEVGVEDTP 310

Query: 560 DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE 381
           D+  T+A +   ADG T I D    R KET+R+ A+  EL K+GA VEE  D   +   +
Sbjct: 311 DLLPTIATLGAAADGVTRITDAEHVRYKETDRVSAMAEELTKMGAEVEEHQDELFVYGAD 370

Query: 380 R-LNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVL 237
             L  T ++   DHR+ M+ ++A   A+   T+        +FPD+F+VL
Sbjct: 371 SDLVGTTVEGRADHRIIMSLAVAGLVADGETTVTGAEHVDVSFPDFFDVL 420



>gb:AY016733_584993 Klebsiella pneumoniae strain L51
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, aroA6 allele, partial cds.
          Length = 153

 Score =  106 bits (265), Expect = 6e-22
 Identities = 57/124 (45%), Positives = 81/124 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV V++  S+ RF++RG Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 39  LHLMKTFGVEVDNQ-SYQRFVVRGKQQYQSPGDYLVEGDASSASYFLAAGAIKGGTVKVI 97

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA V+W ++ +              L+A+D++MN +PD A
Sbjct: 98  GIGRNSVQGDIRFADVLEKMGATVTWGDDFIACT--------HGELKAVDMDMNHIPDAA 149

Query: 551 MTLA 540
           MT+A
Sbjct: 150 MTIA 153



>gb:AF170671_485247 Klebsiella pneumoniae strain TCVGH23
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, aroA-8 allele, partial cds.
          Length = 153

 Score =  106 bits (265), Expect = 6e-22
 Identities = 57/124 (45%), Positives = 81/124 (65%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV V++  S+ RF++RG Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 39  LHLMKTFGVEVDNQ-SYQRFVVRGKQQYQSPGDYLVEGDASSASYFLAAGAIKGGTVKVT 97

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA V+W ++ +              L+A+D++MN +PD A
Sbjct: 98  GIGRNSVQGDIRFADVLEKMGAIVTWGDDFIACT--------HGELKAVDMDMNHIPDAA 149

Query: 551 MTLA 540
           MT+A
Sbjct: 150 MTIA 153



>gb:AE017342_1754855 Cryptococcus neoformans var. neoformans JEC21
            chromosome 2, complete sequence.
          Length = 1611

 Score =  105 bits (262), Expect = 1e-21
 Identities = 77/218 (35%), Positives = 109/218 (50%), Gaps = 19/218 (8%)
 Frame = -2

Query: 830  YKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFA-EVLEKMGAEVSW 654
            Y +P    VE DASSA+Y L           +   G+SSLQGD +FA E+LE MG  V  
Sbjct: 646  YVNPPEYSVESDASSATYPLAIAAITGTTCTISNIGSSSLQGDARFAKEILEPMGCIVEQ 705

Query: 653  TENSVTVKGPPRAPSGRKHLRAI-DVNMNKMPDVAMTLAVVALFADGP------------ 513
            T  S  V GPP        LRA+ +V+M  M D  +T +V+A  A  P            
Sbjct: 706  TLTSTKVTGPPVGT-----LRALGNVDMEPMTDAFLTASVLAAVAVKPCLPERKVEGLPE 760

Query: 512  --TAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNV---TEIDTYD 348
              + I  +A+ RVKE  R+ A+  +L K G   +E  D  II      ++     I  YD
Sbjct: 761  TASRIYGIANQRVKECNRIQAMRDQLAKFGIETDEFDDGIIIFGKPEASLFRGASIHCYD 820

Query: 347  DHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQ 234
            DHR+AMAF++ +C      I++  C  KT+P++++ LQ
Sbjct: 821  DHRVAMAFAVLSCIIDETIIEEKRCVEKTWPNFWDDLQ 858



>gb:AF170674_485250 Klebsiella pneumoniae strain TCVGH35
           3-phosphoshikimate 1-carboxyvinyltransferase (aroA)
           gene, aroA-10 allele, partial cds.
          Length = 153

 Score =  104 bits (259), Expect = 3e-21
 Identities = 56/124 (45%), Positives = 80/124 (64%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L LM+  GV V++  S+ RF++ G Q+Y+SPG+  VEGDASSASYFL           V 
Sbjct: 39  LHLMKTFGVEVDNQ-SYQRFVVCGKQQYQSPGDYLVEGDASSASYFLAAGAIKGGTVKVT 97

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD++FA+VLEKMGA V+W ++ +              L+A+D++MN +PD A
Sbjct: 98  GIGRNSVQGDIRFADVLEKMGATVTWGDDFIACT--------HGELKAVDMDMNHIPDAA 149

Query: 551 MTLA 540
           MT+A
Sbjct: 150 MTIA 153



>gb:AY775558_645910 Actinobacillus suis AroA (aroA) gene, partial
           cds.
          Length = 285

 Score =  103 bits (258), Expect = 4e-21
 Identities = 57/139 (41%), Positives = 85/139 (61%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M+  GV+VE+ + +  F+++G Q Y SP    VEGDASSASYFL             
Sbjct: 156 LAMMKDFGVNVENQN-YQTFVVKGNQSYISPEKYLVEGDASSASYFLAAGAIKGKVKV-P 213

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA VLE MGA+++W ++ +  +        +  L+ +D++MN +PD A
Sbjct: 214 GIGKNSIQGDRLFANVLEAMGAKITWGDDFIQAE--------QGELKGVDMDMNHIPDAA 265

Query: 551 MTLAVVALFADGPTAIRDV 495
           MT+A  ALFA+G T IR++
Sbjct: 266 MTIATTALFAEGETVIRNI 284



>gb:BX649607_1643501 Aspergillus fumigatus BAC pilot project
            supercontig; segment 3/3.
          Length = 1582

 Score =  102 bits (253), Expect = 1e-20
 Identities = 81/240 (33%), Positives = 117/240 (48%), Gaps = 13/240 (5%)
 Frame = -2

Query: 905  LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
            +M   G+ V+ S + +        +Y +P    VE DASSA+Y L           +   
Sbjct: 607  MMRSFGIDVKKSTTEEHTYHIPQGRYINPAEYVVESDASSATYPLAIAAVTGTTCTIPNI 666

Query: 725  GTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAI-DVNMNKMPDVA 552
            G+ SLQGD +FA +VL  MG  V  T+ S TV GP         LR + +V+M  M D  
Sbjct: 667  GSKSLQGDARFAVDVLRPMGCTVEQTDTSTTVTGPADGV-----LRPLPNVDMEPMTDAF 721

Query: 551  MTLAVVALFADG-----PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
            +  +V+A  A G      T I  +A+ RVKE  R+ A+  EL K G    E  D   I  
Sbjct: 722  LGASVLAAIARGKDSNHTTRIYGIANQRVKECNRIKAMHDELAKFGVVCREHDDGLEIDG 781

Query: 386  PERLNVTE----IDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVL-QKFS 225
             +R  + +    +  YDDHR+A +FS L+  A  P  I +  C  KT+P +++ L QKF+
Sbjct: 782  IDRSTLRQPAGGVFCYDDHRVAFSFSVLSLIAPKPTLILEKECVGKTWPGWWDTLRQKFA 841



>sp|Q8TXN4|AROA_METKA Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>gb:AE010356_262260 Methanopyrus
           kandleri AV19 section 55 of 157 of the complete
           genome.>gb:AE009439_903041 Methanopyrus kandleri AV19,
           complete genome.
          Length = 428

 Score =  101 bits (252), Expect = 2e-20
 Identities = 73/226 (32%), Positives = 111/226 (49%), Gaps = 1/226 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           ++ +ER GVSV    S   F + G  + +SPG   VE D SSA YF+            E
Sbjct: 206 VETLERFGVSVVREGS--SFEVEG--RPRSPGKLRVENDWSSAGYFVALGAIGGEMRI-E 260

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G    S   D +  E+  +MGAEV   +  + V+   R       L  ++V+++  PD+ 
Sbjct: 261 GVDLDSSHPDRRIVEITREMGAEVRRIDGGIVVRSTGR-------LEGVEVDLSDSPDLV 313

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
            T+A +A FA+G T I +V   R KE +R+ A+  EL K G  V EG D+  I   E + 
Sbjct: 314 PTVAAMACFAEGVTRIENVGHLRYKEVDRLRALAAELPKFGVEVREGKDWLEIVGGEPVG 373

Query: 371 VTEIDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVL 237
              +D+  DHRMAMA + + A A     ++       ++P ++E L
Sbjct: 374 -ARVDSRGDHRMAMALAVVGAFARGKTVVERADAVSISYPRFWEDL 418



>sp|Q8PXI0|AROA_METMA Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>gb:AE013354_291568 Methanosarcina
           mazei strain Goe1, section 136 of 379 of the complete
           genome.>gb:AE008384_965677 Methanosarcina mazei strain
           Goe1, complete genome.
          Length = 430

 Score =  100 bits (248), Expect = 5e-20
 Identities = 72/226 (31%), Positives = 114/226 (50%), Gaps = 3/226 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDS-WDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXV 735
           ++++   GV +   D+   +F+I G QKY       V GD SSASY L            
Sbjct: 199 IEMLGLAGVKIHTDDNNGTKFIIPGKQKYDLKQYT-VPGDFSSASYLLAAAAMLEGSEIT 257

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTENS--VTVKGPPRAPSGRKHLRAIDVNMNKMP 561
                 S QGD    + L++MGA+++W   +  VTV+G      GRK L+AI  +    P
Sbjct: 258 VKNLFPSKQGDKVIIDTLKQMGADITWDMEAGIVTVRG------GRK-LKAITFDAGSTP 310

Query: 560 DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE 381
           D+  T+AV+A  A+G + I +    R KET+R+ A+ TEL K+G +++E  D   IT   
Sbjct: 311 DLVPTVAVLASVAEGTSRIENAEHVRYKETDRLHALATELPKMGVSLKEEMDSLTIT-GG 369

Query: 380 RLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
            L   E+  +DDHR+ M+ ++A        +        ++PD+F+
Sbjct: 370 TLEGAEVHGWDDHRIVMSLAIAGMVAGNTIVDTTESVSISYPDFFK 415



>gb:BX908798_830438 Parachlamydia-related symbiont UWE25, complete
            genome.
          Length = 939

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 69/228 (30%), Positives = 117/228 (51%), Gaps = 1/228 (0%)
 Frame = -2

Query: 911  LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
            L  + R GVS  + + ++ F I G Q+ +      + GD S+A++ +           + 
Sbjct: 714  LHWLNRLGVSYINQN-YEYFKIEGIQQ-RPHFEVNIPGDLSAAAFPVAAAILTQSKITLY 771

Query: 731  GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
                S +QGD +   VL++MGA++   + S T+   P A      L+   +++N   D  
Sbjct: 772  NVDMSDVQGDKQVIHVLQEMGADIQIDQASHTLTVLPGAL-----LKGTTIDVNPFIDAV 826

Query: 551  MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
              LAV+A FA G T + + A  R KE+ R+  +  EL+K+GA + E  D  +I     L 
Sbjct: 827  PILAVLACFAKGETHLINAAIARQKESNRLSCITIELKKMGAQIMETDDGLLIR-NSNLR 885

Query: 371  VTEIDTYDDHRMAMAFSLAACAEVPVT-IKDPGCTRKTFPDYFEVLQK 231
               +++YDDHR+AMA  +A  A   +T +K   C +K+FP++ + L+K
Sbjct: 886  GAIVESYDDHRLAMALIVAGLASEGITEVKGIDCIKKSFPNFIQDLKK 933



>sp|O26860|AROA_METTH Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>pir|D69202|D69202
           5-enolpyruvylshikimate 3-phosphate synthase -
           Methanobacterium thermoautotrophicum (strain Delta
           H)>gb:AE000855_28465 Methanobacterium
           thermoautotrophicum from bases 691033 to 702432 (section
           61 of 148) of the complete genome.>gb:AE000666_925547
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 419

 Score = 95.9 bits (237), Expect = 1e-18
 Identities = 77/223 (34%), Positives = 108/223 (48%), Gaps = 2/223 (0%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRF--LIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           +MER  V V++S+   R    +  G  Y       VEGD SSASY             +E
Sbjct: 201 VMERFSVPVDYSEGTFRVEPAVYRGLDYT------VEGDYSSASYLAGAVAAAGGDVLIE 254

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
                S QGD    +++  MGAEV   E+ V +     A +G   L  + VN++  PD+ 
Sbjct: 255 NLFRDSRQGDRIILDIISDMGAEVRRGEDHVRI-----ASTGE--LSGVSVNLHDAPDLL 307

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
            T+AV+   A G T I  V   R KET+R+     ELR+LG  V E PD  II      +
Sbjct: 308 PTVAVLGALATGRTEIGGVEHARYKETDRISTCAAELRRLGVDVTELPDGMII--EGGAS 365

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFE 243
              + ++ DHR+AMAF+L    E  +TI+D      +FPD+ E
Sbjct: 366 GGTVWSHGDHRLAMAFTLIGLRE-GITIRDAEVFSVSFPDFPE 407



>gb:APL012748_582273 Actinobacillus pleuropneumoniae aroA gene.
          Length = 332

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 56/132 (42%), Positives = 80/132 (60%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L +M+  GV VE+ + +  F+++G Q Y SP    VEGDASSASYFL             
Sbjct: 209 LAMMKDFGVKVENRN-YQTFVVKGNQSYLSPEKYLVEGDASSASYFLAAGAIKGKVKVT- 266

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G G +S+QGD  FA VLE MGA+++W ++ +      +A  G+  L+  D++MN +PD A
Sbjct: 267 GIGKNSIQGDRLFANVLEAMGAKITWGDDFI------QAEQGK--LKGGDMDMNHIPDAA 318

Query: 551 MTLAVVALFADG 516
           MT+A  ALFA+G
Sbjct: 319 MTIATAALFAEG 330



>gb:AE016935_361554 Bacteroides thetaiotaomicron VPI-5482, section
           10 of 21 of the complete genome.>gb:AE015928_988042
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 410

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 64/195 (32%), Positives = 97/195 (49%), Gaps = 4/195 (2%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           VE D S+ASY+             + G   +S QGD + AEV  ++G    +T   V +K
Sbjct: 212 VESDWSAASYWYQIAALSPEAEIELLGLFRNSYQGDSRGAEVFSRLGITTEFTPKGVKIK 271

Query: 629 GPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVC 450
              + P        ++ +   +PD+A T  V     + P     + S ++KET+R+ A+ 
Sbjct: 272 KTGKTPE------RLEEDFVDIPDLAQTFVVTCALLNIPFRFTGLQSLKIKETDRIAALR 325

Query: 449 TELRKLGATVEEGPDYCIITPPERLN---VTEIDTYDDHRMAMAFSLAACAEVPVTIKDP 279
           TEL+KLG  +EE  D  ++   ER     V  I TY+DHRMAMAF+ A      + I DP
Sbjct: 326 TELKKLGYLIEEENDSVLMWNGERCEPEAVPVIATYEDHRMAMAFAPAVITFPKLLIADP 385

Query: 278 GCTRKTFPDYFEVLQ 234
               K++P Y+E L+
Sbjct: 386 QVVSKSYPGYWEDLK 400



>gb:AE017251_416728 Treponema denticola ATCC 35405, section 6 of 10
           of the complete genome.>gb:AE017226_1070324 Treponema
           denticola ATCC 35405, complete genome.
          Length = 449

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 64/238 (26%), Positives = 118/238 (49%), Gaps = 7/238 (2%)
 Frame = -2

Query: 923 LK*LLKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXX 744
           LK  L  ++  G+  + SD +  F I   QK     +A +  D SSA++ +         
Sbjct: 212 LKMTLHWLKTCGIKFDVSDDFKTFKIIESQKILG-FSAGIPADWSSAAFPIALALITAST 270

Query: 743 XXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKM 564
             ++    + +QGD +  +VL++M A++ + E S T+K  P +      L+    + + +
Sbjct: 271 ISIKNIDINDVQGDARIVKVLKEMNADIRFEEKSQTLKIFPSS------LKGGTFDCSDI 324

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPD--YCIIT 390
           PD    L+ +A FA G T ++++   R KE +R+  + +EL+KLGA + EG D  + I  
Sbjct: 325 PDAVPALSAIACFAKGETILKNIEICRYKECDRLSVISSELKKLGADITEGRDVLHIIGN 384

Query: 389 PPERLNVTEIDTYDDHRMAM-----AFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
             + L+   +D++ DHR+AM      F +        T+K+  C   ++P + E L++
Sbjct: 385 AGKNLSPASVDSHKDHRIAMMLTIIGFGIDDKDGTVFTLKNAECFDISYPSFLEDLKR 442



>pir|A24962|BVASA1 3-dehydroquinate synthase (EC 4.2.3.4) - Emericella
            nidulans
          Length = 1603

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 73/236 (30%), Positives = 106/236 (44%), Gaps = 8/236 (3%)
 Frame = -2

Query: 905  LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
            +M   G+ V+ S + +        +Y +P    +E DAS A+Y L           V   
Sbjct: 607  MMRSFGIDVQKSTTEEHTYHIPQGRYVNPAEYVIESDASCATYPLAVAAVTGTTCTVPNI 666

Query: 725  GTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAM 549
            G++SLQGD +FA EVL  MG  V  TE S TV GP          R    N   +P    
Sbjct: 667  GSASLQGDARFAVEVLRPMGCTVEQTETSTTVTGPSDGILRATSKRGYGTNDRCVPRCFR 726

Query: 548  TLA--VVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERL 375
            T +   +      P     +A+ RVKE  R+ A+  EL K G    E  D   I   +R 
Sbjct: 727  TGSHRPMEKSQTTPPVSSGIANQRVKECNRIKAMKDELAKFGVICREHDDGLEIDGIDRS 786

Query: 374  NVTE----IDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            N+ +    +  YDDHR+A +FS L+     P  I +  C  KT+P +++ L++  K
Sbjct: 787  NLRQPVGGVFCYDDHRVAFSFSVLSLVTPQPTLILEKECVGKTWPGWWDTLRQLFK 842



>sp|P07547|ARO1_EMENI Pentafunctional AROM polypeptide [Includes:
            3-dehydroquinate synthase (EC 4.2.3.4); 3-dehydroquinate
            dehydratase (EC 4.2.1.10) (3- dehydroquinase); Shikimate
            5-dehydrogenase (EC 1.1.1.25); Shikimate kinase (EC
            2.7.1.71); 3-phosphoshikimate 1-carboxyvinyltransferase
            (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate
            synthase) (EPSP synthase) (EPSPS)].>gb:ANAROMG_1819385
            Aspergillus nidulans gene for pentafunctional arom
            polypeptide.
          Length = 1586

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 73/236 (30%), Positives = 106/236 (44%), Gaps = 8/236 (3%)
 Frame = -2

Query: 905  LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
            +M   G+ V+ S + +        +Y +P    +E DAS A+Y L           V   
Sbjct: 607  MMRSFGIDVQKSTTEEHTYHIPQGRYVNPAEYVIESDASCATYPLAVAAVTGTTCTVPNI 666

Query: 725  GTSSLQGDVKFA-EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAM 549
            G++SLQGD +FA EVL  MG  V  TE S TV GP          R    N   +P    
Sbjct: 667  GSASLQGDARFAVEVLRPMGCTVEQTETSTTVTGPSDGILRATSKRGYGTNDRCVPRCFR 726

Query: 548  TLA--VVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERL 375
            T +   +      P     +A+ RVKE  R+ A+  EL K G    E  D   I   +R 
Sbjct: 727  TGSHRPMEKSQTTPPVSSGIANQRVKECNRIKAMKDELAKFGVICREHDDGLEIDGIDRS 786

Query: 374  NVTE----IDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            N+ +    +  YDDHR+A +FS L+     P  I +  C  KT+P +++ L++  K
Sbjct: 787  NLRQPVGGVFCYDDHRVAFSFSVLSLVTPQPTLILEKECVGKTWPGWWDTLRQLFK 842



>gb:AF496767_1805679 Zea mays cultivar H_5 3-phosphoshikimate
           1-carboxyvinyltransferase gene, 3'UTR and partial cds.
          Length = 47

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 41/47 (87%), Positives = 44/47 (93%)
 Frame = -2

Query: 359 DTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           DTYDDHRMAMAFSLAACAEVPVTI+DPGCTRKTFPDYF+VL  F K+
Sbjct: 1   DTYDDHRMAMAFSLAACAEVPVTIRDPGCTRKTFPDYFDVLSTFVKN 47



>gb:AP006618_560989 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 437

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 61/192 (31%), Positives = 97/192 (50%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKG 627
           VE D S+A+ FL           +      + Q      E+L +MGAE    +  +TV G
Sbjct: 242 VEPDLSNATPFLAAAAVTGGSVSIPHWPRLTTQPGDVIREILVRMGAEARIFDGVLTVHG 301

Query: 626 PPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCT 447
           P R       L  ID++++ + ++  T+A +A  AD P+ +R +A  R  ET+R+ A+ T
Sbjct: 302 PDR-------LAGIDIDLHDVGELTPTVAALAALADSPSRLRGIAHLRGHETDRLAALST 354

Query: 446 ELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTR 267
           E+ +LG  V E  D   I P   L+     +Y DHRMA A ++   A   + I+D G T 
Sbjct: 355 EINRLGGKVTETEDGLEIVPAP-LHGGTWHSYADHRMATAGAILGLAVEGIEIEDIGTTA 413

Query: 266 KTFPDYFEVLQK 231
           KT P++ E+ ++
Sbjct: 414 KTLPNFVELWEE 425



>pir|H75438|H75438 3-phosphoshikimate-1-carboxyvinyltransferase -
           Deinococcus radiodurans (strain R1)>gb:AE001959_41367
           Deinococcus radiodurans R1 section 96 of 229 of the
           complete chromosome 1.>gb:AE000513_882262 Deinococcus
           radiodurans R1 complete chromosome 1.
          Length = 462

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 70/232 (30%), Positives = 104/232 (44%), Gaps = 2/232 (0%)
 Frame = -2

Query: 923 LK*LLKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXX 744
           L+  L  +   GV    SD   R  I GGQKY+ PG   V GD   ++  L         
Sbjct: 226 LRQTLDTLSDFGVRATASDDLRRISIPGGQKYR-PGRVLVPGDYPGSAAILTAAALLPGE 284

Query: 743 XXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKM 564
             +       LQG+ +   VL +MGA++    +++TV+G      GR  L A+  + +  
Sbjct: 285 VRLSNLREHDLQGEKEAVNVLREMGADIVREGDTLTVRG------GRP-LHAVTRDGDSF 337

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
            D    L   A FA+G T   +VA+ R+KE +R+     EL +LG    E  D   +T  
Sbjct: 338 TDAVQALTAAAAFAEGDTTWENVATLRLKECDRISDTRAELERLGLRARETADSLSVTGS 397

Query: 383 ERL-NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQ 234
             L      D + DHRM M  +L    A+ P+ I      RK++P +F  L+
Sbjct: 398 AHLAGGITADGHGDHRMIMLLTLLGLRADAPLRITGAHHIRKSYPQFFAHLE 449



>sp|Q9RVD3|AROA_DEIRA 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).
          Length = 439

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 70/232 (30%), Positives = 104/232 (44%), Gaps = 2/232 (0%)
 Frame = -2

Query: 923 LK*LLKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXX 744
           L+  L  +   GV    SD   R  I GGQKY+ PG   V GD   ++  L         
Sbjct: 203 LRQTLDTLSDFGVRATASDDLRRISIPGGQKYR-PGRVLVPGDYPGSAAILTAAALLPGE 261

Query: 743 XXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKM 564
             +       LQG+ +   VL +MGA++    +++TV+G      GR  L A+  + +  
Sbjct: 262 VRLSNLREHDLQGEKEAVNVLREMGADIVREGDTLTVRG------GRP-LHAVTRDGDSF 314

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
            D    L   A FA+G T   +VA+ R+KE +R+     EL +LG    E  D   +T  
Sbjct: 315 TDAVQALTAAAAFAEGDTTWENVATLRLKECDRISDTRAELERLGLRARETADSLSVTGS 374

Query: 383 ERL-NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQ 234
             L      D + DHRM M  +L    A+ P+ I      RK++P +F  L+
Sbjct: 375 AHLAGGITADGHGDHRMIMLLTLLGLRADAPLRITGAHHIRKSYPQFFAHLE 426



>gb:BA000045_741113 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 432

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 67/199 (33%), Positives = 101/199 (50%), Gaps = 7/199 (3%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA+++L            + G G +  +  V   + L  MGA+++  EN   V 
Sbjct: 233 VPGDISSAAFWLVAGSIVPDSQLLLSGVGVNPTRTGV--LDALAAMGADIA-VENRREVC 289

Query: 629 GPPRAPSGRKH--LRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDVASWRVKETER 465
           G P A    +   L+A  +    +P   D    LAV A  A G T IRD A  RVKE++R
Sbjct: 290 GEPVADLRVRSAPLKACTIGGEWIPRLVDEIPVLAVAACCAAGKTVIRDAAELRVKESDR 349

Query: 464 MIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVT-I 288
           +  +  EL +LGA +EE PD  +I    RL    ++++DDHR+AM+ ++A       T I
Sbjct: 350 LATMARELGRLGAHIEERPDGLVIEGGHRLVGAGVESHDDHRVAMSLAVAGLVATGTTEI 409

Query: 287 KDPGCTRKTFPDYFEVLQK 231
            DP C   ++P ++E L +
Sbjct: 410 ADPDCATVSYPQFYEHLAR 428



>gb:AP008231_580976 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 448

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 66/199 (33%), Positives = 105/199 (52%), Gaps = 7/199 (3%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA+++L            +E  G +  +  +   E L++M A+++  EN   V 
Sbjct: 250 VPGDISSAAFWLVAAAIVPDSDLLIENVGVNPTRTGI--LEALQQMEAQIT-LENERIVA 306

Query: 629 GPPRAPSGRK--HLRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDVASWRVKETER 465
           G P A    +  +L+AI++  + +P   D    LAV A FA G T IRD    RVKE++R
Sbjct: 307 GEPVADLRVRSSNLQAIEIGGSLIPRLIDEVPILAVAAAFAKGTTIIRDAEELRVKESDR 366

Query: 464 MIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTI 288
           +  + +EL ++GAT+ E PD   IT    L    +D+Y DHR+AM+ ++AA  A+    I
Sbjct: 367 IAVMASELGRMGATISERPDGLEITGGAALTGATVDSYTDHRIAMSLAIAALQAKGQTQI 426

Query: 287 KDPGCTRKTFPDYFEVLQK 231
           +       ++PD+   LQ+
Sbjct: 427 QQAEAAAVSYPDFVPTLQQ 445



>gb:AE017283_431048 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 429

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 64/188 (34%), Positives = 96/188 (51%), Gaps = 2/188 (1%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKG 627
           +E D ++A+ FL           V G  T S Q   +F  + EKMGA VS  + S+T+  
Sbjct: 236 IEPDLTNAAVFLAAALIVGGSVTVPGWPTDSTQPGAQFMGIAEKMGAIVSRVDGSMTI-- 293

Query: 626 PPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCT 447
              A  G + LR +DV++++  ++   +A VA  A G + IR VA  R  ET+R+ A+  
Sbjct: 294 ---AAQGWQELRPLDVDLHEASELTPVVAAVASLARGRSRIRGVAHIRGHETDRLAALEH 350

Query: 446 ELRKLGATVEEGPDYCIIT--PPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGC 273
           EL KLG  V++  +   IT    ++L+  +   Y DHRMA A +L       V + D  C
Sbjct: 351 ELAKLGVEVQQTDNGLDITGRGADKLHGGKFGCYADHRMAHAGALLGLVIDGVELDDITC 410

Query: 272 TRKTFPDY 249
           T KT P +
Sbjct: 411 TSKTMPQF 418



>gb:CP000001_853280 Bacillus cereus ZK, complete genome.
          Length = 429

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 73/235 (31%), Positives = 113/235 (48%), Gaps = 6/235 (2%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++E  GV V       +  + GGQK  +  +  V GD SSA++FL            +E
Sbjct: 200 RMLEAFGVKVTREGKTVK--LAGGQKLTAT-DVQVPGDVSSAAFFLVAGAIIPNSKLVLE 256

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPP-RAPSGRKHLRAIDVNMNKMPDV 555
             G +  +  +   +VLEKMGA  +    +     P          L+ I++  + +P +
Sbjct: 257 NVGMNPTRTGI--IDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRL 314

Query: 554 AMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
              + V+AL A   +G T I+D    +VKET R+  V  EL KLGA +E   D  II   
Sbjct: 315 IDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGK 374

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             L    +++Y DHR+ M  ++A C AE   TI+D      ++P +FE LQK +K
Sbjct: 375 SVLKGNTVNSYGDHRIGMMLAIAGCLAEGKTTIEDAEAVGVSYPTFFEELQKLAK 429



>gb:AP006627_564222 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 430

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 71/212 (33%), Positives = 106/212 (50%), Gaps = 7/212 (3%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKM 672
           I+GGQ  ++  +  V GD SSA++FL            ++  G +  +  +   EVL++ 
Sbjct: 220 IQGGQSLQA-ADVVVPGDISSAAFFLVAGCIVPGSRVHLKNVGLNPTRAGI--LEVLKRS 276

Query: 671 GAEVSWTENSVTVKGPPRAPS--GRKHLRAIDVNMNKMP---DVAMTLAVVALFADGPTA 507
           GA++S  E  VT  G PR         L    +   ++P   D    LAV+A    G T 
Sbjct: 277 GAKLSIDEQ-VTTGGEPRGDMTISTSELSPFVIEGEEVPTLIDEIPVLAVLATQISGTTI 335

Query: 506 IRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMA 327
           IRD    +VKET R+  V  EL KLGA +E   D  II   + L   ++D++ DHR+ MA
Sbjct: 336 IRDAEELKVKETNRIDTVVGELAKLGADIEATDDGMIIRGGKPLTGGKVDSHGDHRIGMA 395

Query: 326 FSLAA-CAEVPVTIKDPGCTRKTFPDYFEVLQ 234
             +A+ CA  PV + + G    ++P +FE LQ
Sbjct: 396 LVIASLCANGPVELANIGAISVSYPQFFEHLQ 427



>gb:AY142772_591955 Heliobacillus mobilis 3-phosphoshikimate
           1-carboxyvinyltransferase gene, partial cds.
          Length = 256

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 66/198 (33%), Positives = 98/198 (49%), Gaps = 7/198 (3%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA++ L            +   G +  +  +   +VL +MGA +   EN   V 
Sbjct: 58  VPGDISSAAFLLVAASIVPGSEVTLRNIGINPTRDGI--LDVLREMGANLH-VENERLVA 114

Query: 629 GPPRAP-----SGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETER 465
           G P A      +  K        + ++ D    +AV ALFA+G T I+D A  RVKET+R
Sbjct: 115 GEPVADITVQSASLKGTTIEGAIIPRLIDELPIIAVAALFAEGTTIIKDAAELRVKETDR 174

Query: 464 MIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVT-I 288
           +  +  ELRKLG TVEE PD  II   +++    +D++ DHR+AM+ ++A       T I
Sbjct: 175 IAVLAEELRKLGVTVEETPDGMIIPGNQQVKGGTVDSHGDHRIAMSLAIAGLLAADETVI 234

Query: 287 KDPGCTRKTFPDYFEVLQ 234
           +D      +FP +   LQ
Sbjct: 235 RDAASIDVSFPGFAATLQ 252



>sp|Q8DLY3|AROA_SYNEL 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:BA000039_726127
           Thermosynechococcus elongatus BP-1 DNA, complete genome.
          Length = 440

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 72/201 (35%), Positives = 104/201 (51%), Gaps = 7/201 (3%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA+++L            +   G +  +  +   +VL  MGAE++  EN   V 
Sbjct: 243 VPGDISSAAFWLVAASIIPDSELLLTNVGVNPTRTGI--LDVLWAMGAEIT-LENERLVT 299

Query: 629 GPP----RAPSGR-KHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETER 465
           G P    R  S R K  R     + ++ D    LAV A FA+G T IRD A  RVKE++R
Sbjct: 300 GEPVADLRVRSARLKSTRIGGELIPRLIDEIPILAVAAAFAEGVTEIRDAAELRVKESDR 359

Query: 464 MIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTI 288
           + AV TEL+K+GA V E  D   I     L  T ++TY DHRMAM+ ++AA  A+    I
Sbjct: 360 LKAVATELQKMGAKVTELSDGLDIQGGGPLQGTHLETYGDHRMAMSLAIAALNAKGTSEI 419

Query: 287 KDPGCTRKTFPDYFEVLQKFS 225
            +      ++P++  VLQ+ +
Sbjct: 420 HNASAAAVSYPEFVTVLQQIA 440



>gb:AP006841_571265 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 410

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 70/233 (30%), Positives = 110/233 (47%), Gaps = 6/233 (2%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSW--DRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXX 741
           L+LM+  G S     SW  D+ ++   Q Y       VE D S+ASY+            
Sbjct: 179 LQLMKDFGASA----SWTSDQSILVDPQPYHCLPFT-VESDWSAASYWYQIAALSPQANI 233

Query: 740 XVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMP 561
            + G    S QGD + AEV  ++G    +TE  + +K           +  +D +   +P
Sbjct: 234 ELTGLFRHSYQGDSRGAEVFARLGVATEYTETGIRLK------KNGTCVERLDEDFVDIP 287

Query: 560 DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE 381
           D+A T  V     + P     + S ++KET+R+ A+ TE++KLG  + +  D  +    E
Sbjct: 288 DLAQTFVVTCALLNVPFRFTGLQSLKIKETDRIEALKTEMKKLGYILHDKNDSILSWDGE 347

Query: 380 RLNVTE---IDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
           R+       I TY+DHRMAMAF+ AA     + I +P    K++P Y+  L+K
Sbjct: 348 RVEQQACPVIKTYEDHRMAMAFAPAAIHYPTIQIDEPQVVSKSYPGYWNDLRK 400



>gb:AE017033_383016 Bacillus anthracis str. Ames section 10 of 18 of
           the complete genome.>gb:AE017225_408129 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_452863 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1012721 Bacillus
           anthracis str. Ames complete genome.
          Length = 429

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 72/235 (30%), Positives = 112/235 (47%), Gaps = 6/235 (2%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++E  GV V       +  + GGQK  +  +  V GD SSA++FL            +E
Sbjct: 200 RMLEAFGVKVTREGKTVK--LAGGQKLTAT-DVQVPGDVSSAAFFLVAGAIIPNSKLVLE 256

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPP-RAPSGRKHLRAIDVNMNKMPDV 555
             G +  +  +   +VLEKMGA  +    +     P          L+ I++  + +P +
Sbjct: 257 NVGMNPTRTGI--IDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRL 314

Query: 554 AMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
              + V+AL A   +G T I+D    +VKET R+  V  EL KLGA +E   D  II   
Sbjct: 315 IDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDRMIIYGK 374

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             L    +++Y DHR+ M  ++A C AE    I+D      ++P +FE LQK +K
Sbjct: 375 SALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK 429



>gb:CP000002_858047 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 464

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 68/237 (28%), Positives = 119/237 (50%), Gaps = 8/237 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++   GVS+   ++     I GGQ+ K+    FV GD SSA++FL            + 
Sbjct: 232 RMLSMFGVSLREDET--SVSIEGGQQLKA-AEVFVPGDISSAAFFLAAASLVPGSEVVLR 288

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRK--HLRAIDVNMNKMPD 558
             G +  +  +   +VL++MGA++   E   T    P      K   L+A +++ + +P 
Sbjct: 289 NVGLNPTRTGI--IDVLKEMGADLEIEEKD-TGNTEPYGDLRIKTSSLKAAEISGDLIPR 345

Query: 557 VAMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
           +   + ++AL A   +G T I+D A  +VKET R+  V +EL+K+GA +E   D   I  
Sbjct: 346 LIDEIPIIALLATQAEGTTVIKDAAELKVKETNRIDTVASELKKIGANIEPTEDGMKIHG 405

Query: 386 PERL-NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              L    ++ ++ DHR+ M   +AAC  E P+ I  P     ++P +FE ++K ++
Sbjct: 406 KTPLTGGAKVSSHGDHRIGMMLGIAACICEQPIDILQPEAVSVSYPSFFEHIEKLAE 462



>gb:AE017355_463994 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 429

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 72/235 (30%), Positives = 112/235 (47%), Gaps = 6/235 (2%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++E  GV V       +  + GGQK  +  +  V GD SSA++FL            +E
Sbjct: 200 RMLEAFGVKVTREGKTVK--LAGGQKLTAT-DVQVPGDVSSAAFFLVAGAIIPNSKLVLE 256

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPP-RAPSGRKHLRAIDVNMNKMPDV 555
             G +  +  +   +VLEKMGA  +    +     P          L+ I++  + +P +
Sbjct: 257 NVGMNPTRTGI--IDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRL 314

Query: 554 AMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
              + V+AL A   +G T I+D    +VKET R+  V  EL KLGA +E   D  II   
Sbjct: 315 IDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGK 374

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             L    +++Y DHR+ M  ++A C AE    I+D      ++P +FE LQK +K
Sbjct: 375 SALKGNTVNSYGDHRIGMMLAIAGCIAEGKTIIEDAEAVGVSYPTFFEELQKLAK 429



>gb:AE017333_448237 Bacillus licheniformis DSM 13, complete genome.
          Length = 428

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 68/237 (28%), Positives = 119/237 (50%), Gaps = 8/237 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++   GVS+   ++     I GGQ+ K+    FV GD SSA++FL            + 
Sbjct: 196 RMLSMFGVSLREDET--SVSIEGGQQLKA-AEVFVPGDISSAAFFLAAASLVPGSEVVLR 252

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRK--HLRAIDVNMNKMPD 558
             G +  +  +   +VL++MGA++   E   T    P      K   L+A +++ + +P 
Sbjct: 253 NVGLNPTRTGI--IDVLKEMGADLEIEEKD-TGNTEPYGDLRIKTSSLKAAEISGDLIPR 309

Query: 557 VAMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
           +   + ++AL A   +G T I+D A  +VKET R+  V +EL+K+GA +E   D   I  
Sbjct: 310 LIDEIPIIALLATQAEGTTVIKDAAELKVKETNRIDTVASELKKIGANIEPTEDGMKIHG 369

Query: 386 PERL-NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
              L    ++ ++ DHR+ M   +AAC  E P+ I  P     ++P +FE ++K ++
Sbjct: 370 KTPLTGGAKVSSHGDHRIGMMLGIAACICEQPIDILQPEAVSVSYPSFFEHIEKLAE 426



>gb:BA000030_700928 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 446

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 62/186 (33%), Positives = 90/186 (48%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKG 627
           VE D S+A  FL           +      + Q   K  E+  +MG     TE  +   G
Sbjct: 259 VEPDLSNAQPFLAAALVTGGKVVIPDWPERTTQPGDKLREIFTEMGGSCELTEQGLEFTG 318

Query: 626 PPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCT 447
                SG  H   IDV+++++ ++   +A VA  AD P+ +R VA  R+ ET+R+ A+  
Sbjct: 319 -----SGAVH--GIDVDLSEVGELTPGIAAVAALADSPSTLRGVAHLRLHETDRLAALTK 371

Query: 446 ELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTR 267
           E+ +LG  V E  D   I  P RL+     TYDDHRMA A ++   A   V I++   T 
Sbjct: 372 EINELGGDVTETADGLSIR-PRRLHGGIFHTYDDHRMATAGAIIGLAVDGVQIENVATTA 430

Query: 266 KTFPDY 249
           KT PD+
Sbjct: 431 KTLPDF 436



>gb:AE017273_424204 Bacillus cereus ATCC 10987, section 10 of 18 of
           the complete genome.>gb:AE017194_1062623 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 429

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 71/235 (30%), Positives = 113/235 (48%), Gaps = 6/235 (2%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++E  GV V       +  + GGQK  +  +  V GD SSA++FL            ++
Sbjct: 200 RMLEAFGVKVTREGKTVK--LAGGQKLTAT-DVQVPGDVSSAAFFLVAGAIIPNSKLVLQ 256

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPP-RAPSGRKHLRAIDVNMNKMPDV 555
             G +  +  +   +VLEKMGA  +    +     P          L+ I++  + +P +
Sbjct: 257 NVGMNPTRTGI--IDVLEKMGATFTVEPINEGASEPAANITIETSSLKGIEIGGDIIPRL 314

Query: 554 AMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
              + V+AL A   +G T I+D    +VKET R+  V  EL KLGA +E   D  II   
Sbjct: 315 IDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIYGK 374

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
             L    +++Y DHR+ M  ++A C A+   TI+D      ++P +FE LQK +K
Sbjct: 375 SALKGNTVNSYGDHRIGMMLAIAGCIAKGKTTIEDAEAVGVSYPTFFEELQKLAK 429



>gb:AE017178_398065 Porphyromonas gingivalis W83 section 7 of 8 of
           the complete genome.>gb:AE015924_1033676 Porphyromonas
           gingivalis W83 complete genome.
          Length = 419

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 72/236 (30%), Positives = 107/236 (45%), Gaps = 13/236 (5%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEG 729
           +L+   G+ VE S+     +  G + + +P   +   D S+A Y             V  
Sbjct: 186 RLLTAFGIEVERSED---SITVGERPFVAPTEWYPSADWSAAGYIYNMVAVGELSGSVSL 242

Query: 728 CGT----SSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAID----VNM 573
            G      S+Q D + A +  ++G     T++ +T+   P        +R  D     ++
Sbjct: 243 PGLLPPEESMQADSRAATLFGRLGVVTEKTDSGITLSYSP--------VRCTDDFGTEDV 294

Query: 572 NKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCI- 396
              PD+  TLAV  L    P  +  V   R+KE +R+ A+CTE RKLG  V    D  + 
Sbjct: 295 RDCPDLVPTLAVCCLLKRVPFCLTGVGHLRLKECDRLAAICTEARKLGYVVRSDKDALLW 354

Query: 395 ---ITPPERLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEV 240
                 PE L V  I  YDDHRMAMAF+ AA  ++  V I+D G   K+FP +F V
Sbjct: 355 DGERCTPEELPV--IRVYDDHRMAMAFAAAAVLSKKGVMIEDAGVVGKSFPGFFSV 408



>sp|P39915|AROA_BURPS 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).
          Length = 463

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 68/188 (36%), Positives = 85/188 (45%), Gaps = 2/188 (1%)
 Frame = -2

Query: 869 DSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFA 690
           D  +R       +Y SP    +EGDA+SASYFL             G G  S+QGD  F 
Sbjct: 207 DHTERIFAVSAIRYPSPAVLRLEGDATSASYFLAAAGIKGVPVT--GIGRHSMQGDSWFP 264

Query: 689 EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPT 510
             L +MGA    +   V  +G  RA        A+  + N +PD AMTLA     A G  
Sbjct: 265 RALRRMGARSCGSSMIVCPRGELRA--------AVRSDSNSIPDAAMTLATXXALARGGR 316

Query: 509 AIRDVASWRVKETERMIAVCTELRKLGATVEEGPDY--CIITPPERLNVTEIDTYDDHRM 336
             R + +WRVKET+R+ A+ TEL   GA V  G     C   P    +        D RM
Sbjct: 317 RPRTIFAWRVKETDRLYAMSTELGAAGARVVPGAGLRGC---PLRGRSYYVARCRRDSRM 373

Query: 335 AMAFSLAA 312
           AM FSL A
Sbjct: 374 AMCFSLPA 381



>gb:CP000027_79468 Dehalococcoides ethenogenes 195, complete genome.
          Length = 420

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 74/230 (32%), Positives = 98/230 (42%)
 Frame = -2

Query: 923 LK*LLKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXX 744
           LK   + +E  G+    S  W    I   Q Y  P    VEGD SSAS FL         
Sbjct: 193 LKMTKQTLESFGIKAYTSIDWQEISIPP-QPYL-PARYRVEGDWSSASSFLALGAIAAPL 250

Query: 743 XXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKM 564
                  T S Q D    + L +MGAEV   +N V V   P        L AI  ++   
Sbjct: 251 FISN-LDTESFQADRIMIKFLSEMGAEVESGQNWVKVSPKP--------LTAIQADLTHS 301

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
            D+   LA+ A  A G + +  V   R+KE+ R+ AV   L  +G  V E  D  II   
Sbjct: 302 IDLLPALAITAACAKGQSILSGVRQARIKESNRIRAVSQGLSAMGINVTEEDDRLIIEGG 361

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQ 234
                 EID+  DHR+AMAF           I +  C  KT+PD+++ L+
Sbjct: 362 MPRGA-EIDSLGDHRIAMAFGALGAVTGETCISEAECVSKTYPDFWQKLE 410



>gb:AE016961_367762 Coxiella burnetii strain RSA 493, section 2 of 7
           of the complete genome.>gb:AE016828_1008498 Coxiella
           burnetii strain RSA 493, complete genome.
          Length = 438

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 66/208 (31%), Positives = 106/208 (50%), Gaps = 5/208 (2%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMG 669
           + GG K K+  +  + GD SSA++F+              C        +    +L+ MG
Sbjct: 217 VSGGGKLKA-NDISIPGDISSAAFFIVAATITPGSAIRL-CRVGVNPTRLGVINLLKMMG 274

Query: 668 AEVSWTENSVTVKGPPRAPSGRK-HLRAIDVNMNKMP---DVAMTLAVVALFADGPTAIR 501
           A++  T  +   + P    + R   L+ ID+  +++P   D    L + A  A G T +R
Sbjct: 275 ADIEVTHYTEKNEEPTADITVRHARLKGIDIPPDQVPLTIDEFPVLLIAAAVAQGKTVLR 334

Query: 500 DVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFS 321
           D A  RVKET+R+ A+   L+KLG   E  PD  II     L   E+++YDDHR+AMAF+
Sbjct: 335 DAAELRVKETDRIAAMVDGLQKLGIAAESLPDGVII-QGGTLEGGEVNSYDDHRIAMAFA 393

Query: 320 LA-ACAEVPVTIKDPGCTRKTFPDYFEV 240
           +A   A+ PV I++    + +FP++ E+
Sbjct: 394 VAGTLAKGPVRIRNCDNVKTSFPNFVEL 421



>gb:BX251410_764398 Tropheryma whipplei TW08/27, complete genome;
           segment 1/3.
          Length = 443

 Score = 86.7 bits (213), Expect = 6e-16
 Identities = 59/224 (26%), Positives = 106/224 (47%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           +++M   G++V HSD     +     K  +  +  +E D S+A+ F+           ++
Sbjct: 225 VEVMREWGINVTHSDG----VWAVTPKELTGKHITIEPDLSNAAPFMIGAIVTGGSATIQ 280

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
              + + Q       +L + GAE++ T N++TV       SG  ++  I  ++  + ++ 
Sbjct: 281 NWPSKTSQPGKYLEAILPQFGAEITKTANTITV-------SGTGNITGIRADLGHIGELV 333

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
             L  +A  A+ P+   ++   R  ET+R+ A+  E+  LG T+  G DY  ITP     
Sbjct: 334 PNLVALATLAETPSVFYNIGHIRYHETDRIEALVNEISSLGGTITAGKDYIKITPTTLTR 393

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEV 240
                TY DHRMA + ++       +TI+D  CT KTFP + ++
Sbjct: 394 SGVWKTYKDHRMATSGAIIGLRH-KLTIEDIECTSKTFPRFADL 436



>gb:AE016852_349091 Tropheryma whipplei str. Twist, section 3 of 3
           of the complete genome.>gb:AE014184_1029287 Tropheryma
           whipplei str. Twist, complete genome.
          Length = 486

 Score = 86.7 bits (213), Expect = 6e-16
 Identities = 59/224 (26%), Positives = 106/224 (47%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           +++M   G++V HSD     +     K  +  +  +E D S+A+ F+           ++
Sbjct: 268 VEVMREWGINVTHSDG----VWAVTPKELTGKHITIEPDLSNAAPFMIGAIVTGGSATIQ 323

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
              + + Q       +L + GAE++ T N++TV       SG  ++  I  ++  + ++ 
Sbjct: 324 NWPSKTSQPGKYLEAILPQFGAEITKTANTITV-------SGTGNITGIRADLGHIGELV 376

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
             L  +A  A+ P+   ++   R  ET+R+ A+  E+  LG T+  G DY  ITP     
Sbjct: 377 PNLVALATLAETPSVFYNIGHIRYHETDRIEALVNEISSLGGTITAGKDYIKITPTTLTR 436

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEV 240
                TY DHRMA + ++       +TI+D  CT KTFP + ++
Sbjct: 437 SGVWKTYKDHRMATSGAIIGLRH-KLTIEDIECTSKTFPRFADL 479



>sp|O28775|AROA_ARCFU Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>pir|H69436|H69436
           5-enolpyruvylshikimate 3-phosphate synthase (aroA)
           homolog - Archaeoglobus fulgidus>gb:AE000999_30412
           Archaeoglobus fulgidus DSM 4304 section 108 of 172 of
           the complete genome.>gb:AE000782_975380 Archaeoglobus
           fulgidus DSM 4304 complete genome.
          Length = 416

 Score = 86.7 bits (213), Expect = 6e-16
 Identities = 68/226 (30%), Positives = 106/226 (46%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L ++   GV VE   ++  + I G Q +K      V  D SSASY L           +E
Sbjct: 194 LDVLRESGVKVEREGNF--YHIPGSQSFKLR-RYDVPADFSSASY-LIAAGLIAGEVVLE 249

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G   S+ QGD K  ++  +MG  V W +    ++        R  L  ++V+ + +PD+ 
Sbjct: 250 GMFESA-QGDRKIVDICREMGGSVEWDKKRGVIRAE------RSELEGVEVDASDIPDLV 302

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
            T+AV+A  A G T I +    R+KE +R+  +   L+ LG   +   D  II   +   
Sbjct: 303 PTIAVLAAVAKGKTRIYNAEHLRIKEIDRIEGIHQNLKALGVESKPLKDGLIIKGGKGEF 362

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQ 234
              +D++ DHRMA+AFSL       V  ++      +FP YF VL+
Sbjct: 363 RGVVDSFGDHRMALAFSLLGLLG-EVKCRNAEVVSVSFPGYFRVLE 407



>gb:AP006878_575415 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 399

 Score = 86.3 bits (212), Expect = 8e-16
 Identities = 72/229 (31%), Positives = 112/229 (48%), Gaps = 2/229 (0%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSD-SWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXV 735
           L+ ME  GV  E    S++ +    G +YK PG      D S+AS+FL            
Sbjct: 185 LRTMEAFGVEFEREGFSFEVYPGVKGTRYKVPG------DYSTASFFLAAGALYGKVRV- 237

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDV 555
                  +Q D+ F + LE+ GA V    + V V+G          L+A+ ++ +  PD 
Sbjct: 238 NNLLREDVQADMAFLDALEEFGARVKRGRDYVKVEGG--------ELKAVALDCSDFPDS 289

Query: 554 AMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERL 375
              LAVVA +A+G + IR     R KE++R+ A+   L ++G  V E  D   I    R 
Sbjct: 290 FPILAVVAAYAEGRSVIR-ARQLRFKESDRVRAMAVNLSRMGVKVRELEDGLEIEGG-RP 347

Query: 374 NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQK 231
              +++T++DHR+AMA S+AA  A  P  I+D     K+ P +F+ L++
Sbjct: 348 RGAKVETFNDHRIAMAMSIAALGATGPSIIEDTESVSKSHPGFFDDLRR 396



>gb:AE010600_264830 Fusobacterium nucleatum subsp. nucleatum ATCC
           25586, section 142 of 197 of the complete
           genome.>gb:AE009951_911998 Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586, complete genome.
          Length = 424

 Score = 86.3 bits (212), Expect = 8e-16
 Identities = 61/231 (26%), Positives = 113/231 (48%), Gaps = 7/231 (3%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L  + + G+++ ++ S+  F+I G Q YKS GN  VE D S  ++FL             
Sbjct: 204 LDCLNKFGINIINN-SYKEFIIEGNQTYKS-GNYQVEADYSQVAFFLVANSIGSNIKI-N 260

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G   +SLQGD K  + + ++    +WT+N   +                 ++ ++ PD+ 
Sbjct: 261 GLNVNSLQGDKKIIDFISEID---NWTKNEKLI-----------------LDGSETPDII 300

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLN 372
             L++ A  +     I ++A  R+KE++R+ A   EL KLG  + E  D  +I   +  N
Sbjct: 301 PILSLKACISKKEIEIVNIARLRIKESDRLSATVQELSKLGFDLIEKEDSILINSRKNFN 360

Query: 371 ------VTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEV 240
                    + ++ DHR+AM  ++A+ C E  + + +  C +K++P+++EV
Sbjct: 361 EISNNSPISLSSHSDHRIAMTVAIASTCYEGEIILDNLDCVKKSYPNFWEV 411



>sp|Q9V1H1|AROA_PYRAB Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>pir|C75162|C75162 3-phosphoshikimate
           1-carboxyvinyltransferase (aroa) PAB0306 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX02_849219 Pyrococcus
           abyssi complete genome; segment 2/6.
          Length = 410

 Score = 86.3 bits (212), Expect = 8e-16
 Identities = 73/233 (31%), Positives = 111/233 (47%), Gaps = 6/233 (2%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYK-SPG----NAFVEGDASSASYFLXXXXXXXX 747
           LK+ME  G+  E          R G K K  PG       V GD SSAS+FL        
Sbjct: 194 LKVMESFGIEFE----------RNGFKVKVHPGIRGSKFHVPGDYSSASFFLAAGALYGK 243

Query: 746 XXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNK 567
                       Q D +  ++LE+ GA+V      V V+        R  ++ I+V+ + 
Sbjct: 244 VKVSN-LVKDDPQADARIIDILEEFGADVKVGRKYVVVE--------RNEMKPINVDCSN 294

Query: 566 MPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
            PD+   LAV+A +A+G + I      R+KE++R+ AV   LRK G  V+E P+   I  
Sbjct: 295 FPDLFPILAVLASYAEGKSVITG-RQLRLKESDRVKAVAVNLRKAGIKVKELPNGLEIVG 353

Query: 386 PERLNVTEIDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
            +    T +++++DHR+ MA + L   AE    IKDP    K++P +F  L++
Sbjct: 354 GKPRGFT-VESFNDHRIVMAMAILGLGAEGKTIIKDPHVVSKSYPSFFLDLRR 405



>sp|P20691|AROA_BACSU 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|C26532|C26532
           5-enolpyruvoylshikimate-3-phosphate synthase aroE -
           Bacillus subtilis>gb:BACVARGNS_746647 Bacillus subtilis
           dbpA gene, complete sequence; MtrA (mtrA), MtrB (mtrB),
           GerC1 (gerC1), GerC2 (gerC2), GerC3 (gerC3), Ndk (ndk),
           CheR (cheR), AroF (aroF), AroB (aroB), AroH (aroH), TrpE
           (trpE), and TrpD (trpD) genes, complete cds; trpC gene,
           complete sequence; and TrpF (trpF), TrpB (trpB), TrpA
           (trpA), HisH (hisH), TyrA (tyrA), and AroE (aroE) genes,
           complete cds.>gb:BSUB0012_754225 Bacillus subtilis
           complete genome (section 12 of 21): from 2207806 to
           2409180.
          Length = 428

 Score = 86.3 bits (212), Expect = 8e-16
 Identities = 70/236 (29%), Positives = 116/236 (49%), Gaps = 16/236 (6%)
 Frame = -2

Query: 881 VEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQG 705
           V+ S+      I GGQK  +  + FV GD SSA++FL            ++  G +  + 
Sbjct: 203 VKLSEDQTSVSIAGGQKLTA-ADIFVPGDISSAAFFLAAGAMVPNSRIVLKNVGLNPTRT 261

Query: 704 DVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRK----------HLRAIDVNMNKMPDV 555
            +   +VL+ MGA++        +K  P A SG +           L+A+++  + +P +
Sbjct: 262 GI--IDVLQNMGAKLE-------IK--PSADSGAEPYGDLIIETSSLKAVEIGGDIIPRL 310

Query: 554 AMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP 384
              + ++AL A   +G T I+D A  +VKET R+  V +ELRKLGA +E   D   +   
Sbjct: 311 IDEIPIIALLATQAEGTTVIKDAAELKVKETNRIDTVVSELRKLGAEIEPTADGMKVYGK 370

Query: 383 ERL-NVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
           + L     + ++ DHR+ M   +A+C  E P+ I+       ++P +FE L K SK
Sbjct: 371 QTLKGGAAVSSHGDHRIGMMLGIASCITEEPIEIEHTDAIHVSYPTFFEHLNKLSK 426



>gb:AE017007_377842 Bacillus cereus ATCC 14579 section 10 of 18 of
           the complete genome.>gb:AE016877_1018092 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 429

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 71/237 (29%), Positives = 116/237 (48%), Gaps = 8/237 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++E  GV V       +  + GGQK  +  +  V GD SSA++FL            ++
Sbjct: 200 RMLEAFGVKVTREGKTVK--LSGGQKLTAT-DIQVPGDVSSAAFFLVAGAIIPNSKLVLQ 256

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPS---GRKHLRAIDVNMNKMP 561
             G +  +  +   +VLEKMGA  ++T + +       A +       L+ I++  + +P
Sbjct: 257 NVGMNPTRTGI--IDVLEKMGA--TFTVDLINEGASEPAANITIETSSLKGIEIGGDIIP 312

Query: 560 DVAMTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIIT 390
            +   + V+AL A   +G T I+D    +VKET R+  V  EL KLGA +E   D  II 
Sbjct: 313 RLIDEIPVIALAATQAEGITVIKDAHELKVKETNRIDTVVAELTKLGARIEATDDGMIIY 372

Query: 389 PPERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
               L    +++Y DHR+ M  ++A C AE    I+D      ++P +F+ LQK +K
Sbjct: 373 GKSALKGNTVNSYGDHRIGMMLAIAGCLAEGKTIIEDAEAVGVSYPTFFDELQKLAK 429



>gb:AE017180_400898 Geobacter sulfurreducens PCA, complete genome.
          Length = 429

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 63/199 (31%), Positives = 95/199 (47%), Gaps = 7/199 (3%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA++FL            + G G +  +  +   ++L  MG  V   +    V 
Sbjct: 230 VPGDISSAAFFLVAALIVPGSELLIRGVGVNPTRTGI--LDILAAMGGSVELLDQR-EVS 286

Query: 629 GPPRAPS--GRKHLRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDVASWRVKETER 465
           G P A        L+ I++  + +P   D    + V A  A+G T IRD    RVKET+R
Sbjct: 287 GEPVADLLVRSSALKGIEIGGDVVPRAIDEFPVICVAAALAEGTTVIRDARELRVKETDR 346

Query: 464 MIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTI 288
           + A+   LR  GAT+ E  D  II    RLN   ++++ DHR+AM+  +A   A   +T+
Sbjct: 347 IAAMAANLRAAGATITETADGMIIEGTGRLNGVTVESFGDHRIAMSMLVAGLAASGAITV 406

Query: 287 KDPGCTRKTFPDYFEVLQK 231
            D  C   +FP +  +L K
Sbjct: 407 SDTECIATSFPTFTALLDK 425



>sp|Q9K4A7|ARA2_STRCO 3-phosphoshikimate 1-carboxyvinyltransferase 2
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase 2) (EPSP synthase 2) (EPSPS
           2).>gb:SCO939122_178884 Streptomyces coelicolor A3(2)
           complete genome; segment 19/29.
          Length = 438

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 60/186 (32%), Positives = 90/186 (48%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKG 627
           VE D S+A  FL           +    + + Q   +  E+   MG     T+  +   G
Sbjct: 251 VEPDLSNAQPFLAAALVTGGKVVIPDWPSRTTQPGDRLREIFTDMGGSCELTDFGLVFTG 310

Query: 626 PPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCT 447
                SG  H   IDV+++++ ++   +A VA  AD P+ +R VA  R+ ET+R+ A+  
Sbjct: 311 -----SGAIH--GIDVDLSEVGELTPGIAAVAALADSPSTLRGVAHLRLHETDRLAALTK 363

Query: 446 ELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTR 267
           E+ +LG  V E  D   I  P RL+     TYDDHRMA A ++   A   V I++   T 
Sbjct: 364 EINELGGDVTETADGLHIR-PRRLHGGVFHTYDDHRMATAGAVLGLAVEGVQIENVATTA 422

Query: 266 KTFPDY 249
           KT PD+
Sbjct: 423 KTLPDF 428



>gb:AP006840_568608 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 449

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 66/229 (28%), Positives = 106/229 (46%), Gaps = 3/229 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L++++  G+ VE  D   RF I GGQ+Y+ P    V GD   A+  +           + 
Sbjct: 221 LQVLQEAGIRVEAGDDLRRFHIPGGQRYR-PREYTVPGDYPGAAALMAAAAVVPSDVTIP 279

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
                  QG+ +  +VL  MGA+++     V ++G      GR  LR +  + +   D  
Sbjct: 280 RLFPDE-QGERQAIDVLRAMGADIAHDGQQVWIRG------GRP-LRGVRFDGDPFTDAV 331

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII--TPPER 378
           + L   A+ A+G T   +V + R KE +R+     EL KLGA V E  D  I+   P   
Sbjct: 332 LALTAAAVLAEGETVFYNVENLRYKECDRISDYRAELNKLGARVAEERDKLIVRGRPEGV 391

Query: 377 LNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQ 234
                +++  DHR+ M  ++ A  A  PV I+D     K++P +F  L+
Sbjct: 392 EGGVTVESRIDHRVIMGLTIVALRAREPVVIRDAHHVAKSYPAFFADLR 440



>sp|Q9Z6M0|AROA_CHLPN 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|D86620|D86620
           phosphoshikimate vinyltransferase [imported] -
           Chlamydophila pneumoniae (strain J138)>pir|C72004|C72004
           phosphoshikimate vinyltransferase - Chlamydophila
           pneumoniae (strain CWL029)>gb:AE001684_37888 Chlamydia
           pneumoniae section 100 of 103 of the complete
           genome.>gb:AE002240_44287 Chlamydophila pneumoniae AR39,
           section 68 of 94 of the complete
           genome.>gb:AE017160_394420 Chlamydophila pneumoniae
           TW-183, section 4 of 4 of the complete
           genome.>gb:BA000008_664408 Chlamydophila pneumoniae J138
           genomic DNA, complete sequence.>gb:AE002161_886412
           Chlamydophila pneumoniae AR39, complete
           genome.>gb:AE001363_942445 Chlamydia pneumoniae,
           complete genome.>gb:AE009440_1028682 Chlamydophila
           pneumoniae TW-183, complete genome.
          Length = 445

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 59/208 (28%), Positives = 102/208 (49%), Gaps = 10/208 (4%)
 Frame = -2

Query: 830 YKSPGNAF-------VEGDASSASYFLXXXXXXXXXX--XVEGCGTSSLQGDVKFAEVLE 678
           Y  PG++        V GD SSA++               +       +QGD  F  +++
Sbjct: 216 YSFPGSSHPQGFSYHVTGDFSSAAFIAAAALLSKSLQPIRLRNLDILDIQGDKIFFSLMQ 275

Query: 677 KMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRD 498
            +GA + +    + V   P + SG        ++M+   D    L V+  FAD P+ + +
Sbjct: 276 NLGASIQYDNEEILVF--PSSFSGGS------IDMDGCIDALPILTVLCCFADSPSHLYN 327

Query: 497 VASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSL 318
             S + KE++R++A+  EL+K+GA ++   D  ++  P  L    +D++DDHR+AMA ++
Sbjct: 328 ARSAKDKESDRILAITEELQKMGACIQPTHDGLLVN-PSPLYGAVLDSHDDHRIAMALTI 386

Query: 317 AAC-AEVPVTIKDPGCTRKTFPDYFEVL 237
           AA  A     I +  C RKTFP++ + L
Sbjct: 387 AALYASGDSRIHNTACVRKTFPNFVQTL 414



>sp|Q822G0|AROA_CHLCV 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE016996_374779
           Chlamydophila caviae GPIC section 3 of 4 of the complete
           genome.>gb:AE015925_994458 Chlamydophila caviae GPIC
           complete genome.
          Length = 446

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 56/193 (29%), Positives = 99/193 (51%), Gaps = 3/193 (1%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXX--XXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTV 633
           V GD SSA++               +       +QGD +   +L+K+GA + + EN + +
Sbjct: 232 VGGDFSSAAFLAVAALLSQSPHPTYLRNLNMQDVQGDKELFVLLKKLGANIVF-ENDIVI 290

Query: 632 KGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAV 453
             P     G       +++M+   D    LAV+  FA  P+ + +    + KE++R++A+
Sbjct: 291 IFPSTISGG-------NIDMDPFIDALPILAVLCCFATSPSHLYNARGAKDKESDRIVAI 343

Query: 452 CTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPG 276
             EL+K+GA ++   D  +I  P  L    + +++DHR+AMA S+AA  A    +I D  
Sbjct: 344 TEELQKMGACIQPCHDGLLIN-PSPLYGASMFSHNDHRIAMALSIAAMHASGDSSISDTE 402

Query: 275 CTRKTFPDYFEVL 237
           C +KTFP++ ++L
Sbjct: 403 CVKKTFPNFIQIL 415



>sp|O67494|AROA_AQUAE 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|D70433|D70433
           5-enolpyruvylshikimate-3-phosphate synthetase - Aquifex
           aeolicus>gb:AE000744_26847 Aquifex aeolicus VF5 section
           76 of 109 of the complete genome.>gb:AE000657_977378
           Aquifex aeolicus VF5 complete genome.
          Length = 431

 Score = 83.6 bits (205), Expect = 5e-15
 Identities = 67/225 (29%), Positives = 109/225 (48%), Gaps = 19/225 (8%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLE--- 678
           I+GGQ+ +     +   D SSA+YF                 T + +G+++  EVL    
Sbjct: 218 IKGGQELQGT-EVYCPADPSSAAYFAALA-------------TLAPEGEIRLKEVLLNPT 263

Query: 677 ---------KMGAEVSWTENSVTVKGPPRAPSGRK---HLRAIDVNMNKMP---DVAMTL 543
                    +MG ++S+ EN   +   P A    +   +L+ + V+  ++P   D    L
Sbjct: 264 RDGFYRKLIEMGGDISF-ENYRELSNEPMADLVVRPVDNLKPVKVSPEEVPTLIDEIPIL 322

Query: 542 AVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTE 363
           AV+  FADG + ++     R KE++R+ A+ T LRKLG  VEE  D   I   + +    
Sbjct: 323 AVLMAFADGVSEVKGAKELRYKESDRIKAIVTNLRKLGVQVEEFEDGFAIHGTKEIKGGV 382

Query: 362 IDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
           I+T+ DHR+AMAF+ L    E  V I  P C   ++P+++E + K
Sbjct: 383 IETFKDHRIAMAFAVLGLVVEEEVIIDHPECVTVSYPEFWEDILK 427



>sp|Q59975|AROA_SYNY3 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|S76218|S76218
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Synechocystis sp. (strain PCC
           6803)>gb:SSAROAGEN_190499 Synechocystis sp. (PCC6803)
           aroA gene.>gb:BA000022_689258 Synechocystis sp. PCC 6803
           DNA, complete genome.
          Length = 447

 Score = 83.2 bits (204), Expect = 7e-15
 Identities = 69/197 (35%), Positives = 98/197 (49%), Gaps = 7/197 (3%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA+++L            VE  G +  +  V   EVL +MGA+++  EN   V 
Sbjct: 248 VPGDISSAAFWLVAASILPGSELLVENVGINPTRTGV--LEVLAQMGADIT-PENERLVT 304

Query: 629 GPPRAPSGRK--HLRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDVASWRVKETER 465
           G P A    +  HL+        +P   D    LAV A FA+G T I D A  RVKE++R
Sbjct: 305 GEPVADLRVRASHLQGCTFGGEIIPRLIDEIPILAVAAAFAEGTTRIEDAAELRVKESDR 364

Query: 464 MIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIK 285
           + A+ +EL K+GA V E  D   I     L   E+D+  DHR+AMA ++AA      TI 
Sbjct: 365 LAAIASELGKMGAKVTEFDDGLEIQGGSPLQGAEVDSLTDHRIAMALAIAALGSGGQTII 424

Query: 284 DPG-CTRKTFPDYFEVL 237
           +       ++P++F  L
Sbjct: 425 NRAEAAAISYPEFFGTL 441



>sp|Q9KCA6|ARA1_BACHD 3-phosphoshikimate 1-carboxyvinyltransferase 1
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase 1) (EPSP synthase 1) (EPSPS
           1).>pir|C83858|C83858
           5-enolpyruvoylshikimate-3-phosphate synthase aroE
           [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_655613 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 431

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 71/234 (30%), Positives = 115/234 (49%), Gaps = 8/234 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++E  GV++E         I GGQ      +  V GD SSA++FL            + 
Sbjct: 200 RMLEAFGVNIEKDGL--TVSIEGGQMLTGQ-HVVVPGDISSAAFFLVAGAMVPHSRITLT 256

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKH--LRAIDVNMNKMP- 561
             G +  +  +   EVL++MGA ++  EN     G P A    +   L+ +++  + +P 
Sbjct: 257 NVGINPTRAGI--LEVLKQMGATLAM-ENERVQGGEPVADLTIETSVLQGVEIGGDIIPR 313

Query: 560 --DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
             D    +AV+A  A G T I+D    +VKET R+  V +EL KLGA++    D  II  
Sbjct: 314 LIDEIPIIAVLATQASGRTVIKDAEELKVKETNRIDTVVSELTKLGASIHATDDGMIIEG 373

Query: 386 PERL-NVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVLQK 231
           P  L     + ++ DHR+ MA ++AA  AE PVT++       ++P +F+ L +
Sbjct: 374 PTPLKGGVTVSSHGDHRIGMAMAIAALLAEKPVTVEGTEAIAVSYPSFFDHLDR 427



>gb:FPS298919_136136 Flavobacterium psychrophilum aroA gene for
           5-enolpyruvylshikimate 3-phosphate synthase.
          Length = 409

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 3/194 (1%)
 Frame = -2

Query: 806 VEGDASSASYF--LXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTV 633
           +E D SSASYF  +           +     +SLQGD   AE+ +  G E  +  N    
Sbjct: 212 IESDWSSASYFYSIIALSEIGTRITLSSYKQNSLQGDCVLAEIYKDFGVETVFNLN---- 267

Query: 632 KGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAV 453
           K           L  I+  +N  PD+A T+AV          +  + + ++KET+R+ A+
Sbjct: 268 KTISITKINNCQLSTINYQLNNAPDIAQTIAVTCFGLRVGCHLTGLHTLKIKETDRLEAL 327

Query: 452 CTELRKLGATVEEGPDYCIITPPERLNV-TEIDTYDDHRMAMAFSLAACAEVPVTIKDPG 276
             EL KLGAT+    +   +     ++   +I TY DHRMAMAF+  A     + I+D G
Sbjct: 328 KVELTKLGATISVTNNSLTLEGSSNIHSDIKIKTYQDHRMAMAFAPLA-LRTSIIIEDAG 386

Query: 275 CTRKTFPDYFEVLQ 234
              K++P+++  LQ
Sbjct: 387 VVSKSYPNFWNDLQ 400



>gb:BX571660_778640 Wolinella succinogenes, complete genome; segment
           4/7.
          Length = 437

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 53/158 (33%), Positives = 82/158 (51%), Gaps = 2/158 (1%)
 Frame = -2

Query: 689 EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVN--MNKMPDVAMTLAVVALFADG 516
           +VLE MGA + ++  S T +           L+ I V+  ++ + D    LA+    A G
Sbjct: 272 KVLESMGARLHYSITSETYETIGDIEVSHHTLQGITVSERISWLIDELPALAIAMALAQG 331

Query: 515 PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRM 336
            + +++    RVKE++R+  V   LR LG  VEE  D   IT         ID++ DHR+
Sbjct: 332 KSRVQNAKELRVKESDRISVVVNNLRLLGVEVEEFEDGYEITGGTLQGGVTIDSHGDHRI 391

Query: 335 AMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
           AM+F+LA    VP+TI D  C   +FP++ E+L   +K
Sbjct: 392 AMSFALAGLV-VPLTINDSACIDVSFPNFLEILSSIAK 428



>sp|Q9WYI0|AROA_THEMA 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|G72388|G72388
           3-phosphoshikimate-1-carboxyvinyltransferase -
           Thermotoga maritima (strain MSB8)>gb:AE001715_38260
           Thermotoga maritima MSB8 section 27 of 136 of the
           complete genome.>gb:AE000512_1112733 Thermotoga maritima
           MSB8, complete genome.
          Length = 410

 Score = 80.1 bits (196), Expect = 6e-14
 Identities = 60/199 (30%), Positives = 102/199 (51%), Gaps = 7/199 (3%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSW--TENSVT 636
           V GD SSA++F+            V   G +  +  +   EV++ MGA + W  TE ++ 
Sbjct: 211 VPGDISSAAFFVVLGAIHPNARITVTDVGLNPTRTGL--LEVMKLMGANLEWEITEENLE 268

Query: 635 VKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVAL---FADGPTAIRDVASWRVKETER 465
             G  R  +   +L+ + V  + +P +   L +VAL   FA+G T +R+    R KE++R
Sbjct: 269 PIGTVRVETS-PNLKGVVVPEHLVPLMIDELPLVALLGVFAEGETVVRNAEELRKKESDR 327

Query: 464 MIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTI 288
           +  +    ++LG  +EE  D   I   + +    +D   DHRMAM FS+A   +E  V +
Sbjct: 328 IRVLVENFKRLGVEIEEFKDGFKIVGKQSIKGGSVDPEGDHRMAMLFSIAGLVSEEGVDV 387

Query: 287 KDPGCTRKTFPDYFEVLQK 231
           KD  C   +FP+++E+L++
Sbjct: 388 KDHECVAVSFPNFYELLER 406



>gb:AP008226_577914 Thermus thermophilus HB8 genomic DNA, complete
           genome.
          Length = 427

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 64/199 (32%), Positives = 101/199 (50%), Gaps = 9/199 (4%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA++FL            VEG G +  +  +    VL+ MGA++ W      ++
Sbjct: 230 VPGDFSSAAFFLVAALVTPGSEVVVEGVGLNPTRTGL--LTVLKAMGADLEWQ----VLE 283

Query: 629 GPPRAPSG---RKH--LRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDVASWRVKE 474
           G    P G    +H  L+ + V+   +P   D    LA  A +A+G T I  ++  RVKE
Sbjct: 284 GEAGEPVGWVRARHSLLKGVAVDPGLIPLMVDEVPVLAAAAAWAEGETYIPGLSELRVKE 343

Query: 473 TERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPV 294
           ++R+ A+   LR LG  VEEGPD+  I     +    +  + DHR+AMAF++A    V V
Sbjct: 344 SDRVRAIAENLRALGVEVEEGPDWLRIR-GGGVRPGRVRPFHDHRIAMAFAVAG-LPVGV 401

Query: 293 TIKDPGCTRKTFPDYFEVL 237
            +++P     ++P +F+ L
Sbjct: 402 EVEEPHWAEISYPGFFQDL 420



>gb:AE016859_350484 Pseudomonas syringae pv. tomato str. DC3000
           section 4 of 21 of the complete
           genome.>gb:AE016853_1035659 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 418

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/120 (38%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = -2

Query: 581 VNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKL--GATVEEGP 408
           ++ ++M D   TLAV+A F   P     +A+ RVKE +R+ A+C  L  +  G  VEEG 
Sbjct: 290 IDGSQMQDAIPTLAVLAAFNRQPVRFVGIANLRVKECDRISALCDGLCAIAPGLAVEEGD 349

Query: 407 DYCIITPPERLNVTE---IDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL 237
           D  +   P     T    IDT+ DHR+AM F+LA      + I+DP C  KT+P Y++ L
Sbjct: 350 DLIVHANPALAGTTVNALIDTHSDHRIAMCFALAGLKIKGIHIQDPDCVAKTYPGYWDAL 409



>pir|AD2655|AD2655 3-phosphoshikimate 1-carboxyvinyltransferase
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>pir|H97436|H97436 3-phosphoshikimate
           1-carboxyvinyltransferase (VC1732) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE007998_232389 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 56 of 254 of the
           complete sequence.>gb:AE009032_247685 Agrobacterium
           tumefaciens str. C58 circular chromosome, section 58 of
           256 of the complete sequence.>gb:AE007869_1082058
           Agrobacterium tumefaciens str. C58 circular chromosome,
           complete sequence.>gb:AE008688_1085528 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 425

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 5/126 (3%)
 Frame = -2

Query: 599 HLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKL--GA 426
           HL A +++ ++M D   T+AV+A F + P     +A+ RVKE +R+ AV   L ++  G 
Sbjct: 283 HLPA-EIDGSQMQDAIPTIAVIAAFNETPVRFVGIANLRVKECDRIRAVSLGLNEIREGL 341

Query: 425 TVEEGPDYCIITPPERLNVT---EIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFP 255
             EEG D  +   P     T    IDT+ DHR+AM+F+LAA     + I++P C  KT+P
Sbjct: 342 AHEEGDDLIVHADPSLAGQTVDASIDTFADHRIAMSFALAALKIGGIAIQNPACVAKTYP 401

Query: 254 DYFEVL 237
            Y++ L
Sbjct: 402 GYWKAL 407



>gb:AE017301_435728 Thermus thermophilus HB27 section 1 of 7 of the
           complete genome.>gb:AE017221_1077706 Thermus
           thermophilus HB27 complete genome.
          Length = 427

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 63/199 (31%), Positives = 100/199 (50%), Gaps = 9/199 (4%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD SSA++FL            VEG G +  +  +    VL+ MGA++ W      ++
Sbjct: 230 VPGDFSSAAFFLVAALVTPGSEVVVEGVGLNPTRTGL--LTVLKAMGADLEWR----VLE 283

Query: 629 GPPRAPSG---RKH--LRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDVASWRVKE 474
           G    P G    +H  L+ + V+   +P   D    LA  A +A+G T I  ++  RVKE
Sbjct: 284 GEAGEPVGWVRARHSLLKGVAVDPGLIPLMVDEVPVLAAAAAWAEGETYIPGLSELRVKE 343

Query: 473 TERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPV 294
           ++R+ A+   LR LG  VEEGPD+  I     +    +  + DHR+AMAF++     V V
Sbjct: 344 SDRVRAIAENLRALGVEVEEGPDWLRIR-GGGVRPGRVRPFHDHRIAMAFAVVG-LPVGV 401

Query: 293 TIKDPGCTRKTFPDYFEVL 237
            +++P     ++P +F+ L
Sbjct: 402 EVEEPHWAEISYPGFFQDL 420



>gb:AY354515_612695 Streptomyces sp. HK803 PlmR5 (plmR5), PlmR4
           (plmR4), PlmR3 (plmR3), PlmR2 (plmR2), Plm8 (plm8), Plm4
           (plm4), Plm5 (plm5), Plm6 (plm6), Plm7 (plm7), PlmT8
           (plmT8), PlmT7 (plmT7), PlmT6 (plmT6), PlmT5 (plmT5),
           PlmT4 (plmT4), PlmT3 (plmT3), PlmT2 (plmT2), PlmT1
           (plmT1), Plm1 (plm1), Plm2-3 (plm2-3), PlmJK (plmJK),
           PlmL (plmL), ChcA (chcA), PlmM (plmM), PlmR1 (plmR1),
           PlmI (plmI), PlmS2 (plmS2), PlmS3 (plmS3), and PlmS4
           (plmS4) genes, complete cds.
          Length = 1003

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 57/228 (25%), Positives = 105/228 (46%), Gaps = 5/228 (2%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
           +M + G+ V  +  W RF +   Q  + P    +  D  SA++ +           + G 
Sbjct: 202 MMRQFGLEVTVAPDWRRFDVAPHQSVR-PTELTLPPDIGSAAFGIATAALHPSDVLLRGM 260

Query: 725 ----GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPD 558
               G  +   +  F ++   MG  +        V G  R       L+A+DV+   +PD
Sbjct: 261 PSLTGGPADHPEFHFLDIARSMGVPMELDP----VAGGVRIQQDAPLLKAVDVDCRDVPD 316

Query: 557 VAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPER 378
           +   L+ +A FA G +  R+VA  R+KE++R   V  +L  +GA +E   D   +T  + 
Sbjct: 317 MLPVLSTLATFAHGESVFRNVAHTRLKESDR-AGVMVQLNSMGAELELSDDTLRVTGVDS 375

Query: 377 LNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVL 237
           L   E+ +Y+DHR+ M+ ++A+  A    T+  P   R ++P + +++
Sbjct: 376 LVGAELSSYNDHRVLMSLAVASSRARGHSTLSYPHAYRISYPGFLDMM 423



>sp|Q8Y5Y0|AROA_LISMO 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|AC1315|AC1315
           5-enolpyruvylshikimate-3-phosphate synthase homolog aroE
           [imported] - Listeria monocytogenes (strain
           EGD-e)>gb:AL591981_536414 Listeria monocytogenes strain
           EGD, complete genome, segment 9/12.
          Length = 428

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 60/216 (27%), Positives = 104/216 (48%), Gaps = 7/216 (3%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKM 672
           ++GGQK+       V GD SSA++F+            +   G +  +  +   +V+++M
Sbjct: 216 VKGGQKFTGQ-EMTVPGDVSSAAFFIVAGLITPGSEIELTHVGLNPTRTGI--FDVVKQM 272

Query: 671 GAEVSWTENS-VTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFA---DGPTAI 504
           G  +   ++S  T K           L+  +++ + +P +   + V+AL A   +G T I
Sbjct: 273 GGSLVVKDSSRSTGKLAGTVVVKTSKLKGTEIDGDIIPRLIDEIPVIALLATQAEGTTII 332

Query: 503 RDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAF 324
           +D A  +VKET R+ AV TEL K+GA +    D  II     L+   + +Y DHR+ M  
Sbjct: 333 KDAAELKVKETNRIDAVATELNKMGADITPTEDGLIIHGKTPLHAANVTSYGDHRIGMML 392

Query: 323 SLAA--CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            +AA    E  V ++ P     ++P +FE ++   K
Sbjct: 393 QIAALLVEEGDVELERPEAVSVSYPTFFEDIRSLLK 428



>gb:AE017239_414039 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 13 of 16 of the complete
           genome.>gb:AE016958_1057443 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 435

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 69/221 (31%), Positives = 102/221 (46%), Gaps = 2/221 (0%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
           ++ + GV V+ S   +R+ +R G    +  +  VE D ++A  FL           + G 
Sbjct: 206 MLRQAGVDVDDSVP-NRWQVRPGPV--AARHWEVEPDLTNAVPFLAAAVVSGGTVRITGW 262

Query: 725 GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMT 546
              S+Q       VL K+ A VS T++S+ V+G          LRA+       P VA  
Sbjct: 263 PADSVQPADNILSVLGKLNAVVSQTDSSLEVRGSGSYDGFDVDLRAVG---ELTPSVA-- 317

Query: 545 LAVVALFADGPTA-IRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP-PERLN 372
            A+ AL   G  + +  +A  R  ET+R+ A+  E+ +LG    E PD  +IT  P R  
Sbjct: 318 -ALAALATPGSVSRLSGIAHLRGHETDRLAALSAEINRLGGDCTETPDGLVITATPLRPG 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDY 249
           V     Y DHRMAMA ++       V + D G T KT PD+
Sbjct: 377 VWH--AYADHRMAMAGAIVGLRVAGVRVDDIGATSKTLPDF 415



>gb:AE017328_444373 Listeria monocytogenes str. 4b F2365, section 7
           of 10 of the complete genome.>gb:AE017262_1076729
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 428

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 60/216 (27%), Positives = 102/216 (47%), Gaps = 7/216 (3%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKM 672
           ++GGQ +       V GD SSA++F+            +   G +  +  +   +V+E+M
Sbjct: 216 VKGGQTFTGQ-EMTVPGDVSSAAFFIVAGLITPGSEIELTHVGLNPTRTGI--FDVVEQM 272

Query: 671 GAEVSWTENS-VTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFA---DGPTAI 504
           G  +   ++S  T K           L+  ++  + +P +   + V+AL A   +G T I
Sbjct: 273 GGSLVVKDSSRSTGKLAGTVVVKTSDLKGTEIGGDIIPRLIDEIPVIALLATQAEGTTII 332

Query: 503 RDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAF 324
           +D A  +VKET R+ AV TEL K+GA +    D  II     L+   + +Y DHR+ M  
Sbjct: 333 KDAAELKVKETNRIDAVATELNKMGADITPTEDGLIIRGKTPLHAANVTSYGDHRIGMML 392

Query: 323 SLAA--CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            +AA    E  V ++ P     ++P +FE ++   K
Sbjct: 393 QIAALLVEEGDVELERPEAVSVSYPTFFEDIRSLLK 428



>sp|P43905|AROA_LACLC 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|S52580|S52580
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Lactococcus lactis>gb:LLTYRAPH_141092
           L.lactis tyrA, aroA, aroK and pheA genes.
          Length = 430

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 63/236 (26%), Positives = 111/236 (47%), Gaps = 8/236 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXV-E 732
           +++ + G  +  SD     L+ GGQK        V GD SSA+++L           + E
Sbjct: 198 EMLVQFGGEITVSDK--TILVPGGQKLLGQ-EVTVPGDISSAAFWLVAGLVVENSGLILE 254

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
             G +  +  +   EV++ MG ++   E     K         + L+  +++ + +P + 
Sbjct: 255 NVGINETRTGI--LEVIQAMGGQLEILEQDEVAKAATLKVKASQ-LKGTEISGDLIPRLI 311

Query: 551 MTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE 381
             L ++AL A   +G T IRD A  +VKET+R+  V   L  +GA +E   D  II    
Sbjct: 312 DELPIIALLATQAEGKTIIRDAAELKVKETDRIAVVADALNSMGANIEPTDDGMIIQGGT 371

Query: 380 RLNVTE--IDTYDDHRMAMAFSLAA--CAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
           +L+  E  I+T  DHR+ M  ++AA       + ++     + ++P +F+ L+K S
Sbjct: 372 KLHAPENAINTLGDHRIGMMVAIAALLVENGEIELERAEAIQTSYPSFFDDLEKLS 427



>gb:BA000043_738773 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 427

 Score = 74.3 bits (181), Expect = 3e-12
 Identities = 60/217 (27%), Positives = 109/217 (50%), Gaps = 12/217 (5%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKM 672
           + G Q+ +   + +V GD SSA++FL            ++  G +  +  +   +VL +M
Sbjct: 215 VAGPQRLRGT-HIYVPGDISSAAFFLVAGAIVPNSEITLKNVGLNPTRTGI--IDVLTQM 271

Query: 671 GAEVSWTENSVTVKGPPRAPSG-----RKHLRAIDVNMNKMPDVAMTLAVVALFA---DG 516
           GA+++       V+     P G        LRA+++  + +P +   + ++AL A   +G
Sbjct: 272 GADIAIDN----VRNEETEPVGDITVRTSTLRAVEIGGDLIPRLIDEIPIIALLATQAEG 327

Query: 515 PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII--TPPERLNVTEIDTYDDH 342
            T I+D +  +VKET R+  V TEL+KLGA +E   D  +I    P   +   +D++ DH
Sbjct: 328 TTVIKDASELKVKETNRIHTVVTELKKLGADIEATDDGMMIRGKTPLYADGIVVDSHGDH 387

Query: 341 RMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQ 234
           R+ M  ++AAC A+  V ++       ++P +F  L+
Sbjct: 388 RIGMMLAVAACIAKGTVRLERSEAVAVSYPAFFADLR 424



>gb:BX572096_797740 Prochlorococcus marinus MIT9313 complete genome;
           segment 2/7.
          Length = 441

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 67/239 (28%), Positives = 112/239 (46%), Gaps = 10/239 (4%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFL-IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXV 735
           +++   G  +E      R + +  GQK     N  V GD SSA+++L            V
Sbjct: 209 RMLRAFGADLEVGGEMGRHIRVSPGQKLYGQ-NIVVPGDISSAAFWLVAGALVPGAELVV 267

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPP----RAPSGRKHLRAIDVNMNK 567
           E  G +  +  +   EVL++M A +    N   V G P    R   G   L+   +N + 
Sbjct: 268 ENVGLNPTRTGI--LEVLQQMEARIE-VLNRHEVAGEPVGDLRVRQGS--LKPFSINGDI 322

Query: 566 MP---DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCI 396
           +P   D    LAV A F DG + I D +  RVKET+R+  +  +L  +GA ++E  D   
Sbjct: 323 IPRLVDEVPILAVAACFCDGESKITDASELRVKETDRLAVMTRQLTAMGADIDEHADGLT 382

Query: 395 ITPPERLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
           I     L  T++D+  DHR+AM+ ++AA  AE    +        ++P++++ L++  +
Sbjct: 383 IRGGRTLRGTDLDSETDHRVAMSLAVAALLAEGNSRLTGSEAAAVSYPNFWDDLERLHR 441



>gb:AF114233_480032 Corynebacterium glutamicum
           5-enolpyruvylshikimate 3-phosphate synthase (aroA) gene,
           complete cds.
          Length = 498

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 57/225 (25%), Positives = 105/225 (46%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
           ++   G+ +E S++  ++++  G+         +E D S+A+ FL           +   
Sbjct: 279 MLRSAGIEIEESEN--QWVVHPGEILGRTWR--IEPDLSNATPFLAAAAVTGGTIKINHW 334

Query: 725 GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMT 546
              + Q       +LE+MG EV         +G   + +G   L+ I+++M+ + ++  T
Sbjct: 335 PIKTTQPGDAIRSILERMGCEVELVAQG---EGYDLSVTGPVALKGIEIDMSDIGELTPT 391

Query: 545 LAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVT 366
           +A +A  A   + +  +A  R  ET+R+ A+  E+ KLG    E  D  +I P   L+  
Sbjct: 392 VAALAALASTESRLTGIAHLRGHETDRLAALTAEINKLGGKCTELKDGLLIEPAS-LHGG 450

Query: 365 EIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
              +Y DHRMA A ++   A   V ++D   T KTFP +  V ++
Sbjct: 451 VWHSYADHRMATAGAIIGLAVDGVQVEDIKTTSKTFPGFENVWEE 495



>sp|Q9Z470|AROA_CORGL 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:BA000036_718491
           Corynebacterium glutamicum ATCC 13032 DNA, complete
           genome.>gb:BX927150_832347 Corynebacterium glutamicum
           ATCC 13032, IS fingerprint type 4-5, complete genome;
           segment 3/10.>gb:AX064129_1458978 Sequence 411 from
           Patent WO0100843.
          Length = 430

 Score = 73.9 bits (180), Expect = 4e-12
 Identities = 57/225 (25%), Positives = 105/225 (46%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
           ++   G+ +E S++  ++++  G+         +E D S+A+ FL           +   
Sbjct: 211 MLRSAGIEIEESEN--QWVVHPGEILGRTWR--IEPDLSNATPFLAAAAVTGGTIKINHW 266

Query: 725 GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMT 546
              + Q       +LE+MG EV         +G   + +G   L+ I+++M+ + ++  T
Sbjct: 267 PIKTTQPGDAIRSILERMGCEVELVAQG---EGYDLSVTGPVALKGIEIDMSDIGELTPT 323

Query: 545 LAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVT 366
           +A +A  A   + +  +A  R  ET+R+ A+  E+ KLG    E  D  +I P   L+  
Sbjct: 324 VAALAALASTESRLTGIAHLRGHETDRLAALTAEINKLGGKCTELKDGLLIEPAS-LHGG 382

Query: 365 EIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQK 231
              +Y DHRMA A ++   A   V ++D   T KTFP +  V ++
Sbjct: 383 VWHSYADHRMATAGAIIGLAVDGVQVEDIKTTSKTFPGFENVWEE 427



>gb:AE017164_395504 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031173 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 444

 Score = 73.2 bits (178), Expect = 7e-12
 Identities = 62/235 (26%), Positives = 113/235 (48%), Gaps = 9/235 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFL-IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXV 735
           ++++  G ++E S    R + ++ G K K      V GD SSA+++L            +
Sbjct: 211 RMLKAFGANLEISGEMGRHITLKPGVKLKGT-QIVVPGDISSAAFWLIAGSIIPKSDITI 269

Query: 734 EGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAP---SGRKHLRAIDVNMNKM 564
           E  G +  +  +   EVL+ MGA +    N   V G P      +  + L++  ++   M
Sbjct: 270 ENIGLNPTRTGI--LEVLDNMGANIQLL-NKREVAGEPVGDIRVTYSEQLKSFTLDNEIM 326

Query: 563 P---DVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII 393
           P   D    L V A F DG + I   +  R+KET+R+  +  +L+K+GA +EE  D   I
Sbjct: 327 PRLIDEVPILIVAACFCDGISQITGASELRIKETDRLQVMTRQLKKMGAKIEEKADGLTI 386

Query: 392 TPPERLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVLQK 231
              + L+   +D+  DHR+AM+  +A+  A+   +I        ++P+++  L++
Sbjct: 387 NGSQSLHGANLDSESDHRIAMSLGIASLLADSNSSIFRSDAASVSYPEFWSDLER 441



>gb:BX572091_796239 Prochlorococcus marinus MED4 complete genome;
           segment 2/5.
          Length = 438

 Score = 72.8 bits (177), Expect = 9e-12
 Identities = 55/203 (27%), Positives = 99/203 (48%), Gaps = 8/203 (3%)
 Frame = -2

Query: 815 NAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSV 639
           N  + GD SSA++++            ++  G +  +  +    V+ +MG      + S 
Sbjct: 236 NILIPGDISSAAFWMIAASIVPESEIIIKNVGLNPTRTGI--LNVMNEMGCNYEILDKS- 292

Query: 638 TVKGPPRAPSGRKH---LRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDVASWRVK 477
           T+ G P      K+   L+   V  + +P   D    LAV A F  G + I+D    RVK
Sbjct: 293 TIAGEPIGSINIKYVSNLKPFKVEGDILPKLIDEIPILAVAACFCSGVSEIKDAKELRVK 352

Query: 476 ETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAA-CAEV 300
           ET+R+  + T+L+K GA + E  D  II    + +  E+D+  DHR++M+ ++A+  A+ 
Sbjct: 353 ETDRLKVMATQLKKFGANILEKEDGLIINGESKFHSAEVDSETDHRVSMSLAIASLLAKG 412

Query: 299 PVTIKDPGCTRKTFPDYFEVLQK 231
              I     +R ++P +++ L+K
Sbjct: 413 SSKIARAEASRVSYPTFWDDLEK 435



>sp|Q8RB11|AROA_THETN 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE013066_288695
           Thermoanaerobacter tengcongensis MB4, section 93 of 244
           of the complete genome.>gb:AE008691_1110760
           Thermoanaerobacter tengcongensis strain MB4, complete
           genome.
          Length = 423

 Score = 72.8 bits (177), Expect = 9e-12
 Identities = 59/205 (28%), Positives = 99/205 (48%), Gaps = 6/205 (2%)
 Frame = -2

Query: 839 GQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAE 663
           G K K      V GD SSA+YF+            ++    +  +  +   +VL+ MG  
Sbjct: 217 GSKLKGQ-KIIVPGDISSAAYFIVAANLLPNSEVVIKDVNVNPTRTGI--IDVLKGMGGN 273

Query: 662 VSW-TENSVTVKGPPRAPSGRKHLRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRDV 495
           V    E  V  +           L+ I++  + +P   D    +AV A+FA+G T I++ 
Sbjct: 274 VELINERYVNNEKIADIVVKSSKLKGIEIGGDLIPKLIDEIPVIAVAAVFAEGTTVIKNA 333

Query: 494 ASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLA 315
              +VKE+ R+ ++ +EL K+GA + E  D  II     L   E+++Y+DHR+AM+  +A
Sbjct: 334 EELKVKESNRIKSMTSELGKMGAKIFETEDGMIIEGTGFLRGAEVESYNDHRVAMSLWIA 393

Query: 314 A-CAEVPVTIKDPGCTRKTFPDYFE 243
              AE    IK   C   ++PD+++
Sbjct: 394 GLLAEGRTIIKKAECVDVSYPDFYK 418



>sp|Q9CEU0|AROA_LACLA 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|H86842|H86842
           hypothetical protein aroA [imported] - Lactococcus
           lactis subsp. lactis (strain IL1403)>gb:AE006404_218646
           Lactococcus lactis subsp. lactis IL1403 section 166 of
           218 of the complete genome.>gb:AE005176_1095719
           Lactococcus lactis subsp. lactis IL1403, complete
           genome.
          Length = 430

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 61/238 (25%), Positives = 113/238 (47%), Gaps = 8/238 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXV-E 732
           +++ + G  ++ SD     L+ GGQK        V GD SSA+++L           + E
Sbjct: 198 EMLVQFGGELKVSDK--TILVPGGQKLVGQ-KVVVPGDISSAAFWLVAALVVENSELILE 254

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
             G +  +  +   EV++ MG ++   E     K         + L+  +++ + +P + 
Sbjct: 255 NVGVNETRTGI--IEVIQAMGGQLEILEQDNVAKAATLKVKASQ-LKGTEISGDLIPRLI 311

Query: 551 MTLAVVALFA---DGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE 381
             L ++AL A    G T IRD A  +VKET+R+  V   L  +GA ++   D  II    
Sbjct: 312 DELPIIALLATQAQGQTIIRDAAELKVKETDRIAVVANALNSMGAKIQPTDDGMIIQGGT 371

Query: 380 RLNVTE--IDTYDDHRMAMAFSLAA--CAEVPVTIKDPGCTRKTFPDYFEVLQKFSKH 219
           +L+  E  I+T  DHR+ M  ++AA       + ++     + ++P +F+ L++ S++
Sbjct: 372 KLHAPENSINTLGDHRIGMMAAIAALLVKNGEIELERAEAIQTSYPSFFDDLEQLSEN 429



>gb:AF481102_514468 Candidatus Tremblaya princeps MviN (mviN) gene,
           partial cds; ribosomal protein L13 (rpL13), ribosomal
           protein S9 (rpS9), putative protein HesB (hesB),
           dihydroxyacid dehydrase (ilvD),
           5-enolpyruvylshikimate-3-phosphate synthase (aroA),
           ribosomal protein S1 (rpS1), ribosomal protein S16
           (rpS16), ribosomal protein L19 (rpL19), 5,
           10-methylenetetrahydrofolate reductase (metF), chaperone
           Hsp60 (groEL), chaperone Hsp10 (groES), DNA polymerase
           alpha subunit (dnaE), valine sensitive acetolactate
           synthase III subunit (ilvI), ketol-acid reductoisomerase
           (ilvC), alpha-isopropylmalate synthase (leuA), and
           ribosomal protein S15 (rpS15) genes, complete cds; 16S
           ribosomal RNA, 23S ribosomal RNA, and 5S ribosomal RNA
           genes, complete sequence; putative protein YabC (yabC),
           DNA polymerase III epsilon subunit (dnaQ), cell division
           protein (ftsJ), arginosuccinate lyase (argH), and
           ribosomal protein L31 (rpL31) genes, complete cds; and
           unknown genes.
          Length = 432

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 51/165 (30%), Positives = 75/165 (45%), Gaps = 5/165 (3%)
 Frame = -2

Query: 728 CGTS-SLQGDVKFAEVLEKMGAEVSWT--ENSVTVKGPPRAPSGRKHLRAIDVNMNKMPD 558
           CG   + Q D   A+ +  MG  + W   + +   +    AP+ R       +     PD
Sbjct: 269 CGVDHASQSDATMADAMSSMGCAM-WQCRDGNAMWRAARHAPTPR-------LLCCSAPD 320

Query: 557 VAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVE--EGPDYCIITPP 384
            AMT   ++L   G +    V SWR KET+R++A+  ELR++G   +   G   C+    
Sbjct: 321 GAMTAMTISLALAGASDAVGVLSWRYKETDRVLAMALELRRMGVAADCGMGSMACLSCSL 380

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDY 249
                 ++ TY DHR+AM  SL   A   V    P C  KT+PDY
Sbjct: 381 TWHGRADVSTYRDHRIAMCCSLMHAAGCGVRTSGPQCVCKTYPDY 425



>gb:BX571965_790464 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 451

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 67/229 (29%), Positives = 101/229 (44%), Gaps = 10/229 (4%)
 Frame = -2

Query: 902 MERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCG 723
           +   GV+VE+  ++ RF + G  ++K P    V  D +S +  L              CG
Sbjct: 215 LAHAGVAVEYDAAFRRFFVPGRDRFK-PSEFTVGADPASTAAILAL------------CG 261

Query: 722 TSSLQGDVKFAEVLEK---MGAEVSWTENSVTV----KGPPRAPSGRKHLRAIDVNMNKM 564
             SL  DV      E+    GA + +  ++ T+     G      G   +RA D + +  
Sbjct: 262 --SLASDVTLNGFFEEELGSGAVIRYLTDTGTLIDELPGNRIRIRGGASIRAQDFDGSLA 319

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII--T 390
           PD    LA  A FA+G +   ++   R KE++R+     EL KLG   EE  D  II   
Sbjct: 320 PDAVPALAGRAAFAEGTSTFYNIEHIRYKESDRISDFRRELDKLGVRSEEKLDQLIIHGN 379

Query: 389 PPERLNVTEIDTYDDHRMAMAF-SLAACAEVPVTIKDPGCTRKTFPDYF 246
           P        +D + DH + MA  ++    E PV IK+P    +T+PDYF
Sbjct: 380 PRSYRGGAVVDGHYDHGLIMALTTIGLHCEHPVLIKEPHHVGQTYPDYF 428



>gb:BX248345_760613 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 12/14.
          Length = 450

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 63/221 (28%), Positives = 102/221 (46%), Gaps = 2/221 (0%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
           ++ + GV ++ S   +R+ +R G       +  +E D ++A  FL           + G 
Sbjct: 206 MLRQAGVDIDDSTP-NRWQVRPGPVAARRWD--IEPDLTNAVAFLSAAVVSGGTVRITGW 262

Query: 725 GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMT 546
              S+Q       +L ++ A V   ++S+ V+GP         LRA+       P VA  
Sbjct: 263 PRVSVQPADHILAILRQLNAVVIHADSSLEVRGPTGYDGFDVDLRAVG---ELTPSVA-- 317

Query: 545 LAVVALFADGPTA-IRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIIT-PPERLN 372
            A+ AL + G  + +  +A  R  ET+R+ A+ TE+ +LG T  E PD  +IT  P R  
Sbjct: 318 -ALAALASPGSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCRETPDGLVITATPLRPG 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDY 249
           +     Y DHRMAMA ++       V + D   T KT P++
Sbjct: 377 IWR--AYADHRMAMAGAIIGLRVAGVEVDDIAATTKTLPEF 415



>gb:AE010267_261266 Pyrococcus furiosus DSM 3638, section 142 of 173
           of the complete genome.>gb:AE009950_902047 Pyrococcus
           furiosus DSM 3638, complete genome.
          Length = 440

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 67/236 (28%), Positives = 107/236 (45%), Gaps = 6/236 (2%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIR-----GGQKYKSPGNAFVEGDASSASYFLXXXXXXXX 747
           LK ME  GV  + +   +R +I       G K+K PG      D SSA+ FL        
Sbjct: 222 LKTMEEFGVKYDKAQENERLVIFVDPGVKGTKFKVPG------DYSSAANFLVAGALYGK 275

Query: 746 XXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNK 567
                      +Q D +   +L + GA+V   +  V V+   R P        ++V+ + 
Sbjct: 276 IRV-RNLMRDDVQADKEILNILREYGAKVKVKDEYVEVESNERNP--------LNVDCSN 326

Query: 566 MPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
            PD+   LAV+A +A+G + IR     R+KE++R+ A+   L + G  V E  D   I  
Sbjct: 327 FPDLFPLLAVLAAYAEGKSVIRG-RQLRIKESDRIHAMAVNLSRAGIRVRELSDGLEIWG 385

Query: 386 PERLNVTEIDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            +        T++DHR+ MA + LA  A+    I +     K++P++FE L +  K
Sbjct: 386 GQPKGFRG-KTFNDHRITMALAILALGAKGESIIPETKSIAKSYPNFFEDLMRVIK 440



>sp|Q8U0A0|AROA_PYRFU Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).
          Length = 406

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 67/236 (28%), Positives = 107/236 (45%), Gaps = 6/236 (2%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIR-----GGQKYKSPGNAFVEGDASSASYFLXXXXXXXX 747
           LK ME  GV  + +   +R +I       G K+K PG      D SSA+ FL        
Sbjct: 188 LKTMEEFGVKYDKAQENERLVIFVDPGVKGTKFKVPG------DYSSAANFLVAGALYGK 241

Query: 746 XXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNK 567
                      +Q D +   +L + GA+V   +  V V+   R P        ++V+ + 
Sbjct: 242 IRV-RNLMRDDVQADKEILNILREYGAKVKVKDEYVEVESNERNP--------LNVDCSN 292

Query: 566 MPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
            PD+   LAV+A +A+G + IR     R+KE++R+ A+   L + G  V E  D   I  
Sbjct: 293 FPDLFPLLAVLAAYAEGKSVIRG-RQLRIKESDRIHAMAVNLSRAGIRVRELSDGLEIWG 351

Query: 386 PERLNVTEIDTYDDHRMAMAFS-LAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            +        T++DHR+ MA + LA  A+    I +     K++P++FE L +  K
Sbjct: 352 GQPKGFRG-KTFNDHRITMALAILALGAKGESIIPETKSIAKSYPNFFEDLMRVIK 406



>sp|P22487|AROA_MYCTU 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|E70590|E70590
           3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_23437 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:MSGARO_150387
           M.tuberculosis aroA gene, complete cds.>gb:MTAROA_150932
           M. tuberculosis aroA gene for
           5-enolpyruvylshikimate-3-phosphate synthase (EC
           2.5.1.19).>gb:BX842582_821331 Mycobacterium tuberculosis
           H37Rv complete genome; segment 11/13.
          Length = 450

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 63/221 (28%), Positives = 102/221 (46%), Gaps = 2/221 (0%)
 Frame = -2

Query: 905 LMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGC 726
           ++ + GV ++ S   +R+ +R G       +  +E D ++A  FL           + G 
Sbjct: 206 MLRQAGVDIDDSTP-NRWQVRPGPVAARRWD--IEPDLTNAVAFLSAAVVSGGTVRITGW 262

Query: 725 GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMT 546
              S+Q       +L ++ A V   ++S+ V+GP         LRA+       P VA  
Sbjct: 263 PRVSVQPADHILAILRQLNAVVIHADSSLEVRGPTGYDGFDVDLRAVG---ELTPSVA-- 317

Query: 545 LAVVALFADGPTA-IRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIIT-PPERLN 372
            A+ AL + G  + +  +A  R  ET+R+ A+ TE+ +LG T  E PD  +IT  P R  
Sbjct: 318 -ALAALASPGSVSRLSGIAHLRGHETDRLAALSTEINRLGGTCRETPDGLVITATPLRPG 376

Query: 371 VTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDY 249
           +     Y DHRMAMA ++       V + D   T KT P++
Sbjct: 377 IWR--AYADHRMAMAGAIIGLRVAGVEVDDIAATTKTLPEF 415



>gb:BX842655_826251 Bdellovibrio bacteriovorus complete genome,
           strain HD100; segment 10/11.
          Length = 394

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 58/211 (27%), Positives = 103/211 (48%), Gaps = 3/211 (1%)
 Frame = -2

Query: 860 DRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVL 681
           +++LI  GQ+  S     VE D SSA + +           +      S Q D  F E+ 
Sbjct: 189 NKYLIPAGQRI-SKLEYRVESDLSSA-FTMASAGALVGGAKLLNYPVKSSQPDGIFVEIF 246

Query: 680 EKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIR 501
           ++M  E    E ++ VK  P A      LRA++ ++ + PD+   LAV+  +A+G + + 
Sbjct: 247 KQMNIETEMVEGALCVK--PCAG-----LRAVNWDLYQSPDLFPVLAVLCSWANGSSKLY 299

Query: 500 DVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYD---DHRMAM 330
           +      KE+ R+  +     +LG + E  PD  II    + ++ +  T+D   DHRM M
Sbjct: 300 NAPHLAAKESNRIAKIADLFERLGISHEVLPDGMIIHGNPQQSLKKGITFDSDQDHRMVM 359

Query: 329 AFSLAACAEVPVTIKDPGCTRKTFPDYFEVL 237
           A +L       +TI++P    K+FP++++++
Sbjct: 360 AATLMKLKGHDITIENPEAINKSFPEFWDMI 390



>gb:AE013598_296087 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 440

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 68/232 (29%), Positives = 109/232 (46%), Gaps = 7/232 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++   GV ++ S    R  +RGGQ+ ++   A V  D SSA++F+            + 
Sbjct: 204 RMLSAFGVDIDFSPGSAR--LRGGQRLRATDIA-VPADFSSAAFFIVAASIVPDSEVVLR 260

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKH--LRAIDVNMNKMPD 558
             G +  +  +  A  L  MGA++S  EN     G P A    ++  LR   +    +PD
Sbjct: 261 AVGLNPRRTGLLAA--LRLMGADIS-EENHAEHGGEPVADLRVRYAPLRGAQIPEALVPD 317

Query: 557 VA---MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
           +      L V A  A G T +   A  RVKE++R+ A+ T LR LG  V+E PD   I  
Sbjct: 318 MIDEFPALFVAATAASGQTVVTGAAELRVKESDRLAAMATGLRTLGVQVDETPDGATIHG 377

Query: 386 PERLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVLQ 234
              +    I+++ DHR+AMAF++A   +   V + D      +FP +  + Q
Sbjct: 378 GS-IGSGVIESHGDHRIAMAFAIAGQLSSGSVRVNDVANVATSFPGFDTLAQ 428



>gb:CP000010_864682 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 451

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 67/229 (29%), Positives = 101/229 (44%), Gaps = 10/229 (4%)
 Frame = -2

Query: 902 MERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCG 723
           +   GV+VE+  ++ RF + G  ++K P    V  D +S +  L              CG
Sbjct: 215 LAHAGVAVEYDAAFRRFFVPGRDRFK-PSEFTVGADPASTAAILAL------------CG 261

Query: 722 TSSLQGDVKFAEVLEK---MGAEVSWTENSVTV----KGPPRAPSGRKHLRAIDVNMNKM 564
             SL  DV      E+    GA + +  ++ T+     G      G   +RA D + +  
Sbjct: 262 --SLASDVTLNGFFEEELGSGAVIRYLTDTGTLIDELPGNRIRIRGGASIRAQDFDGSLA 319

Query: 563 PDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCII--T 390
           PD    LA  A FA+G +   ++   R KE++R+     EL KLG   EE  D  II   
Sbjct: 320 PDAVPALAGRAAFAEGTSTFYNIEHIRYKESDRISDFRRELDKLGVRSEEKLDQLIIHGN 379

Query: 389 PPERLNVTEIDTYDDHRMAMAF-SLAACAEVPVTIKDPGCTRKTFPDYF 246
           P        +D + DH + MA  ++    E PV IK+P    +T+PDYF
Sbjct: 380 PRGYRGGAVVDGHYDHGLIMALTTIGLHCEHPVLIKEPHHVGQTYPDYF 428



>gb:AE016822_340868 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 436

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 53/189 (28%), Positives = 85/189 (44%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKG 627
           +E D S+A+ FL           + G   S+ Q     A +L   GA V+   + +TV G
Sbjct: 245 IEPDLSNAAPFLAAAVVTGGSVTITGWPESTTQVGADLAHLLPLFGATVTKAVDRLTVTG 304

Query: 626 PPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCT 447
           P R       ++ I +++    ++A  L  +A  AD P+ I  +      ET+R+ A+  
Sbjct: 305 PER-------IQGIRLDLTTGGELAPALVAIAALADSPSEITGIGHICHHETDRLAALAA 357

Query: 446 ELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTR 267
           E+   G  V E  D  +   P  L      +Y+DHRMA A ++   A   V I++   T 
Sbjct: 358 EINGFGGAVTELED-GLRVEPRPLTGGVWRSYEDHRMATAGAIVGLAVEGVEIENVATTA 416

Query: 266 KTFPDYFEV 240
           KT P + E+
Sbjct: 417 KTLPHFTEL 425



>sp|Q8DUV8|AROA_STRMU 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE014920_313176
           Streptococcus mutans UA159 section 68 of 185 of the
           complete genome.>gb:AE014133_940177 Streptococcus mutans
           UA159 complete genome.
          Length = 427

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 55/214 (25%), Positives = 100/214 (46%), Gaps = 6/214 (2%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXV-EGCGTSSLQGDVKFAEVLEKM 672
           I GGQ++ +  N  V GD SSA+++L             +  G +  +  +   EV+E M
Sbjct: 216 ISGGQEFTAQ-NVIVPGDISSAAFWLAAGLIVSNSKLTLKNVGINETRTGI--LEVIEAM 272

Query: 671 GAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFA---DGPTAIR 501
           G +V  ++     K          +L+  ++  + +P +   L ++AL A   +G T I 
Sbjct: 273 GGKVELSDRDDLAKAATLTVES-SNLKGTEIGGDIIPRLIDELPIIALLATQANGRTVIY 331

Query: 500 DVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFS 321
           D    +VKET+R+  V   L  +GA +    D  II     L+  +++T+ DHR+ M  +
Sbjct: 332 DAQELKVKETDRIQVVADALNAMGAKITPTDDGMIIEGKTNLHGAKVNTFGDHRIGMMTA 391

Query: 320 LAA--CAEVPVTIKDPGCTRKTFPDYFEVLQKFS 225
           +AA    E  V ++       ++P +F  L++ +
Sbjct: 392 IAALLVKEGEVELERAEAINTSYPTFFSDLERIT 425



>sp|Q9PK28|AROA_CHLMU 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE002332_45229
           Chlamydia muridarum Nigg section 62 of 85 of the
           complete genome.>gb:AE002160_1149369 Chlamydia muridarum
           Nigg, complete genome.
          Length = 441

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 57/217 (26%), Positives = 102/217 (47%), Gaps = 4/217 (1%)
 Frame = -2

Query: 887 VSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYF--LXXXXXXXXXXXVEGCGTSS 714
           +++  S   D     G Q  KS   + V GD SSA++   L           +    +  
Sbjct: 209 LNISFSREQDSLFFPGAQSIKSFSYS-VPGDYSSAAFLAALGLLSSSSNPTVLYNLPSKD 267

Query: 713 LQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVV 534
            QGD +   +L+ +GA++   ++ + ++  P + SG        ++M+   D    LAV+
Sbjct: 268 PQGDKQLFSLLKSLGADIVIEKDHIEIR--PSSFSGGV------IDMDPFIDALPILAVL 319

Query: 533 ALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDT 354
             FA  P+ + +    R KE+ R+ A+  ELRK+G +V    D   I  P RL+   + +
Sbjct: 320 CCFAKNPSHLYNALGARDKESNRIEAIAHELRKMGGSVHPTQDGLYI-EPSRLHGAVVHS 378

Query: 353 YDDHRMAMAFSLAA--CAEVPVTIKDPGCTRKTFPDY 249
           ++DHR+AMA ++A    +     + +  C  K+FP +
Sbjct: 379 HNDHRIAMALAVAGVHASSGQTLLCNTQCVNKSFPHF 415



>sp|Q9YEK9|AROA_AERPE Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>pir|A72642|A72642 probable
           3-phosphoshikimate 1-carboxyvinyltransferase APE0569 -
           Aeropyrum pernix (strain K1)>gb:BA000002_651281
           Aeropyrum pernix K1 DNA, complete genome.
          Length = 427

 Score = 70.5 bits (171), Expect = 4e-11
 Identities = 67/230 (29%), Positives = 106/230 (46%), Gaps = 3/230 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVE 732
           L+ +   GV VE  + +  F +RG  K   P +A V GD SSAS+ L            E
Sbjct: 200 LESLSMFGVRVER-EGYRLFRLRGTPK---PVDAAVPGDYSSASFMLAAGAIAGRVEV-E 254

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVA 552
           G      Q D +  E+L  MGA V        V+G   A      L  +DV+++  PD+A
Sbjct: 255 GLRPVDPQPDRRIVELLRSMGARVR-------VEGGVVAVESTGPLEPVDVDLDGSPDLA 307

Query: 551 MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLG--ATVEEGPDYCIITPPER 378
              AV+A +A G + +R +   + KE++R+ A+   L +LG  A V  G    +      
Sbjct: 308 PVAAVLAAYARGVSRLRGLERLKYKESDRLSAIAWNLARLGVEARVRGG---ILEIRGGG 364

Query: 377 LNVTEIDTYDDHRMAMAFSLAAC-AEVPVTIKDPGCTRKTFPDYFEVLQK 231
           +      ++ DHR+AMA ++A   A  PV ++       ++P + E L +
Sbjct: 365 VEGGVARSWGDHRIAMAMAVAGLGARRPVAVEGFSRVPDSYPGFLEDLAR 414



>sp|Q96Y91|AROA_SULTO Probable 3-phosphoshikimate
           1-carboxyvinyltransferase (EC 2.5.1.19)
           (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP
           synthase) (EPSPS).>gb:BA000023_692969 Sulfolobus
           tokodaii str. 7 DNA, complete genome.
          Length = 408

 Score = 70.1 bits (170), Expect = 6e-11
 Identities = 52/191 (27%), Positives = 89/191 (46%), Gaps = 1/191 (0%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXXXXVEGC-GTSSLQGDVKFAEVLEKMGAEVSWTENSVTVK 630
           V GD + AS++            +E      +  GD       + MGAE    +N   VK
Sbjct: 217 VPGDYALASFYASSSIVSGGEIVIEDVYELPNFDGDHSIVNFYKMMGAESYVKDNKWIVK 276

Query: 629 GPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVC 450
              +       L  I+VN++  PD+A ++A +A F+  PT I+ +   + KE+ R++ + 
Sbjct: 277 SSEK-------LNGIEVNVDDYPDLAPSIASLAPFSSSPTIIKGIKRLKTKESNRVVTIS 329

Query: 449 TELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCT 270
             L K G  VE   D  +I P E +    +   +DHR+AM  S+ +  +   TI+   C 
Sbjct: 330 ETLSKFGVKVEYDEDKIVIYPSE-VKAGHVICPNDHRIAMLASVLS-FKSGGTIEKAECV 387

Query: 269 RKTFPDYFEVL 237
            K+ P++++ L
Sbjct: 388 NKSNPNFWKDL 398



>gb:AY375303_614303 Streptococcus suis putative RNA
           methyltransferase gene, partial cds; putative penicillin
           binding protein 5 gene, complete cds; and aro operon,
           complete sequence.
          Length = 426

 Score = 69.7 bits (169), Expect = 8e-11
 Identities = 59/212 (27%), Positives = 100/212 (47%), Gaps = 8/212 (3%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKM 672
           I+GGQ++ +     V GD SSA+++L            +E  G +  +  +   +V++ M
Sbjct: 216 IQGGQEFIAQ-EITVPGDISSAAFWLVAGLIIPGSKIVLENVGINETRTGI--LDVIKAM 272

Query: 671 GAEVSWTE-----NSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTA 507
           G +++ +       S T+             R ID   + + D    + ++A  A G T 
Sbjct: 273 GGKMTLSNIDELAKSATITVETSELKATGDCRRID---SSVIDELPIITLLATQAHGTTI 329

Query: 506 IRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMA 327
           IRD    +VKET+R+  V   L  +GAT+E   D  II  P  L+  EI+T+ DHR+ M 
Sbjct: 330 IRDAEELKVKETDRIQVVADALNSMGATIEPTEDGMIIHGPTALHGAEINTFGDHRIGMM 389

Query: 326 FSLAA--CAEVPVTIKDPGCTRKTFPDYFEVL 237
            ++AA    +  V ++       ++P +FE L
Sbjct: 390 TAIAALLAKDGEVVLERAEAINTSYPAFFEHL 421



>sp|Q92A85|AROA_LISIN 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|AC1687|AC1687
           5-enolpyruvylshikimate-3-phosphate synthase homolog aroE
           [imported] - Listeria innocua (strain
           Clip11262)>gb:AL596170_539381 Listeria innocua Clip11262
           complete genome, segment 8/12.
          Length = 428

 Score = 69.7 bits (169), Expect = 8e-11
 Identities = 58/216 (26%), Positives = 100/216 (46%), Gaps = 7/216 (3%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKM 672
           ++GGQK+       V GD SSA++F+            +   G +  +  +   +V+E+M
Sbjct: 216 VKGGQKFIGQ-EMTVPGDVSSAAFFIVAGLITPGSEIELTHVGLNPTRTGI--FDVVEQM 272

Query: 671 GAEVSWTENS-VTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFA---DGPTAI 504
           G  +   ++S  T K           L+  ++  + +P +   + V+AL A   +G T I
Sbjct: 273 GGSLVVKDSSRSTGKLAGTVVVKSSELKGTEIGGDIIPRLIDEIPVIALLATQAEGTTII 332

Query: 503 RDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAF 324
           +D A  +VKET R+ AV  EL K+GA +    D  II     L+   + +Y DHR+ M  
Sbjct: 333 KDAAELKVKETNRIDAVANELNKMGADITPTEDGLIIRGKTPLHAANVTSYGDHRIGMML 392

Query: 323 SLAA--CAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            +AA    +  V +        ++P +FE ++   K
Sbjct: 393 QIAALLVEDGDVELDRAEAVSVSYPTFFEDIRSLLK 428



>sp|Q8PLY5|AROA_XANAC 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE011797_276589
           Xanthomonas axonopodis pv. citri str. 306, section 175
           of 469 of the complete genome.>gb:AE008923_918364
           Xanthomonas axonopodis pv. citri str. 306, complete
           genome.
          Length = 440

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 67/232 (28%), Positives = 108/232 (46%), Gaps = 7/232 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++   GV ++ S    R  +RGGQ+ ++   A V  D SSA++F+            + 
Sbjct: 204 RMLSAFGVEIDFSPGKAR--LRGGQRLRATDIA-VPADFSSAAFFIVAASVVPGSEVVLR 260

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKH--LRAIDVNMNKMPD 558
             G +  +  +  A  L  MGA++   EN     G P A    ++  LR   +    +PD
Sbjct: 261 AVGLNPRRTGLLAA--LRLMGADIG-EENHAEHGGEPVADLHVRYAPLRGAQIPEALVPD 317

Query: 557 VA---MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
           +      L V A  A G T +   A  RVKE++R+ A+ T LR LG  V+E PD   I  
Sbjct: 318 MIDEFPALFVAAAAASGQTVVTGAAELRVKESDRLAAMATGLRTLGIQVDETPDGATIHG 377

Query: 386 PERLNVTEIDTYDDHRMAMAFSLAACAEV-PVTIKDPGCTRKTFPDYFEVLQ 234
              +    I+++ DHR+AMAF++A    +  V + D      +FP +  + Q
Sbjct: 378 GS-IGSGVIESHGDHRIAMAFAIAGQLSMGQVQVNDVANVATSFPGFDTLAQ 428



>gb:AE008692_241534 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 453

 Score = 68.9 bits (167), Expect = 1e-10
 Identities = 67/232 (28%), Positives = 113/232 (48%), Gaps = 13/232 (5%)
 Frame = -2

Query: 887 VSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVEGCGTSSL 711
           +SVE +D      I G  + K P +  V GD SSA++ +            VE  G +  
Sbjct: 215 LSVEENDGVRIISIHGEAELK-PQHIIVPGDPSSAAFLVVAGLIVPGSDLIVENVGLNPT 273

Query: 710 QGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRK--HLRAIDVNMNKMP---DVAMT 546
           +  +    +L+ MG ++ +  N   V G P A    K  HL+AIDV  + +P   D    
Sbjct: 274 RSGLY--TMLKAMGGQIEYL-NPREVGGEPVADLSVKYSHLKAIDVPPSIVPSMIDEFPI 330

Query: 545 LAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPP------ 384
           L + A  A+G + ++ +A  RVKE++R+  +   L+ LG ++EE  D  II         
Sbjct: 331 LFIAAAMAEGKSTLQGLAELRVKESDRIAVMAEGLKALGVSLEEKEDGLIIEGSAGEGLG 390

Query: 383 ERLNVTEIDTYDDHRMAMAFSLAA-CAEVPVTIKDPGCTRKTFPDYFEVLQK 231
           ++  +  I  + DHR+AM+F++A   +E  VTI D      +FP + ++ ++
Sbjct: 391 QKGKMVSIAAHLDHRIAMSFAVAGLVSEGGVTIDDRRPIMTSFPVFGQLFKE 442



>gb:BX569691_775907 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 441

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 59/210 (28%), Positives = 96/210 (45%), Gaps = 13/210 (6%)
 Frame = -2

Query: 821 PGNAF------VEGDASSASYFLXXXXXX-XXXXXVEGCGTSSLQGDVKFAEVLEKMGAE 663
           PGN        V GD SSA+++L            +E  G +  +  +   EVLE+M A+
Sbjct: 232 PGNTLKGQQVVVPGDISSAAFWLVAGALVPGADLTIENVGLNPTRTGI--LEVLEQMNAQ 289

Query: 662 VSWTENSVTVKGPPRAPSGRKH--LRAIDVNMNKMP---DVAMTLAVVALFADGPTAIRD 498
           +    N   V G P       H  L+   +    MP   D    L+V A F DG + I  
Sbjct: 290 IE-VLNRRDVAGEPVGDLRITHGPLQPFSIGEEIMPRLVDEVPILSVAACFCDGESRISG 348

Query: 497 VASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSL 318
            +  RVKET+R+  +  +L+ +GA +EE  D   I     L    +D+  DHR+AM+ ++
Sbjct: 349 ASELRVKETDRLAVMARQLKAMGAEIEEHEDGMTIHGGRPLKGAALDSETDHRVAMSLAV 408

Query: 317 AA-CAEVPVTIKDPGCTRKTFPDYFEVLQK 231
           A+  A    T++       ++P +++ L +
Sbjct: 409 ASLLASGDSTLQRSDAAAVSYPSFWDDLDR 438



>gb:AE014295_311355 Bifidobacterium longum NCC2705, complete genome.
          Length = 455

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 59/197 (29%), Positives = 89/197 (45%), Gaps = 6/197 (3%)
 Frame = -2

Query: 821 PGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENS 642
           P    VE D S+A+ FL           V     ++ Q        LE+MGA+VS+    
Sbjct: 255 PSKVTVEPDLSNAAPFLGAALIAGGTVRVPHWPETTTQPGGLLPGYLEQMGAKVSFP--- 311

Query: 641 VTVKGPPRAP---SGRKH-LRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKE 474
            T+ G         G  H L   D  +    ++A +LA + +FAD  T +  +   R  E
Sbjct: 312 -TIDGVRYCEVTGDGTVHGLGTFD--LTAAGEIAPSLAAILVFADKSTDMVGIGHLRGHE 368

Query: 473 TERMIAVCTELRKLGATVEEGPDYCII--TPPERLNVTEIDTYDDHRMAMAFSLAACAEV 300
           T R+ A+  E+R++G   EE PD   I   P E L+   ++TY DHRMA   ++      
Sbjct: 369 TNRLEALVNEIRRVGGAAEELPDGLRIEPVPAETLHGAVMETYADHRMATFAAMLGLRIP 428

Query: 299 PVTIKDPGCTRKTFPDY 249
            + + +   TRKT PD+
Sbjct: 429 DIEVINVATTRKTLPDF 445



>sp|Q87BU2|AROA_XYLFT 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:AE012558_284751
           Xylella fastidiosa Temecula1, section 6 of 9 of the
           complete genome.>gb:AE009442_961327 Xylella fastidiosa
           Temecula1, complete genome.
          Length = 454

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 68/227 (29%), Positives = 107/227 (47%), Gaps = 7/227 (3%)
 Frame = -2

Query: 908 KLMERXGVSVEHSDSWDRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXX-XXXXXVE 732
           +++   GV ++ S    R  +RGGQ+  +  N  +  D SSA+++L            + 
Sbjct: 217 RMLTAFGVDIDVSTGCVR--LRGGQRLCAT-NITIPADFSSAAFYLVAASVIPGSDITLR 273

Query: 731 GCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKH--LRAIDVNMNKMPD 558
             G +  +  +    VL  MGA++    N     G P A    ++  L+   V  + +PD
Sbjct: 274 AVGLNPRR--IGLLTVLRLMGADIV-ESNRHEQGGEPVADLRVRYASLQGTRVPEDLVPD 330

Query: 557 VA---MTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITP 387
           +      L V A  A+G T +   A  RVKE++R+ A+ T LR LG  V+E  D   I  
Sbjct: 331 MIDEFPALFVAAAAAEGQTVVSGAAELRVKESDRLAAMVTGLRVLGVQVDETADGATIHG 390

Query: 386 PERLNVTEIDTYDDHRMAMAFSLAACAEV-PVTIKDPGCTRKTFPDY 249
              +    I+++ DHR+AMAFS+A    V  V I+D      +FPDY
Sbjct: 391 GP-IGHGTINSHGDHRIAMAFSIAGQLSVSTVRIEDVANVATSFPDY 436



>sp|Q8FRI2|AROA_COREF 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>gb:BA000035_715564
           Corynebacterium efficiens YS-314 DNA, complete genome.
          Length = 408

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 52/186 (27%), Positives = 82/186 (44%)
 Frame = -2

Query: 806 VEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKG 627
           +E D S+A+ FL           V      + Q       +LE MG  V +  N  T   
Sbjct: 218 IEPDLSNATPFLAAAAVTRGTVTVRNWPRDTTQPGDSIRSILEDMGCTVEFISNGATFDL 277

Query: 626 PPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCT 447
               P+    L+ I ++M+ + ++  T+A +A  A   + +  +A  R  ET R+ A+  
Sbjct: 278 EVTGPA---ELKGIHLDMSDIGELTPTVAALAALATTESRLTGIAHLRGHETNRLEALTA 334

Query: 446 ELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTR 267
           E+ +LG    E  D   ITP   L+     +Y DHRMA A ++       V ++D   T 
Sbjct: 335 EINRLGGNCTELDDGLHITPAP-LHGGVWHSYADHRMATAGAIIGLVIKDVGVEDIQTTS 393

Query: 266 KTFPDY 249
           KTFP +
Sbjct: 394 KTFPGF 399



>sp|O84371|AROA_CHLTR 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|G71522|G71522
           probable phosphoshikimate vinyltransferase - Chlamydia
           trachomatis (serotype D, strain
           UW3/Cx)>gb:AE001310_34297 Chlamydia trachomatis
           D/UW-3/CX section 37 of 87 of the complete
           genome.>gb:AE001273_1098323 Chlamydia trachomatis
           D/UW-3/CX, complete genome.
          Length = 440

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 56/211 (26%), Positives = 100/211 (47%), Gaps = 4/211 (1%)
 Frame = -2

Query: 860 DRFLIRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXX--XXVEGCGTSSLQGDVKFAE 687
           D     GGQ  +S   + V GD SSA++               +    +   QGD     
Sbjct: 217 DSLTFPGGQSLESFSYS-VPGDYSSAAFLASFGLLSSSSKPTILRNLSSQDSQGDKLLFS 275

Query: 686 VLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTA 507
           +L+++GA +   ++ + +   P + SG       +++M+   D    LAV+  FA  P+ 
Sbjct: 276 LLKQLGAHILIGKHHIEMH--PSSFSGG------EIDMDPFIDALPILAVLCCFAKNPSR 327

Query: 506 IRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMA 327
           + +    + KE+ R+ A+  EL+K+G +V    D   I  P RL+   +D+++DHR+AMA
Sbjct: 328 LYNALGAKDKESNRIEAIAHELQKMGGSVHPTRDGLYI-EPSRLHGAVVDSHNDHRIAMA 386

Query: 326 FSLAA--CAEVPVTIKDPGCTRKTFPDYFEV 240
            ++A    +     + +  C  K+FP YF +
Sbjct: 387 LAVAGVHASSGQTLLCNTQCINKSFP-YFVI 416



>gb:CP000025_878725 Campylobacter jejuni RM1221, complete genome.
          Length = 428

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 44/153 (28%), Positives = 78/153 (50%), Gaps = 2/153 (1%)
 Frame = -2

Query: 689 EVLEKMGA--EVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADG 516
           ++L+KMGA  E++ T+N     G  R  S + +   +  N+  + D A  LA+    A G
Sbjct: 268 KILQKMGAKLEMTITQNDFETIGEIRVESSKLNGIEVKDNIAWLIDEAPALAIAFALAKG 327

Query: 515 PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRM 336
            +++ +    RVKE++R+  +   L+  G    E  D   I     L  ++I +Y DHR+
Sbjct: 328 KSSLINAKELRVKESDRIAVMVENLKLCGVEARELDDGFEIEGGCELKSSKIKSYGDHRI 387

Query: 335 AMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL 237
           AM+F++       + I D  C + +FP++ E+L
Sbjct: 388 AMSFAILGLL-CGIEIDDSDCIKTSFPNFIEIL 419



>gb:AJ812018_533140 Pseudomonas putida aroA gene for
           3-phosphoshikimate 1-carboxyvinyltransferase.
          Length = 431

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 57/230 (24%), Positives = 99/230 (43%), Gaps = 3/230 (1%)
 Frame = -2

Query: 911 LKLMERXGVSVEHSDSWDRFLIRGGQKYKSPG--NAFVEGDASSASYFLXXXXXXXXXXX 738
           L +M+R G+    + +++ F  + G  Y         VEGD S  + FL           
Sbjct: 197 LDVMKRFGLKTPENRNYEEFYFKAGNVYDETKMQRYTVEGDWSGGA-FLLVAGAIAGPIT 255

Query: 737 VEGCGTSSLQGDVKFAEVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPD 558
           V G   +S Q D    + L  M A      ++  +K  P        L A + +    PD
Sbjct: 256 VRGLDIASTQADKAIVQAL--MSANAGIAIDAKEIKLHPA------DLNAFEFDATDCPD 307

Query: 557 VAMTLAVVALFADGPTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPER 378
           +   L  +A +  G T I+ V+    KE++R + +  E  K+G  +    D   +   + 
Sbjct: 308 LFPPLVALASYCKGETKIKGVSRLAHKESDRGLTLQDEFGKMGVEIHLEGDLMRVIGGKG 367

Query: 377 LNVTEIDTYDDHRMAMAFSLAACAEV-PVTIKDPGCTRKTFPDYFEVLQK 231
           +   E+ +  DHR+AMA ++AA   V   TI+      K++PD++  L++
Sbjct: 368 VKGAEVSSRHDHRIAMACAVAALKAVGETTIEHAEAVNKSYPDFYSDLKQ 417



>gb:AE009847_256446 Pyrobaculum aerophilum strain IM2 section 102 of
           201 of the complete genome.>gb:AE009441_899072
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 400

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 55/198 (27%), Positives = 84/198 (42%)
 Frame = -2

Query: 848 IRGGQKYKSPGNAFVEGDASSASYFLXXXXXXXXXXXVEGCGTSSLQGDVKFAEVLEKMG 669
           I  G + KSPG   V GD S +++ +           + G   S L  D       + MG
Sbjct: 206 IEVGGRMKSPGKLAVPGDFSLSAFLVVAGVATGGEVEIRG-PLSKL--DEPLVNAFKAMG 262

Query: 668 AEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADGPTAIRDVAS 489
            +++  E  V  KG           R IDVN++  PD+ M  A+ A   +  + IR V +
Sbjct: 263 VDITTGEGWVRAKGG--------FYRGIDVNLSDNPDLVMPTALAAGMVEEESTIRGVET 314

Query: 488 WRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRMAMAFSLAAC 309
            R KE+ R+  V   L +LG  V    D   I  P +       ++ DHR+ +  +LAA 
Sbjct: 315 LRYKESNRIATVIDVLERLGVQVRHEKDAIYIKGPPKRRDVAFSSHGDHRIGL-MALAAS 373

Query: 308 AEVPVTIKDPGCTRKTFP 255
             V   + D     K++P
Sbjct: 374 KIVGGCVDDISPVAKSWP 391



>gb:ECU31523_133949 Escherichia coli
           5-enolpyruvylshikimate-3-phosphate-synthase (AroA) gene,
           partial cds.
          Length = 48

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 30/45 (66%), Positives = 35/45 (77%)
 Frame = -2

Query: 356 TYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
           TY+DHRMAM FSL A ++ PVTI DP CT KTFPDYFE L + S+
Sbjct: 2   TYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQ 46



>pir|JC5338|JC5338 3-phosphoshikimate 1-carboxyvinyltransferase (EC
           2.5.1.19) - Campylobacter jejuni>gb:CJDNAPALG_848201
           C.jejuni DNA for pheS, aroA, lytB and S1 genes.
          Length = 428

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 44/153 (28%), Positives = 78/153 (50%), Gaps = 2/153 (1%)
 Frame = -2

Query: 689 EVLEKMGA--EVSWTENSVTVKGPPRAPSGRKHLRAIDVNMNKMPDVAMTLAVVALFADG 516
           ++L+KMGA  E++ T+N     G  R  S + +   +  N+  + D A  LA+    A G
Sbjct: 268 KILQKMGAKLEMTITQNDFETIGEIRVESSKLNGIEVKDNIAWLIDEAPALAIAFALAKG 327

Query: 515 PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPERLNVTEIDTYDDHRM 336
            +++ +    RVKE++R+  +   L+  G    E  D   I     L  ++I +Y DHR+
Sbjct: 328 KSSLINAKELRVKESDRIAVMVENLKLCGVEARELDDGFEIEGGCELKSSKIKSYGDHRI 387

Query: 335 AMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVL 237
           AM+F++       + I D  C + +FP++ E+L
Sbjct: 388 AMSFAILGLL-CGIEIDDSDCIKTSFPNFIEIL 419



>sp|P56197|AROA_HELPY 3-phosphoshikimate 1-carboxyvinyltransferase
           (EC 2.5.1.19) (5- enolpyruvylshikimate-3-phosphate
           synthase) (EPSP synthase) (EPSPS).>pir|A64570|A64570
           3-phosphoshikimate 1-carboxyvinyltransferase -
           Helicobacter pylori (strain 26695)>gb:AE000556_24578
           Helicobacter pylori 26695 section 34 of 134 of the
           complete genome.>gb:AE000511_880017 Helicobacter pylori
           26695 complete genome.
          Length = 429

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 47/168 (27%), Positives = 84/168 (50%), Gaps = 12/168 (7%)
 Frame = -2

Query: 689 EVLEKMGAEVSWTENSVTVKGPPRAPSGRKHLRAIDVNMN--KMPDVAMTLAVVALFADG 516
           EVL+KMGA + +   S  ++           L+AI+++ N   + D    L++  LFA G
Sbjct: 257 EVLKKMGASIEYAIQSKDLEMIGDIYVEHAPLKAINIDQNIASLIDEIPALSIAMLFAKG 316

Query: 515 PTAIRDVASWRVKETERMIAVCTELRKLGATVEEGPDYCIITPPE----------RLNVT 366
            + +++    R KE++R+ AV +  + LG   EE  D   +   E          R+   
Sbjct: 317 KSMVKNAKDLRAKESDRIKAVVSNFKALGIECEEFEDGFYVEGLEDISPLKQRFSRIKPP 376

Query: 365 EIDTYDDHRMAMAFSLAACAEVPVTIKDPGCTRKTFPDYFEVLQKFSK 222
            I +++DHR+AM+F++   A +P+ I +  C   +FP +  +L +F K
Sbjct: 377 LIKSFNDHRIAMSFAVLTLA-LPLEIDNLECANISFPQFKHLLNQFKK 423


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 969,171,742
Number of Sequences: 1806583
Number of extensions: 20146117
Number of successful extensions: 73445
Number of sequences better than 10.0: 336
Number of HSP's better than 10.0 without gapping: 70848
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 73005
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 66211811355
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)