BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11643
         (896 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY050535_1562263 Arabidopsis thaliana leucine-rich repeat rec...   172   4e-62   
gb:AY062680_1565336 Arabidopsis thaliana Unknown protein (At1g09...   171   9e-62   
pir|T52400|T52400 receptor-like protein kinase [imported] - Arab...   131   9e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for puta...   121   3e-40   
gb:AC119796_1739716 Oryza sativa (japonica cultivar-group) chrom...   122   2e-39   
pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis ...   110   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb:AY603422_1617457 Pyrus pyrifolia isolate Kousui2 leucine-rich...   107   1e-33   
gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich...   107   1e-33   
gb:AY603423_1617458 Pyrus pyrifolia isolate Kinchaku leucine-ric...   107   1e-33   
pir|C96745|C96745 hypothetical protein T9N14.3 [imported] - Arab...   103   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AP003210_1825238 Oryza sativa (japonica cultivar-group) genom...   106   7e-33   
gb:AX008789_1456287 Sequence 1 from Patent WO9964600.>gb:AF05312...   107   1e-32   
pir|F86410|F86410 protein F3M18.12 [imported] - Arabidopsis thal...   103   6e-32   Arabidopsis thaliana [mouse-ear cress]
gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genom...    94   1e-31   
gb:AP003227_1825640 Oryza sativa (japonica cultivar-group) genom...   100   1e-31   
gb:AC099732_1737183 Oryza sativa (japonica cultivar-group) chrom...    91   6e-31   
gb:AP005593_1854663 Oryza sativa (japonica cultivar-group) genom...   102   1e-30   
gb:AF244888_1780445 Glycine max receptor-like protein kinase 1 (...    93   2e-30   
pir|T05897|T05897 protein kinase homolog F6H11.160 - Arabidopsis...    94   4e-30   Arabidopsis thaliana [mouse-ear cress]
pir|T46033|T46033 receptor protein kinase-like protein - Arabido...    92   8e-30   Arabidopsis thaliana [mouse-ear cress]
pir|T05898|T05898 hypothetical protein F6H11.170 - Arabidopsis t...    91   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...    91   3e-29   
pir|B86234|B86234 hypothetical protein [imported] - Arabidopsis ...   130   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AF244890_1780447 Glycine max receptor-like protein kinase 3 (...    91   9e-29   
gb:AF244889_1780446 Glycine max receptor-like protein kinase 2 (...    91   9e-29   
gb:AP003768_1833267 Oryza sativa (japonica cultivar-group) genom...    83   1e-27   
gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene ...    85   2e-27   
sp|Q9SYQ8|CLV1_ARATH|CLV1_ARATH Receptor protein kinase CLAVATA1 precursor ...    87   3e-27   Arabidopsis thaliana [mouse-ear cress]
pir|T50851|T50851 receptor protein kinase homolog [imported] - s...    85   3e-27   Glycine max [soybeans]
pir|E96787|E96787 protein T4O12.5 [imported] - Arabidopsis thali...    87   3e-27   Arabidopsis thaliana [mouse-ear cress]
gb:AY283519_1594738 Brassica napus CLV1-like receptor kinase (CL...    87   5e-27   
gb:AC118284_1739500 Oryza sativa (japonica cultivar-group) chrom...    84   6e-27   
pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis t...    85   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threoni...    84   6e-27   
gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like ...    86   8e-27   
pir|T50850|T50850 receptor protein kinase homolog [imported] - s...    86   8e-27   Glycine max [soybeans]
gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome...    84   1e-26   
gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome...    87   1e-26   
gb:AF049870_1764105 Arabidopsis thaliana beta tubulin 1, thaumat...    87   2e-26   
gb:AP003622_1831610 Oryza sativa (japonica cultivar-group) genom...    90   8e-26   
gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 ...    86   1e-25   
pir|B84742|B84742 probable receptor-like protein kinase [importe...    82   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AP003962_1835750 Oryza sativa (japonica cultivar-group) genom...    86   2e-25   
gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genom...    79   2e-25   
gb:AP003282_1827213 Oryza sativa (japonica cultivar-group) genom...    90   3e-25   
gb:AP005394_1851029 Oryza sativa (japonica cultivar-group) genom...    75   3e-25   
gb:AP005394_1851023 Oryza sativa (japonica cultivar-group) genom...    77   3e-25   
pir|T05322|T05322 hypothetical protein F18F4.240 - Arabidopsis t...    82   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR receptor-...    80   5e-25   
gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-...    82   5e-25   
gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein ...    79   1e-24   
gb:AP003758_1833017 Oryza sativa (japonica cultivar-group) genom...    79   1e-24   
gb:AP004564_1841660 Oryza sativa (japonica cultivar-group) genom...    74   2e-24   
pir|E86312|E86312 F11A6.9 protein - Arabidopsis thaliana>gb:AE00...    77   2e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AK118356_1816339 Arabidopsis thaliana At5g62710 mRNA for puta...    74   3e-24   
gb:AB009053_1510681 Arabidopsis thaliana genomic DNA, chromosome...    74   3e-24   
gb:AP005826_1858573 Oryza sativa (japonica cultivar-group) genom...    74   3e-24   
gb:AP005826_1858575 Oryza sativa (japonica cultivar-group) genom...    74   3e-24   
pir|H84770|H84770 probable receptor-like protein kinase [importe...    74   3e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AB182388_1529231 Oryza sativa (japonica cultivar-group) FON1 ...    76   4e-24   
gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09 (R2...    71   6e-24   
pir|T03784|T03784 probable receptor protein kinase - rice>gb:OSL...    76   6e-24   Oryza sativa [red rice]
gb:OSJN00189_1696455 Oryza sativa genomic DNA, chromosome 4, BAC...    80   7e-24   
gb:AY056243_1563564 Arabidopsis thaliana unknown protein (At2g13...    68   8e-24   
gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.              68   8e-24   
gb:AX120071_1461715 Sequence 54 from Patent WO0129240.                 68   8e-24   
pir|G84510|G84510 probable receptor-like protein kinase [importe...    68   8e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1021015 Oryza sativa (japonica cultivar-group) chrom...    77   1e-23   
gb:OSJN00095_1694822 Oryza sativa genomic DNA, chromosome 4, BAC...    74   1e-23   
gb:AP002865_1823339 Oryza sativa (japonica cultivar-group) genom...    74   1e-23   
gb:AC007789_1536200 Oryza sativa BAC OSJNBa0049B20 genomic seque...    74   1e-23   
gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis r...    71   2e-23   
sp|Q94F62|BAK1_ARATH|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re...    71   2e-23   Arabidopsis thaliana [mouse-ear cress]
pir|B86440|B86440 probable protein kinase [imported] - Arabidops...    72   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AX120065_1461712 Sequence 48 from Patent WO0129240.                 71   2e-23   
pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis...    71   2e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1021016 Oryza sativa (japonica cultivar-group) chrom...    76   2e-23   
gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genom...   111   2e-23   
pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis tha...    76   2e-23   Arabidopsis thaliana [mouse-ear cress]
pir|T45878|T45878 receptor lectin kinase-like protein - Arabidop...    70   4e-23   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LYN8|EXS_ARATH|EXS_ARATH Leucine-rich repeat receptor protein kinase ...    72   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC...    70   5e-23   
gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somat...    70   5e-23   
gb:CQ768565_1451800 Sequence 60 from Patent WO2004007712.              68   5e-23   
gb:AX120069_1461714 Sequence 52 from Patent WO0129240.                 68   5e-23   
pir|H84510|H84510 probable receptor-like protein kinase [importe...    68   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AY094412_1575714 Arabidopsis thaliana At2g13800/F13J11.15 mRN...    68   5e-23   
gb:AC135205_1742004 Oryza sativa (japonica cultivar-group) chrom...    78   5e-23   
gb:AP004140_1838185 Oryza sativa (japonica cultivar-group) genom...    77   5e-23   
gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporoge...    72   6e-23   
gb:AP004564_1841662 Oryza sativa (japonica cultivar-group) genom...    75   6e-23   
gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenes...    69   6e-23   
gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.                  69   6e-23   
gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRN...    69   6e-23   
gb:A67827_1450282 Sequence 32 from Patent WO9743427.>gb:CQ768543...    69   6e-23   
pir|H96740|H96740 hypothetical protein F14O23.21 [imported] - Ar...    69   6e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP005807_1858200 Oryza sativa (japonica cultivar-group) genom...    78   8e-23   
gb:AC104280_1737456 Oryza sativa (japonica cultivar-group) chrom...    71   8e-23   
gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 ...    67   1e-22   
gb:AC084817_1733839 Oryza sativa (japonica cultivar-group) chrom...    82   1e-22   
pir|T10659|T10659 probable serine/threonine-specific protein kin...   108   1e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic embryoge...    68   2e-22   
pir|D86466|D86466 69.4K hypothetical protein F23M19.11 - Arabido...    69   2e-22   Arabidopsis thaliana [mouse-ear cress]
pir|T14354|T14354 probable somatic embryogenesis receptor-like k...    67   2e-22   Daucus carota [carrots]
gb:AC104473_1737662 Oryza sativa (japonica cultivar-group) chrom...    70   2e-22   
gb:AX038197_1457678 Sequence 12 from Patent WO0060086.>gb:ATAC01...    72   2e-22   
gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genom...    76   3e-22   
gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA...    79   3e-22   
pir|T01502|T01502 probable serine/threonine-specific protein kin...    79   3e-22   Arabidopsis thaliana [mouse-ear cress]
gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.              70   3e-22   
gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome...    70   3e-22   
gb:AX138094_1462211 Sequence 40 from Patent EP1094113.                 70   3e-22   
gb:AX120059_1461709 Sequence 42 from Patent WO0129240.                 70   3e-22   
gb:AY064978_1566153 Arabidopsis thaliana At1g21590/F24J8_9 mRNA,...    70   4e-22   
pir|G86348|G86348 hypothetical protein F24J8.18 - Arabidopsis th...    70   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis r...    68   4e-22   
gb:AB017061_1513313 Arabidopsis thaliana genomic DNA, chromosome...    80   5e-22   
gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.              64   5e-22   
gb:ZMA277702_1731487 Zea mays mRNA for SERK1 protein.>gb:ZMA4008...    66   5e-22   
gb:AY463361_1607685 Oryza sativa (indica cultivar-group) benzoth...    66   5e-22   
gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSER...    66   5e-22   
pir|G84630|G84630 probable LRR receptor protein kinase [imported...    64   5e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AX120057_1461708 Sequence 40 from Patent WO0129240.                 64   5e-22   
gb:AC120509_1739833 Oryza sativa chromosome 3 BAC OSJNBb0081K01 ...    74   7e-22   
gb:AC136220_1743067 Oryza sativa (japonica cultivar-group) chrom...    73   7e-22   
gb:AP004791_1845157 Oryza sativa (japonica cultivar-group) genom...    66   7e-22   
gb:AP003282_1827220 Oryza sativa (japonica cultivar-group) genom...    64   7e-22   
pir|B86479|B86479 hypothetical protein F14D7.1 - Arabidopsis tha...    70   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP005836_1858768 Oryza sativa (japonica cultivar-group) genom...    67   9e-22   
gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genom...    65   9e-22   
gb:AC132492_1741212 Oryza sativa (japonica cultivar-group) chrom...    73   9e-22   
pir|T01711|T01711 probable serine/threonine-specific protein kin...    70   9e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AY075617_1567762 Arabidopsis thaliana AT3g25560/MWL2_18 mRNA,...    64   1e-21   
gb:AB025639_1516701 Arabidopsis thaliana genomic DNA, chromosome...    64   1e-21   
gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich r...    66   1e-21   
gb:CQ768569_1451802 Sequence 64 from Patent WO2004007712.              64   1e-21   
gb:AX120073_1461716 Sequence 56 from Patent WO0129240.                 64   1e-21   
pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis tha...    70   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,...    70   1e-21   
gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding ...    70   1e-21   
gb:AY085009_1570091 Arabidopsis thaliana clone 124301 mRNA, comp...    69   1e-21   
gb:ATAC009326_1542913 Arabidopsis thaliana chromosome III P1 MZB...    69   1e-21   
gb:AX038195_1457677 Sequence 10 from Patent WO0060086.                 69   1e-21   
gb:AB125885_1528227 Ipomoea batatas SRF6 mRNA for putative serin...    66   1e-21   
gb:OSJN00165_1696020 Oryza sativa genomic DNA, chromosome 4, BAC...    72   1e-21   
gb:AP005457_1852178 Oryza sativa (japonica cultivar-group) genom...    69   1e-21   
gb:AY162176_1585779 Medicago truncatula somatic embryogenesis re...    65   1e-21   
pir|E84846|E84846 probable receptor-like protein kinase [importe...    88   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AP004121_1837906 Oryza sativa (japonica cultivar-group) genom...    67   2e-21   
gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genom...    71   2e-21   
gb:AF285172_1783120 Phaseolus vulgaris leaf senescence-associate...    64   2e-21   
gb:AC134931_1741947 Oryza sativa (japonica cultivar-group) chrom...    67   2e-21   
gb:AC079357_1732541 Oryza sativa (japonica cultivar-group) chrom...    67   2e-21   
gb:AP005533_1853634 Oryza sativa (japonica cultivar-group) genom...    67   2e-21   
gb:AE016959_1023140 Oryza sativa (japonica cultivar-group) chrom...    67   2e-21   
gb:AP004739_1844116 Oryza sativa (japonica cultivar-group) genom...    65   3e-21   
gb:OSJN00093_1694778 Oryza sativa genomic DNA, chromosome 4, BAC...    70   3e-21   
gb:AP003237_1825950 Oryza sativa (japonica cultivar-group) genom...    67   3e-21   
gb:AC134344_1741747 Oryza sativa (japonica cultivar-group) chrom...    70   3e-21   
gb:AP004006_1836240 Oryza sativa (japonica cultivar-group) genom...    74   4e-21   
gb:AE005173_894394 Arabidopsis thaliana chromosome 1, bottom arm...    74   4e-21   
gb:AY714491_1624022 Oryza sativa (indica cultivar-group) clone O...    69   4e-21   
gb:OSJN00093_1694776 Oryza sativa genomic DNA, chromosome 4, BAC...    68   4e-21   
gb:AY332474_1600056 Oryza sativa (japonica cultivar-group) trans...    69   4e-21   
gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genom...    69   4e-21   
pir|T51383|T51383 receptor protein kinase-like protein - Arabido...    65   4e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AY088040_1573064 Arabidopsis thaliana clone 40594 mRNA, compl...    65   4e-21   
gb:AC008262_1536615 Genomic sequence for Arabidopsis thaliana BA...    71   5e-21   
gb:AC087553_1734111 Oryza sativa (japonica cultivar-group) chrom...    66   5e-21   
gb:AB013395_1512172 Arabidopsis thaliana genomic DNA, chromosome...    69   5e-21   
gb:CQ768547_1451791 Sequence 42 from Patent WO2004007712.              69   5e-21   
gb:AX138087_1462209 Sequence 33 from Patent EP1094113.                 69   5e-21   
gb:AX120053_1461706 Sequence 36 from Patent WO0129240.                 69   5e-21   
pir|G96716|G96716 hypothetical protein F23O10.15 [imported] - Ar...    71   5e-21   Arabidopsis thaliana [mouse-ear cress]
pir|T49152|T49152 serine/threonine-specific protein kinase-like ...    67   5e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AY059844_1564688 Arabidopsis thaliana receptor-like protein k...    69   6e-21   
gb:OSJN00183_1696341 Oryza sativa genomic DNA, chromosome 4, BAC...    68   7e-21   
gb:AP003770_1833317 Oryza sativa (japonica cultivar-group) genom...    66   9e-21   
gb:AP003858_1834408 Oryza sativa (japonica cultivar-group) genom...    69   9e-21   
gb:AY042808_1560873 Arabidopsis thaliana Unknown protein (F14D7....    67   9e-21   
sp|Q9ZVR7|PSKR_ARATH|PSKR_ARATH Putative phytosulfokine receptor precursor ...    66   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC137612_1743549 Oryza sativa (japonica cultivar-group) chrom...    68   1e-20   
gb:AC005936_1533211 Arabidopsis thaliana chromosome 2 clone F5O4...    66   1e-20   
pir|H96533|H96533 hypothetical protein F14J22.6 [imported] - Ara...    65   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:CQ768545_1451790 Sequence 40 from Patent WO2004007712.>gb:AY0...    62   1e-20   
gb:AX138085_1462208 Sequence 31 from Patent EP1094113.                 62   1e-20   
pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5....    62   1e-20   Arabidopsis thaliana [mouse-ear cress]
pir|T47793|T47793 receptor-like protein kinase - Arabidopsis tha...    67   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC009755_1543036 Arabidopsis thaliana chromosome III BAC F1...    72   2e-20   
pir|T18536|T18536 receptor-like protein kinase - Ipomoea nil (Ja...    65   2e-20   Ipomoea nil [qian niu]
sp|P93194|RPK1_PHANI|RPK1_PHANI Receptor-like protein kinase precursor (EC ...    65   2e-20   Ipomoea nil [qian niu]
gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome...    67   2e-20   
pir|B84659|B84659 probable receptor-like protein kinase, ERECTA ...    68   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP004123_1837931 Oryza sativa (japonica cultivar-group) genom...    66   2e-20   
gb:AP003863_1834480 Oryza sativa (japonica cultivar-group) genom...    63   2e-20   
gb:INU77888_1683176 Ipomoea nil receptor-like protein kinase INR...    65   2e-20   
gb:INU77888_1683178 Ipomoea nil receptor-like protein kinase INR...    65   2e-20   
pir|G96813|G96813 hypothetical protein T30F21.14 [imported] - Ar...    66   2e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP007224_1863294 Oryza sativa (japonica cultivar-group) genom...    66   2e-20   
gb:AY756174_1627014 Oryza rufipogon putative leucine-rich repeat...    66   2e-20   
gb:OSJN00019_1693374 Oryza sativa genomic DNA, chromosome 4, BAC...    66   2e-20   
gb:AP004301_1839828 Oryza sativa (japonica cultivar-group) genom...    64   2e-20   
gb:AP006172_1861335 Oryza sativa (japonica cultivar-group) genom...    64   2e-20   
gb:AC133334_1741356 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    64   2e-20   
gb:AC133334_1741357 Oryza sativa chromosome 3 BAC OSJNBa0004L11 ...    64   2e-20   
gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genom...    62   2e-20   
gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complet...    69   3e-20   
gb:AP005896_1859826 Oryza sativa (japonica cultivar-group) genom...    67   3e-20   
gb:AY756174_1627011 Oryza rufipogon putative leucine-rich repeat...    67   3e-20   
gb:AP005419_1851480 Oryza sativa (japonica cultivar-group) genom...    68   3e-20   
pir|H86301|H86301 hypothetical protein F19K19.4 [imported] - Ara...    64   3e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AY059921_1564765 Arabidopsis thaliana Unknown protein (F19K19...    64   3e-20   
gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genom...    64   3e-20   
gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat...    64   3e-20   
gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone O...    64   3e-20   
gb:OSJN00152_1695767 Oryza sativa genomic DNA, chromosome 4, BAC...    66   3e-20   
gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genom...    70   3e-20   
pir|T48335|T48335 receptor like protein kinase - Arabidopsis tha...    64   3e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genom...    70   3e-20   
gb:CQ768555_1451795 Sequence 50 from Patent WO2004007712.>gb:AX1...    66   3e-20   
pir|T50817|T50817 protein serine/threonine kinase-like protein -...    66   3e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP004768_1844703 Oryza sativa (japonica cultivar-group) genom...    68   3e-20   
gb:AK117450_1815484 Arabidopsis thaliana At3g58690 mRNA for puta...    67   3e-20   
sp|P47735|RLK5_ARATH|RLK5_ARATH Receptor-like protein kinase 5 precursor (E...   100   4e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP003453_1829707 Oryza sativa (japonica cultivar-group) genom...    70   4e-20   
gb:AB007644_1510128 Arabidopsis thaliana genomic DNA, chromosome...    64   4e-20   
gb:AC008030_1536482 Arabidopsis thaliana chromosome I BAC F1N18 ...    75   4e-20   
pir|F86420|F86420 probable receptor-like serine/threonine kinase...    75   4e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP005650_1855480 Oryza sativa (japonica cultivar-group) genom...    67   4e-20   
gb:AY093029_1574983 Arabidopsis thaliana protein serine/threonin...    66   4e-20   
gb:AB041503_1519669 Populus nigra PnPK1 mRNA for protein kinase ...    67   4e-20   
gb:AY113170_1578244 Arabidopsis thaliana At1g29720/T3M22_6 mRNA,...    75   5e-20   
gb:AP003278_1827097 Oryza sativa (japonica cultivar-group) genom...    66   5e-20   
gb:AF503433_1806732 Sorghum bicolor BAC 170F8, complete sequence.      70   6e-20   
gb:AP005100_1847816 Oryza sativa (japonica cultivar-group) genom...    64   6e-20   
gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.              60   6e-20   
gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinas...    60   6e-20   
gb:AP004123_1837935 Oryza sativa (japonica cultivar-group) genom...    66   6e-20   
gb:AX120067_1461713 Sequence 50 from Patent WO0129240.                 60   6e-20   
pir|A85357|A85357 receptor-like kinase homolog [imported] - Arab...    60   6e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP003279_1827110 Oryza sativa (japonica cultivar-group) genom...    62   6e-20   
gb:CRU303349_1673665 Capsella rubella ORF1, ORF2, ORF3, ORF4, OR...    67   7e-20   
gb:AY730046_1625387 Oryza sativa (indica cultivar-group) putativ...    64   7e-20   
gb:AP006168_1861232 Oryza sativa (japonica cultivar-group) genom...    62   7e-20   
gb:AP005442_1851834 Oryza sativa (japonica cultivar-group) genom...    64   7e-20   
pir|E96602|E96602 hypothetical protein T6H22.9 [imported] - Arab...    67   7e-20   Arabidopsis thaliana [mouse-ear cress]
pir|C84922|C84922 probable protein kinase [imported] - Arabidops...    65   8e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AP004752_1844391 Oryza sativa (japonica cultivar-group) genom...    67   8e-20   
gb:AP004752_1844393 Oryza sativa (japonica cultivar-group) genom...    67   8e-20   
pir|A85041|A85041 probable receptor kinase [imported] - Arabidop...    61   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP002882_1823607 Oryza sativa (japonica cultivar-group) genom...    64   1e-19   
gb:AP003044_1824341 Oryza sativa (japonica cultivar-group) genom...    62   1e-19   
gb:AY064064_1566002 Arabidopsis thaliana unknown protein (At4g00...    66   1e-19   
pir|T01538|T01538 receptor-like protein kinase 5 homolog A_IG005...    66   1e-19   Arabidopsis thaliana [mouse-ear cress]
pir|G96746|G96746 hypothetical protein T9N14.20 [imported] - Ara...    65   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP005457_1852183 Oryza sativa (japonica cultivar-group) genom...    62   1e-19   
gb:AY756174_1627017 Oryza rufipogon putative leucine-rich repeat...    64   1e-19   
gb:AY714497_1624028 Oryza sativa (japonica cultivar-group) clone...    64   1e-19   
gb:AP007224_1863291 Oryza sativa (japonica cultivar-group) genom...    64   1e-19   
gb:AE005172_889761 Arabidopsis thaliana chromosome 1, top arm co...    65   1e-19   
pir|T04455|T04455 hypothetical protein F4D11.90 - Arabidopsis th...    63   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP000816_1820640 Oryza sativa (japonica cultivar-group) genom...    70   1e-19   
pir|T04606|T04606 protein kinase homolog F20O9.40 - Arabidopsis ...    60   1e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AY099582_1576608 Arabidopsis thaliana serine/threonine kinase...    64   1e-19   
gb:AC119292_1739707 Oryza sativa (japonica cultivar-group) chrom...    62   1e-19   
gb:AP000382_1819890 Arabidopsis thaliana genomic DNA, chromosome...    63   1e-19   
gb:AK117952_1815959 Arabidopsis thaliana At5g01020 mRNA for puta...    67   1e-19   
gb:ATF7J8_1550981 Arabidopsis thaliana DNA chromosome 5, BAC clo...    67   1e-19   
gb:AB041504_1519670 Populus nigra PnPK2 mRNA for protein kinase ...    65   1e-19   
gb:AP005443_1851850 Oryza sativa (japonica cultivar-group) genom...    69   1e-19   
gb:AY091071_1574298 Arabidopsis thaliana putative protein kinase...    69   2e-19   
gb:AB188249_1529360 Oryza sativa (japonica cultivar-group) OsSER...    63   2e-19   
gb:AP004301_1839826 Oryza sativa (japonica cultivar-group) genom...    60   2e-19   
gb:AP006172_1861333 Oryza sativa (japonica cultivar-group) genom...    60   2e-19   
gb:AY060554_1564862 Arabidopsis thaliana AT5g63710/MBK5_19 mRNA,...    63   2e-19   
gb:AX138089_1462210 Sequence 35 from Patent EP1094113.                 63   2e-19   
gb:CQ768549_1451792 Sequence 44 from Patent WO2004007712.>gb:AX1...    63   2e-19   
pir|A86211|A86211 hypothetical protein [imported] - Arabidopsis ...    69   2e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AP002953_1823972 Oryza sativa (japonica cultivar-group) genom...    63   2e-19   
sp|Q9FE20|PBS1_ARATH|PBS1_ARATH Serine/threonine-protein kinase PBS1 (EC 2....    61   2e-19   
pir|E84587|E84587 probable protein kinase [imported] - Arabidops...    69   2e-19   
gb:AB188248_1529359 Oryza sativa (japonica cultivar-group) OsSER...    63   2e-19   
gb:AY536858_1612412 Arabidopsis thaliana putative protein kinase...    63   2e-19   
gb:OSJN00093_1694777 Oryza sativa genomic DNA, chromosome 4, BAC...    65   2e-19   
gb:AY244746_1592517 Arabidopsis thaliana ERECTA-like kinase 2 (E...    66   2e-19   
gb:AC109596_1738727 Oryza sativa (japonica cultivar-group) chrom...    62   2e-19   
pir|T48489|T48489 receptor-like protein kinase - Arabidopsis tha...    66   2e-19   
gb:AB006705_1509998 Arabidopsis thaliana genomic DNA, chromosome...    61   2e-19   
gb:AB006705_1509997 Arabidopsis thaliana genomic DNA, chromosome...    60   2e-19   
gb:AP004014_1836375 Oryza sativa (japonica cultivar-group) genom...    60   2e-19   
pir|T04954|T04954 hypothetical protein F7J7.170 - Arabidopsis th...    60   2e-19   
pir|T48301|T48301 protein kinase-like - Arabidopsis thaliana>gb:...    65   2e-19   
gb:AP003728_1832549 Oryza sativa (japonica cultivar-group) genom...    62   2e-19   
gb:OSJN00017_1693336 Oryza sativa genomic DNA, chromosome 4, BAC...    60   2e-19   
gb:AC130603_1740791 Oryza sativa (japonica cultivar-group) chrom...    59   2e-19   
gb:AP005633_1855149 Oryza sativa (japonica cultivar-group) genom...    67   3e-19   
gb:AY751547_1626695 Sesbania rostrata nodulation receptor kinase...    69   3e-19   
gb:OSJN00073_1694337 Oryza sativa genomic DNA, chromosome 4, BAC...    68   3e-19   
gb:AP003758_1833016 Oryza sativa (japonica cultivar-group) genom...    61   3e-19   
gb:AY142496_1582925 Arabidopsis thaliana putative protein kinase...    63   3e-19   
gb:AB025624_1516458 Arabidopsis thaliana genomic DNA, chromosome...    60   3e-19   
gb:AF224707_1778586 Arabidopsis thaliana receptor-like protein k...    63   3e-19   
pir|T04830|T04830 probable serine/threonine-specific protein kin...    63   3e-19   
pir|T10569|T10569 probable serine/threonine-specific protein kin...    64   3e-19   
gb:AY632360_1618711 Gossypium hirsutum BAC 106I22, complete sequ...    60   3e-19   
gb:AY632359_1618697 Gossypium hirsutum BAC 155C17, complete sequ...    60   3e-19   
pir|B96590|B96590 hypothetical protein T22H22.21 [imported] - Ar...    73   3e-19   
gb:AF332960_1787292 Lycopersicon esculentum auxin-regulated dual...    63   3e-19   
gb:AC069144_1540630 Arabidopsis thaliana chromosome 1 BAC F14C21...    73   3e-19   
gb:BT003881_1637008 Arabidopsis thaliana clone RAFL15-23-A08 (R2...    59   3e-19   
gb:AP000410_1820018 Arabidopsis thaliana genomic DNA, chromosome...    59   3e-19   
gb:AC104473_1737654 Oryza sativa (japonica cultivar-group) chrom...    63   4e-19   
gb:AB178084_1528917 Daucus carota LRR-S/T-RLK mRNA for putative ...    66   4e-19   
pir|F96598|F96598 protein F20N2.4 [imported] - Arabidopsis thali...    64   4e-19   
pir|T01269|T01269 serine/threonine-specific protein kinase (EC 2...    65   4e-19   
gb:AC136220_1743061 Oryza sativa (japonica cultivar-group) chrom...    64   4e-19   
gb:AP005903_1859842 Oryza sativa (japonica cultivar-group) genom...    60   4e-19   
gb:AP001800_1821421 Oryza sativa (japonica cultivar-group) genom...    61   4e-19   
gb:AE016959_1020855 Oryza sativa (japonica cultivar-group) chrom...    61   4e-19   
gb:AY090250_1574003 Arabidopsis thaliana AT4g23250/F21P8_140 mRN...    62   4e-19   
gb:AP005299_1850138 Oryza sativa (japonica cultivar-group) genom...    59   4e-19   
gb:AE016959_1023603 Oryza sativa (japonica cultivar-group) chrom...    60   4e-19   
gb:AF474072_1803107 Hordeum vulgare sp. vulgare cultivar Morex B...    64   4e-19   
sp|Q06548|APKA_ARATH|APKA_ARATH Protein kinase APK1A (EC 2.7.1.-).>pir|S286...    68   4e-19   
pir|T47684|T47684 serine/threonine-specific protein kinase-like ...    71   4e-19   
gb:BT003347_1636770 Arabidopsis thaliana serine/threonine-specif...    71   4e-19   
gb:BT000431_1634709 Arabidopsis thaliana serine/threonine-specif...    71   4e-19   
gb:OSJN00093_1694775 Oryza sativa genomic DNA, chromosome 4, BAC...    63   5e-19   
sp|Q8LPB4|PSKR_DAUCA|PSKR_DAUCA Phytosulfokine receptor precursor (EC 2.7.1...    65   5e-19   
gb:AB011476_1511391 Arabidopsis thaliana genomic DNA, chromosome...    70   5e-19   
gb:AY244745_1592516 Arabidopsis thaliana ERECTA-like kinase 1 (E...    64   5e-19   
gb:AP006526_1862192 Oryza sativa (japonica cultivar-group) genom...    66   5e-19   
gb:AP005534_1853651 Oryza sativa (japonica cultivar-group) genom...    63   5e-19   
gb:AP004014_1836383 Oryza sativa (japonica cultivar-group) genom...    60   5e-19   
gb:AY484588_1608321 Musa acuminata clone MuG9, genomic sequence.       63   5e-19   
gb:AY065457_1566562 Arabidopsis thaliana putative protein kinase...    67   5e-19   
pir|F84682|F84682 probable protein kinase [imported] - Arabidops...    67   5e-19   
gb:AK118052_1816052 Arabidopsis thaliana At5g62230 mRNA for unkn...    64   5e-19   
gb:AP006156_1861014 Oryza sativa (japonica cultivar-group) genom...    69   6e-19   
gb:AY128280_1580582 Arabidopsis thaliana AT3g13380/MRP15_1 mRNA,...    66   6e-19   
gb:AP005896_1859828 Oryza sativa (japonica cultivar-group) genom...    61   6e-19   
gb:AC135916_1742802 Genomic sequence for Oryza sativa, Nipponbar...    63   6e-19   
pir|T02728|T02728 serine/threonine-specific protein kinase (EC 2...    62   6e-19   
gb:OSJN00259_1697523 Oryza sativa genomic DNA, chromosome 4, BAC...    63   6e-19   
gb:AP002901_1823733 Oryza sativa (japonica cultivar-group) genom...    65   6e-19   
gb:AP004768_1844723 Oryza sativa (japonica cultivar-group) genom...    64   6e-19   
pir|B86289|B86289 probable serine/threonine-specific protein kin...    59   6e-19   
pir|E96647|E96647 hypothetical protein F19K23.5 [imported] - Ara...    62   6e-19   
gb:AB020746_1514621 Arabidopsis thaliana genomic DNA, chromosome...    62   6e-19   
gb:AP002901_1823734 Oryza sativa (japonica cultivar-group) genom...    65   6e-19   
pir|T00574|T00574 probable protein kinase [imported] - Arabidops...    72   6e-19   
gb:AB109215_1526831 Hordeum vulgare BRI1 gene for putative brass...    67   8e-19   
gb:AB088206_1524763 Hordeum vulgare BRI1 mRNA for putative brass...    67   8e-19   
gb:AP005457_1852180 Oryza sativa (japonica cultivar-group) genom...    60   8e-19   
gb:AY756174_1627010 Oryza rufipogon putative leucine-rich repeat...    61   8e-19   
gb:AB019235_1514215 Arabidopsis thaliana genomic DNA, chromosome...    63   8e-19   
gb:OSJN00200_1696604 Oryza sativa genomic DNA, chromosome 4, BAC...    61   8e-19   
pir|T45690|T45690 receptor-like protein kinase homolog - Arabido...    60   8e-19   
gb:AE016959_1021829 Oryza sativa (japonica cultivar-group) chrom...    61   8e-19   
pir|T05149|T05149 protein kinase homolog F18E5.30 - Arabidopsis ...    60   8e-19   
gb:AP004014_1836378 Oryza sativa (japonica cultivar-group) genom...    60   8e-19   
gb:AE016959_1020714 Oryza sativa (japonica cultivar-group) chrom...    60   8e-19   
gb:AJ841698_1814401 Poa pratensis serk1 gene for somatic embryog...    59   8e-19   
gb:AJ841697_1814400 Poa pratensis serk2 gene for somatic embryog...    59   8e-19   
gb:ZMA400870_1731518 Zea mays partial mRNA for somatic embryogen...    61   8e-19   
gb:AP004586_1841916 Oryza sativa (japonica cultivar-group) genom...    63   8e-19   
gb:AY085132_1570213 Arabidopsis thaliana clone 13257 mRNA, compl...    62   8e-19   
gb:AP003411_1829038 Oryza sativa (japonica cultivar-group) genom...    61   1e-18   
gb:AP005457_1852174 Oryza sativa (japonica cultivar-group) genom...    62   1e-18   
gb:AY064972_1566148 Arabidopsis thaliana AT4g08850/T32A17_160 mR...    63   1e-18   
pir|B85089|B85089 receptor protein kinase-like protein [imported...    63   1e-18   
sp|O24585|CRI4_MAIZE|CRI4_MAIZE Putative receptor protein kinase CRINKLY4 p...    64   1e-18   
gb:AE005173_892850 Arabidopsis thaliana chromosome 1, bottom arm...    60   1e-18   
pir|A96558|A96558 probable protein kinase [imported] - Arabidops...    63   1e-18   
gb:AP005396_1851082 Oryza sativa (japonica cultivar-group) genom...    70   1e-18   
pir|T05148|T05148 protein kinase homolog F18E5.20 - Arabidopsis ...    58   1e-18   
gb:OSJN00076_1694417 Oryza sativa genomic DNA, chromosome 4, BAC...    63   1e-18   
pir|T01086|T01086 probable serine/threonine-specific protein kin...    61   1e-18   
pir|G84686|G84686 probable protein kinase [imported] - Arabidops...    63   1e-18   
gb:AP004991_1846842 Oryza sativa (japonica cultivar-group) genom...    62   1e-18   
pir|T01617|T01617 probable protein kinase [imported] - Arabidops...    59   1e-18   
gb:AP003858_1834406 Oryza sativa (japonica cultivar-group) genom...    62   1e-18   
gb:AC109596_1738732 Oryza sativa (japonica cultivar-group) chrom...    64   1e-18   
gb:AB057787_1521711 Oryza sativa OsCR4 gene, complete cds.>gb:AC...    64   1e-18   
pir|T49010|T49010 hypothetical protein F25L23.280 - Arabidopsis ...    65   1e-18   
pir|T02731|T02731 serine/threonine-specific protein kinase (EC 2...    62   1e-18   
gb:AP005400_1851185 Oryza sativa (japonica cultivar-group) genom...    64   1e-18   
gb:AB019227_1514080 Arabidopsis thaliana genomic DNA, chromosome...    64   1e-18   
gb:AP004764_1844639 Oryza sativa (japonica cultivar-group) genom...    58   1e-18   
gb:BT004634_1637668 Arabidopsis thaliana At3g53810 gene, complet...    59   1e-18   
pir|T45921|T45921 serine/threonine-specific kinase like protein ...    59   1e-18   
gb:AP004014_1836374 Oryza sativa (japonica cultivar-group) genom...    60   1e-18   
gb:BT008409_1639626 Arabidopsis thaliana At3g24600 gene, complet...    59   1e-18   
gb:AB020746_1514623 Arabidopsis thaliana genomic DNA, chromosome...    59   1e-18   
gb:AP003854_1834320 Oryza sativa (japonica cultivar-group) genom...    62   1e-18   
gb:OSJN00033_1693630 Oryza sativa genomic DNA, chromosome 4, BAC...    61   1e-18   
gb:AP005469_1852408 Oryza sativa (japonica cultivar-group) genom...    61   1e-18   
gb:AP004764_1844638 Oryza sativa (japonica cultivar-group) genom...    58   1e-18   
sp|Q9LQQ8|RCK7_ARATH|RCK7_ARATH Putative serine/threonine-protein kinase RL...    61   1e-18   
gb:AP004093_1837600 Oryza sativa (japonica cultivar-group) genom...    59   1e-18   
gb:AY007545_1558031 Brassica napus protein serine/threonine kina...    65   1e-18   
pir|T04841|T04841 protein kinase homolog F21P8.130 - Arabidopsis...    66   1e-18   
gb:AP005508_1853071 Oryza sativa (japonica cultivar-group) genom...    62   1e-18   
gb:OSJN00073_1694336 Oryza sativa genomic DNA, chromosome 4, BAC...    64   1e-18   
gb:AY714496_1624027 Oryza sativa (indica cultivar-group) clone O...    60   2e-18   
pir|F96602|F96602 hypothetical protein T6H22.8.2 [imported] - Ar...    62   2e-18   
pir|T04842|T04842 protein kinase AK4 (EC 2.7.1.-) - Arabidopsis ...    59   2e-18   
pir|C96574|C96574 hypothetical protein T3F20.25 [imported] - Ara...    67   2e-18   
gb:AC109596_1738731 Oryza sativa (japonica cultivar-group) chrom...    59   2e-18   
gb:AK118836_1816794 Arabidopsis thaliana At1g51800 mRNA for unkn...    64   2e-18   
pir|B96557|B96557 probable receptor protein kinase [imported] - ...    64   2e-18   
gb:AP004064_1837126 Oryza sativa (japonica cultivar-group) genom...    68   2e-18   
gb:AF084037_1767054 Arabidopsis thaliana receptor-like protein k...    59   2e-18   
gb:AP005100_1847815 Oryza sativa (japonica cultivar-group) genom...    64   2e-18   
gb:AP004301_1839823 Oryza sativa (japonica cultivar-group) genom...    62   2e-18   
pir|T04845|T04845 probable serine/threonine-specific protein kin...    60   2e-18   
gb:AY140033_1582473 Arabidopsis thaliana protein kinase-like pro...    59   2e-18   
gb:AY085517_1570586 Arabidopsis thaliana clone 15535 mRNA, compl...    59   2e-18   
pir|G86227|G86227 hypothetical protein [imported] - Arabidopsis ...    59   2e-18   
gb:AP003280_1827145 Oryza sativa (japonica cultivar-group) genom...    60   2e-18   
gb:AB028620_1518053 Arabidopsis thaliana genomic DNA, chromosome...    59   2e-18   
gb:AC007127_1535275 Arabidopsis thaliana chromosome 2 clone T23A...    61   2e-18   
pir|E84549|E84549 probable protein kinase [imported] - Arabidops...    61   2e-18   
gb:AY395743_1604832 Vitis aestivalis protein kinase-like protein...    62   2e-18   
gb:AY536850_1612404 Arabidopsis thaliana putative protein kinase...    61   2e-18   
sp|Q8L899|BRI1_LYCPE|BRI1_LYCPE Systemin receptor SR160 precursor (EC 2.7.1...    63   2e-18   
sp|Q8GUQ5|BRI1_LYCES|BRI1_LYCES Brassinosteroid LRR receptor kinase precurs...    63   2e-18   
gb:AY714495_1624026 Oryza sativa (indica cultivar-group) clone O...    59   2e-18   
gb:AC109596_1738728 Oryza sativa (japonica cultivar-group) chrom...    59   2e-18   
gb:AC096856_1736382 Oryza sativa chromosome 3 BAC OSJNBa0075M12 ...    64   2e-18   
gb:AC104487_1737663 Oryza sativa chromosome 3 BAC OSJNBa0042I09 ...    64   2e-18   
pir|S71277|S71277 serine/threonine-specific receptor protein kin...    61   2e-18   
pir|D85350|D85350 hypothetical protein AT4g29990 [imported] - Ar...    61   2e-18   
gb:OSJN00019_1693373 Oryza sativa genomic DNA, chromosome 4, BAC...    58   2e-18   
gb:AB006702_1509943 Arabidopsis thaliana genomic DNA, chromosome...    61   2e-18   
gb:AX088876_1461047 Sequence 1 from Patent WO0114563.>gb:AX82570...    59   2e-18   
gb:AP004087_1837530 Oryza sativa (japonica cultivar-group) genom...    62   2e-18   
gb:AC145120_1744276 Solanum demissum chromosome 5 BAC PGEC446O19...    67   2e-18   
gb:AP003579_1831218 Oryza sativa (japonica cultivar-group) genom...    71   2e-18   
sp|P43293|NAK_ARATH|NAK_ARATH Probable serine/threonine-protein kinase NAK...    69   2e-18   
pir|F86201|F86201 probable protein kinase [imported] - Arabidops...    64   2e-18   
gb:AY150374_1584939 Arabidopsis thaliana putative kinase interac...    64   2e-18   
gb:AP002537_1822501 Oryza sativa (japonica cultivar-group) genom...    62   2e-18   
gb:AC007592_1535979 Genomic sequence for Arabidopsis thaliana BA...    64   2e-18   
pir|G96602|G96602 probable receptor protein kinase F14G9.24 [imp...    62   3e-18   
gb:AC009894_1536870 Arabidopsis thaliana chromosome I BAC T6H22 ...    62   3e-18   
gb:AY756174_1627016 Oryza rufipogon putative leucine-rich repeat...    59   3e-18   
pir|D96574|D96574 hypothetical protein T3F20.24 [imported] - Ara...    65   3e-18   
pir|T51545|T51545 receptor protein kinase-like protein - Arabido...    62   3e-18   
gb:AF403127_1796415 Oryza sativa S-locus receptor-like kinase RL...    61   3e-18   
pir|A96529|A96529 hypothetical protein F13F21.28 [imported] - Ar...    60   3e-18   
gb:AP003758_1833018 Oryza sativa (japonica cultivar-group) genom...    61   3e-18   
gb:AB005231_1509264 Arabidopsis thaliana genomic DNA, chromosome...    58   3e-18   
gb:AB030083_1518398 Populus nigra PnLPK mRNA for lectin-like pro...    60   3e-18   
gb:AB015471_1512521 Arabidopsis thaliana genomic DNA, chromosome...    63   3e-18   
gb:AP003811_1833703 Oryza sativa (japonica cultivar-group) genom...    62   3e-18   
gb:AP003434_1829307 Oryza sativa (japonica cultivar-group) genom...    59   3e-18   
gb:AE016959_1023261 Oryza sativa (japonica cultivar-group) chrom...    59   3e-18   
gb:AP003300_1827660 Oryza sativa (japonica cultivar-group) genom...    62   3e-18   
gb:AC091494_1734784 Oryza sativa chromosome 3 BAC OSJNBa0070N04 ...    59   3e-18   
gb:AB023031_1515321 Arabidopsis thaliana genomic DNA, chromosome...    63   3e-18   
gb:AP006162_1861144 Oryza sativa (japonica cultivar-group) genom...    59   3e-18   
gb:OSJN00153_1695778 Oryza sativa genomic DNA, chromosome 4, BAC...    61   3e-18   
gb:AP003140_1824807 Oryza sativa (japonica cultivar-group) genom...    62   3e-18   
gb:AF436829_1799881 Arabidopsis thaliana AT4g26540/M3E9_30 mRNA,...    71   4e-18   
gb:AC079288_1732514 Arabidopsis thaliana chromosome 1 BAC T3M22 ...    65   4e-18   
gb:AP007224_1863292 Oryza sativa (japonica cultivar-group) genom...    59   4e-18   
gb:AP004342_1840507 Oryza sativa (japonica cultivar-group) genom...    58   4e-18   
pir|H86420|H86420 probable receptor-like serine/threonine kinase...    65   4e-18   
gb:OSJN00200_1696603 Oryza sativa genomic DNA, chromosome 4, BAC...    60   4e-18   
pir|T08973|T08973 probable serine/threonine-specific protein kin...    61   4e-18   
pir|C96558|C96558 probable protein kinase [imported] - Arabidops...    63   4e-18   
gb:AY358029_1601932 Medicago truncatula lectin-like receptor kin...    62   4e-18   
pir|T10567|T10567 probable serine/threonine-specific protein kin...    61   4e-18   
gb:AP003866_1834552 Oryza sativa (japonica cultivar-group) genom...    68   4e-18   
gb:AP003266_1826760 Oryza sativa (japonica cultivar-group) genom...    58   4e-18   
gb:AP005689_1856080 Oryza sativa (japonica cultivar-group) genom...    66   4e-18   
gb:AP004084_1837460 Oryza sativa (japonica cultivar-group) genom...    62   4e-18   
gb:AP003983_1835897 Oryza sativa (japonica cultivar-group) genom...    62   4e-18   
gb:AB009049_1510614 Arabidopsis thaliana genomic DNA, chromosome...    64   4e-18   
gb:OSJN00174_1696190 Oryza sativa genomic DNA, chromosome 4, BAC...    59   4e-18   
gb:OSJN00038_1693706 Oryza sativa genomic DNA, chromosome 4, BAC...    60   4e-18   
gb:OSA243961_1692389 Oryza sativa chromosome 4 BAC l1332 genomic...    59   4e-18   
gb:AY756174_1627013 Oryza rufipogon putative leucine-rich repeat...    59   5e-18   
gb:AB025613_1516373 Arabidopsis thaliana genomic DNA, chromosome...    57   5e-18   
pir|F85343|F85343 hypothetical protein AT4g29450 [imported] - Ar...    64   5e-18   
pir|T09349|T09349 S-receptor kinase (EC 2.7.1.-) T26M18.110 prec...    59   5e-18   
gb:AP001551_1821319 Oryza sativa (japonica cultivar-group) genom...    63   5e-18   
gb:OSJN00259_1697526 Oryza sativa genomic DNA, chromosome 4, BAC...    60   5e-18   
gb:AB025636_1516647 Arabidopsis thaliana genomic DNA, chromosome...    60   5e-18   
pir|T01181|T01181 hypothetical protein T26D22.12 - Arabidopsis t...    60   5e-18   
gb:AP005518_1853323 Oryza sativa (japonica cultivar-group) genom...    60   5e-18   
pir|T02732|T02732 serine/threonine-specific protein kinase (EC 2...    59   5e-18   
pir|D96728|D96728 hypothetical protein F24J13.3 [imported] - Ara...    58   5e-18   
gb:AB073628_1523190 Nicotiana tabacum mRNA for receptor-like pro...    61   5e-18   
gb:AP004314_1840053 Oryza sativa (japonica cultivar-group) genom...    60   5e-18   
gb:AP004570_1841747 Oryza sativa (japonica cultivar-group) genom...    59   5e-18   
gb:AC134886_1741831 Oryza sativa chromosome 3 BAC OSJNBa0002D18 ...    58   5e-18   
gb:AY220481_1590515 Nicotiana tabacum Avr9/Cf-9 induced kinase 1...    63   5e-18   
pir|C96641|C96641 hypothetical protein T25B24.6 [imported] - Ara...    59   5e-18   


>gb:AY050535_1562263 Arabidopsis thaliana leucine-rich repeat
            receptor-like kinase F21M12.36 mRNA, complete cds.
          Length = 977

 Score =  172 bits (436), Expect(2) = 4e-62
 Identities = 81/117 (69%), Positives = 100/117 (85%)
 Frame = -3

Query: 621  AEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMV 442
            AEYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ +V
Sbjct: 853  AEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIV 912

Query: 441  DSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA 271
            D  I E ++EDA+K+LRIAI+CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct: 913  DKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES 969



 Score = 89.4 bits (220), Expect(2) = 4e-62
 Identities = 41/55 (74%), Positives = 49/55 (89%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP
Sbjct: 798 ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAP 852



>gb:AY062680_1565336 Arabidopsis thaliana Unknown protein (At1g09970;
            F21M12.36) mRNA, complete cds.
          Length = 976

 Score =  171 bits (433), Expect(2) = 9e-62
 Identities = 80/119 (67%), Positives = 100/119 (84%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGY  KV EK DVYSFGVVLMELV+GKKPIEAE+GE+ DIV+WVS  LKSKES++ 
Sbjct: 850  IAPEYGYASKVTEKCDVYSFGVVLMELVTGKKPIEAEFGESKDIVNWVSNNLKSKESVME 909

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA 271
            +VD  I E ++EDA+K+LRIAI+CTA LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct: 910  IVDKKIGEMYREDAVKMLRIAIICTARLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES 968



 Score = 89.4 bits (220), Expect(2) = 9e-62
 Identities = 41/55 (74%), Positives = 49/55 (89%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAP
Sbjct: 798 ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAP 852



>pir|T52400|T52400 receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AP000417_1820121 Arabidopsis
            thaliana genomic DNA, chromosome 3, P1 clone: MMB12.
          Length = 991

 Score =  131 bits (330), Expect(2) = 9e-46
 Identities = 63/109 (57%), Positives = 84/109 (77%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV--STKLKSKESI 454
            +  EY YT KV EKSDVYSFGVVLMELV+GKKP+E ++GENNDIV WV   +K  ++E +
Sbjct: 860  IAPEYAYTTKVNEKSDVYSFGVVLMELVTGKKPLETDFGENNDIVMWVWSVSKETNREMM 919

Query: 453  LSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
            + ++D++I++ +KEDA+KVL IA+LCT   P +RP M+ VV MLE  EP
Sbjct: 920  MKLIDTSIEDEYKEDALKVLTIALLCTDKSPQARPFMKSVVSMLEKIEP 968



 Score = 75.5 bits (184), Expect(2) = 9e-46
 Identities = 38/56 (67%), Positives = 47/56 (83%), Gaps = 1/56 (1%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP 729
           DRP+IHRDVKSSNILLDE ++PRIADFGLAKI+Q +S  +D +  ++ GT GYIAP
Sbjct: 807 DRPVIHRDVKSSNILLDEEWRPRIADFGLAKIIQADSVQRDFSAPLVKGTLGYIAP 862



>gb:AK117901_1815909 Arabidopsis thaliana At5g49660 mRNA for putative
            receptor protein kinase, complete cds, clone:
            RAFL19-08-G15.
          Length = 966

 Score =  121 bits (303), Expect(2) = 3e-40
 Identities = 57/107 (53%), Positives = 75/107 (70%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY Y+ K   K DVYSFGVVLMEL++GKKP+++ +GEN +IV+WVSTK+ +KE ++ 
Sbjct: 832  LAPEYAYSSKATIKCDVYSFGVVLMELITGKKPVDSCFGENKNIVNWVSTKIDTKEGLIE 891

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
             +D  + E  K D I  LR+AI CT+  P  RPTM  VVQ+L DA P
Sbjct: 892  TLDKRLSESSKADMINALRVAIRCTSRTPTIRPTMNEVVQLLIDATP 938



 Score = 67.4 bits (163), Expect(2) = 3e-40
 Identities = 31/53 (58%), Positives = 42/53 (79%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           PIIHRD+KS+NILLD  ++P++ADFG+AK+LQ       TT V+ GT+GY+AP
Sbjct: 783 PIIHRDIKSTNILLDVNYQPKVADFGIAKVLQARGK-DSTTTVMAGTYGYLAP 834



>gb:AC119796_1739716 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1172F09, complete sequence.
          Length = 1030

 Score =  122 bits (306), Expect(2) = 2e-39
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 4/134 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGYT KV +KSD+YSFGVVLMEL++G++PIE EYGE+ DIV W+  +L+S   +  
Sbjct: 891  IAPEYGYTLKVDQKSDIYSFGVVLMELLTGRRPIEPEYGESQDIVGWIRERLRSNTGVEE 950

Query: 447  MVDSAI---QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP-CKLVSIIVS 280
            ++D+++    +  +E+ + VLR+A+LCTA  P  RPTMR VV ML +A+P  K  S  V+
Sbjct: 951  LLDASVGGRVDHVREEMLLVLRVAVLCTAKSPKDRPTMRDVVTMLGEAKPRRKSSSATVA 1010

Query: 279  KDAAKLDNPSDNTS 238
                  D P   TS
Sbjct: 1011 ATVVDKDKPVFTTS 1024



 Score = 63.2 bits (152), Expect(2) = 2e-39
 Identities = 29/56 (51%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  P+IHRDVKSSN+LLD+    +IADFGLA+++   +   +T  V+ G++GYIAP
Sbjct: 841 CRPPVIHRDVKSSNVLLDDNMDAKIADFGLARVM---ARAHETVSVVAGSYGYIAP 893



>pir|T00712|T00712 protein kinase homolog F22O13.7 - Arabidopsis
            thaliana>gb:AE005172_889864 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC003981_1531272 Genomic sequence for
            Arabidopsis thaliana BAC F22O13 from chromosome I,
            complete sequence.
          Length = 1029

 Score =  110 bits (274), Expect(2) = 1e-35
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 3/110 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGYT K+ EKSD+YS GVVL+ELV+GK PI+  + ++ D+V W+  K+K  ES+  
Sbjct: 896  IAPEYGYTLKIDEKSDIYSLGVVLLELVTGKMPIDPSFEDSIDVVEWIRRKVKKNESLEE 955

Query: 447  MVDSAIQEPFK---EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
            ++D++I    K   E+ +  LRIA+LCTA LP  RP++R V+ ML +A+P
Sbjct: 956  VIDASIAGDCKHVIEEMLLALRIALLCTAKLPKDRPSIRDVITMLAEAKP 1005



 Score = 63.2 bits (152), Expect(2) = 1e-35
 Identities = 30/56 (53%), Positives = 42/56 (75%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C  PIIHRD+KS+NILLD   + RIADFGLAK++ + +   +T  ++ G++GYIAP
Sbjct: 846  CYPPIIHRDIKSNNILLDSNLEARIADFGLAKMMLHKN---ETVSMVAGSYGYIAP 898



>gb:AY603422_1617457 Pyrus pyrifolia isolate Kousui2 leucine-rich
            repeat receptor-like protein kinase mRNA, complete cds.
          Length = 998

 Score =  107 bits (268), Expect(2) = 1e-33
 Identities = 51/104 (49%), Positives = 77/104 (74%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSD+YSFGVV++ELV+G+ P++ E+GE  D+V WV T L  K  + +
Sbjct: 866  IAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPVDPEFGE-KDLVKWVCTTLDQK-GVDN 923

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            +VD  ++  +KE+  KVL I +LCT+ LP +RP+MRRVV++L++
Sbjct: 924  VVDPKLESCYKEEVCKVLNIGLLCTSPLPINRPSMRRVVKLLQE 967



 Score = 58.9 bits (141), Expect(2) = 1e-33
 Identities = 29/56 (51%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PI+HRDVKS+NILLD  F  R+ADFG+AK +        +  +I G+ GYIAP
Sbjct: 813 CVPPIVHRDVKSNNILLDGDFGARVADFGVAKEVDVTGKGLKSMSIIAGSCGYIAP 868



>gb:AY603421_1617456 Pyrus pyrifolia isolate Kousui1 leucine-rich
            repeat receptor-like protein kinase mRNA, complete cds.
          Length = 998

 Score =  107 bits (268), Expect(2) = 1e-33
 Identities = 51/104 (49%), Positives = 77/104 (74%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSD+YSFGVV++ELV+G+ P++ E+GE  D+V WV T L  K  + +
Sbjct: 866  IAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPVDPEFGE-KDLVKWVCTTLDQK-GVDN 923

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            +VD  ++  +KE+  KVL I +LCT+ LP +RP+MRRVV++L++
Sbjct: 924  VVDPKLESCYKEEVCKVLNIGLLCTSPLPINRPSMRRVVKLLQE 967



 Score = 58.9 bits (141), Expect(2) = 1e-33
 Identities = 29/56 (51%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PI+HRDVKS+NILLD  F  R+ADFG+AK +        +  +I G+ GYIAP
Sbjct: 813 CVPPIVHRDVKSNNILLDGDFGARVADFGVAKEVDVTGKGLKSMSIIAGSCGYIAP 868



>gb:AY603423_1617458 Pyrus pyrifolia isolate Kinchaku leucine-rich
            repeat receptor-like protein kinase mRNA, partial cds.
          Length = 987

 Score =  107 bits (268), Expect(2) = 1e-33
 Identities = 51/104 (49%), Positives = 77/104 (74%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSD+YSFGVV++ELV+G+ P++ E+GE  D+V WV T L  K  + +
Sbjct: 855  IAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPVDPEFGE-KDLVKWVCTTLDQK-GVDN 912

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            +VD  ++  +KE+  KVL I +LCT+ LP +RP+MRRVV++L++
Sbjct: 913  VVDPKLESCYKEEVCKVLNIGLLCTSPLPINRPSMRRVVKLLQE 956



 Score = 58.9 bits (141), Expect(2) = 1e-33
 Identities = 29/56 (51%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PI+HRDVKS+NILLD  F  R+ADFG+AK +        +  +I G+ GYIAP
Sbjct: 802 CVPPIVHRDVKSNNILLDGDFGARVADFGVAKEVDVTGKGLKSMSIIAGSCGYIAP 857



>pir|C96745|C96745 hypothetical protein T9N14.3 [imported] -
            Arabidopsis thaliana>gb:AE005173_894765 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC067754_1540317 Arabidopsis thaliana
            chromosome 1 BAC T9N14 genomic sequence, complete
            sequence.
          Length = 977

 Score =  103 bits (256), Expect(2) = 3e-33
 Identities = 50/110 (45%), Positives = 78/110 (70%), Gaps = 2/110 (1%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKL-KSKESIL 451
            +  E  Y+ K  EKSDVYSFGVVL+ELV+G +P+E E+GE  DIV +V +++ +   ++ 
Sbjct: 855  MAPELAYSFKATEKSDVYSFGVVLLELVTGLRPMEDEFGEGKDIVDYVYSQIQQDPRNLQ 914

Query: 450  SMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPC 304
            +++D  +   + +E  I+VL++ +LCT  LPN RP+MR VV+ L+DA+PC
Sbjct: 915  NVLDKQVLSTYIEESMIRVLKMGLLCTTKLPNLRPSMREVVRKLDDADPC 964



 Score = 62.0 bits (149), Expect(2) = 3e-33
 Identities = 32/58 (55%), Positives = 40/58 (68%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQ--YNSSCKDTTHVIPGTHGYIAP 729
           C  PIIHRD+KSSNILLD  ++ +IADFG+AK+    Y  SC      + GTHGY+AP
Sbjct: 806 CCPPIIHRDIKSSNILLDGDYESKIADFGVAKVADKGYEWSC------VAGTHGYMAP 857



>gb:AP003210_1825238 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBa0010K01.
          Length = 1002

 Score =  106 bits (265), Expect(2) = 7e-33
 Identities = 51/104 (49%), Positives = 77/104 (74%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSD+YSFGVVL+ELV+GK P++ E+GE  D+V WV + +  K  +  
Sbjct: 870  IAPEYAYTLRVNEKSDIYSFGVVLLELVTGKPPVDPEFGE-KDLVKWVCSTIDQK-GVEH 927

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            ++DS +   FK++  +VL IA+LC+++LP +RP MRRVV+ML++
Sbjct: 928  VLDSKLDMTFKDEINRVLNIALLCSSSLPINRPAMRRVVKMLQE 971



 Score = 57.4 bits (137), Expect(2) = 7e-33
 Identities = 28/52 (53%), Positives = 37/52 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRDVKS+NILLD  F  R+ADFG+AK+++       +  VI G+ GYIAP
Sbjct: 821 IVHRDVKSNNILLDAEFGARVADFGVAKVVEATVRGPKSMSVIAGSCGYIAP 872



>gb:AX008789_1456287 Sequence 1 from Patent
            WO9964600.>gb:AF053127_1764428 Malus domestica
            leucine-rich receptor-like protein kinase (LRPKm1) mRNA,
            complete cds.
          Length = 999

 Score =  107 bits (268), Expect(2) = 1e-32
 Identities = 51/104 (49%), Positives = 77/104 (74%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSD+YSFGVV++ELV+G+ P++ E+GE  D+V WV T L  K  + +
Sbjct: 867  IAPEYAYTLRVNEKSDIYSFGVVILELVTGRLPVDPEFGE-KDLVKWVCTTLDQK-GVDN 924

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            +VD  ++  +KE+  KVL I +LCT+ LP +RP+MRRVV++L++
Sbjct: 925  VVDPKLESCYKEEVCKVLNIGLLCTSPLPINRPSMRRVVKLLQE 968



 Score = 55.5 bits (132), Expect(2) = 1e-32
 Identities = 28/56 (50%), Positives = 36/56 (64%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F  R+ADFG+AK +        +  +I G+ GYIAP
Sbjct: 814 CVPAIVHRDVKSNNILLDGDFGARVADFGVAKEVDATGKGLKSMSIIAGSCGYIAP 869



>pir|F86410|F86410 protein F3M18.12 [imported] - Arabidopsis
            thaliana>gb:AE005172_891730 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC010155_1536924 Genomic sequence for
            Arabidopsis thaliana BAC F3M18 from chromosome I,
            complete sequence.>gb:AY093235_1575189 Arabidopsis
            thaliana putative receptor protein kinase (At1g28440)
            mRNA, complete cds.>gb:BT008808_1640004 Arabidopsis
            thaliana At1g28440 gene, complete cds.
          Length = 996

 Score =  103 bits (256), Expect(2) = 6e-32
 Identities = 49/104 (47%), Positives = 74/104 (71%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSD+YSFGVV++E+V+ K+P++ E GE  D+V WV + L  K  I  
Sbjct: 860  IAPEYAYTLRVNEKSDIYSFGVVILEIVTRKRPVDPELGE-KDLVKWVCSTLDQK-GIEH 917

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            ++D  +   FKE+  K+L + +LCT+ LP +RP+MRRVV+ML++
Sbjct: 918  VIDPKLDSCFKEEISKILNVGLLCTSPLPINRPSMRRVVKMLQE 961



 Score = 57.8 bits (138), Expect(2) = 6e-32
 Identities = 26/53 (49%), Positives = 36/53 (67%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           PI+HRD+KS+NIL+D  +  R+ADFG+AK +        +  VI G+ GYIAP
Sbjct: 810 PIVHRDIKSNNILIDGDYGARVADFGVAKAVDLTGKAPKSMSVIAGSCGYIAP 862



>gb:AP003742_1832731 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1118_D07.>gb:AP004338_1840410 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, PAC
            clone:P0507H12.
          Length = 1023

 Score = 94.4 bits (233), Expect(2) = 1e-31
 Identities = 49/105 (46%), Positives = 67/105 (63%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL 451
            +  EY YT KV EKSDVYSFGVVL+EL++GKKP+  E+G+  DIV WV T   S KE ++
Sbjct: 865  IAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPV-GEFGDGVDIVQWVKTMTDSNKEHVI 923

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             ++D  +      + + V  +A+LC       RPTMR VVQ+L +
Sbjct: 924  KILDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQILSE 968



 Score = 65.5 bits (158), Expect(2) = 1e-31
 Identities = 32/56 (57%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PI+HRDVKS+NILLD  F+  +ADFGLAK LQ +S   +    I G++GYIAP
Sbjct: 813 CSPPILHRDVKSNNILLDSDFEAHVADFGLAKFLQ-DSGTSECMSAIAGSYGYIAP 867



>gb:AP003227_1825640 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0018C10.>gb:AP003261_1826594 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0471B04.
          Length = 964

 Score =  100 bits (250), Expect(2) = 1e-31
 Identities = 51/106 (48%), Positives = 72/106 (67%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  E  Y+ KV EKSDVYSFG+VL+EL++G+ P + ++    DIVSWVS+ L + ++  +
Sbjct: 845  MAPELAYSLKVTEKSDVYSFGIVLLELLTGRSPSDQQFDGELDIVSWVSSHL-ANQNPAA 903

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
            ++D  +     ED  KVL IAILCT  LP+ RPTMR VV+ML D +
Sbjct: 904  VLDPKVSSHASEDMTKVLNIAILCTVQLPSERPTMREVVKMLIDID 949



 Score = 58.9 bits (141), Expect(2) = 1e-31
 Identities = 29/57 (50%), Positives = 41/57 (71%), Gaps = 1/57 (1%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNS-SCKDTTHVIPGTHGYIAP 729
           C   IIHRD+KS+NILLDE ++ ++ADFG+AK+++ +  SC        GTHGY+AP
Sbjct: 797 CSPAIIHRDIKSTNILLDEEYEAKLADFGIAKLVEGSPLSC------FAGTHGYMAP 847



>gb:AC099732_1737183 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1203D03, complete sequence.
          Length = 1001

 Score = 90.5 bits (223), Expect(2) = 6e-31
 Identities = 49/105 (46%), Positives = 64/105 (60%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKL-KSKESIL 451
            +  EY YT KV EKSDVYSFGVVL+EL++G+KP+  E+G+  DIV WV      SKE + 
Sbjct: 853  IAPEYAYTLKVDEKSDVYSFGVVLLELIAGRKPV-GEFGDGVDIVHWVRMVTGSSKEGVT 911

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             + D  +      +   V  +A+LC A     RPTMR VVQ+L D
Sbjct: 912  KIADPRLSTVPLHELTHVFYVAMLCVAEQSVERPTMREVVQILTD 956



 Score = 67.0 bits (162), Expect(2) = 6e-31
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PI+HRDVKS+NILLD  F+  +ADFGLAK L+ N+   +    I G++GYIAP
Sbjct: 800 CSPPILHRDVKSNNILLDAEFEAHVADFGLAKFLRGNAGGSECMSAIAGSYGYIAP 855



>gb:AP005593_1854663 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0692F07.
          Length = 967

 Score =  102 bits (254), Expect(2) = 1e-30
 Identities = 51/104 (49%), Positives = 75/104 (72%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSDVYSFGVV++ELV+GK P+ ++ G+  D+V+W +T ++ +    S
Sbjct: 847  IAPEYAYTIRVTEKSDVYSFGVVMLELVTGKSPMSSDIGD-KDLVAWAATNVE-QNGAES 904

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            ++D  I E FK++  +VLRIA+LC   LPN+RP+MR VV+ L D
Sbjct: 905  VLDEKIAEHFKDEMCRVLRIALLCVKNLPNNRPSMRLVVKFLLD 948



 Score = 54.3 bits (129), Expect(2) = 1e-30
 Identities = 30/52 (57%), Positives = 37/52 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRDVKS+NILLD  F+ +IADFG+AK +    +   T  VI G+ GYIAP
Sbjct: 801 IIHRDVKSNNILLDADFRAKIADFGVAKSIGDGPA---TMSVIAGSCGYIAP 849



>gb:AF244888_1780445 Glycine max receptor-like protein kinase 1 (RLK1)
            mRNA, complete cds.
          Length = 1008

 Score = 93.2 bits (230), Expect(2) = 2e-30
 Identities = 50/105 (47%), Positives = 67/105 (63%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL 451
            +  EY YT KV EKSDVYSFGVVL+ELV+G+KP+  E+G+  DIV WV     S KE +L
Sbjct: 856  IAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPV-GEFGDGVDIVQWVRKMTDSNKEGVL 914

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             ++DS +      + + V  +A+LC       RPTMR VVQ+L +
Sbjct: 915  KVLDSRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTE 959



 Score = 62.4 bits (150), Expect(2) = 2e-30
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK LQ +S   +    I G++GYIAP
Sbjct: 804 CSPLIVHRDVKSNNILLDSNFEAHVADFGLAKFLQ-DSGASECMSAIAGSYGYIAP 858



>pir|T05897|T05897 protein kinase homolog F6H11.160 - Arabidopsis
            thaliana>gb:AB010075_1510984 Arabidopsis thaliana genomic
            DNA, chromosome 5, P1 clone:MPA24.>gb:ATF6H11_1550859
            Arabidopsis thaliana DNA chromosome 5, BAC clone F6H11
            (ESSAII project).
          Length = 976

 Score = 93.6 bits (231), Expect(2) = 4e-30
 Identities = 50/124 (40%), Positives = 76/124 (61%), Gaps = 20/124 (16%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV------------ 484
            +  EYGYT KV EKSDVYSFGVVL+EL++GK+P ++ +GEN DIV +             
Sbjct: 848  IAPEYGYTSKVNEKSDVYSFGVVLLELITGKRPNDSSFGENKDIVKFAMEAALCYPSPSA 907

Query: 483  ------STKLKSKESILSMVDSAIQEPFK--EDAIKVLRIAILCTAALPNSRPTMRRVVQ 328
                     L +   +  +VD  ++   +  E+  KVL +A+LCT++ P +RPTMR+VV+
Sbjct: 908  EDGAMNQDSLGNYRDLSKLVDPKMKLSTREYEEIEKVLDVALLCTSSFPINRPTMRKVVE 967

Query: 327  MLED 316
            +L++
Sbjct: 968  LLKE 971



 Score = 61.2 bits (147), Expect(2) = 4e-30
 Identities = 32/56 (57%), Positives = 40/56 (71%), Gaps = 3/56 (5%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKIL--QYNSSCKDTT-HVIPGTHGYIAP 729
           PI+HRDVKS+NILLD   KPR+ADFGLAK L  + N    D +   + G++GYIAP
Sbjct: 795 PIVHRDVKSNNILLDHEMKPRVADFGLAKPLKREDNDGVSDVSMSCVAGSYGYIAP 850



>pir|T46033|T46033 receptor protein kinase-like protein - Arabidopsis
            thaliana>gb:ATT16K5_1554580 Arabidopsis thaliana DNA
            chromosome 3, BAC clone T16K5.>gb:BT005722_1638658
            Arabidopsis thaliana clone RAFL15-39-P09 (R50199)
            putative leucine-rich repeat transmembrane protein kinase
            (At3g49670) mRNA, complete cds.>gb:BT006113_1639007
            Arabidopsis thaliana clone U50199 putative leucine-rich
            repeat transmembrane protein kinase (At3g49670) mRNA,
            complete cds.
          Length = 1002

 Score = 91.7 bits (226), Expect(2) = 8e-30
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL 451
            +  EY YT KV EKSDVYSFGVVL+EL++GKKP+  E+G+  DIV WV +   S K+ +L
Sbjct: 860  IAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPV-GEFGDGVDIVQWVRSMTDSNKDCVL 918

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             ++D  +      +   V  +A+LC       RPTMR VVQ+L +
Sbjct: 919  KVIDLRLSSVPVHEVTHVFYVALLCVEEQAVERPTMREVVQILTE 963



 Score = 62.0 bits (149), Expect(2) = 8e-30
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK LQ +S   +    I G++GYIAP
Sbjct: 808 CSPLIVHRDVKSNNILLDSNFEAHVADFGLAKFLQ-DSGTSECMSAIAGSYGYIAP 862



>pir|T05898|T05898 hypothetical protein F6H11.170 - Arabidopsis
            thaliana>gb:AX250419_1464807 Sequence 25 from Patent
            WO0168863.>gb:AB010075_1510983 Arabidopsis thaliana
            genomic DNA, chromosome 5, P1
            clone:MPA24.>gb:ATF6H11_1550860 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F6H11 (ESSAII
            project).>gb:AY099814_1576839 Arabidopsis thaliana
            receptor protein kinase-like protein (At5g65700) mRNA,
            complete cds.>gb:BT008810_1640006 Arabidopsis thaliana
            At5g65700 gene, complete cds.
          Length = 1003

 Score = 90.5 bits (223), Expect(2) = 2e-29
 Identities = 49/105 (46%), Positives = 66/105 (62%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL 451
            +  EY YT KV EKSDVYSFGVVL+ELV+G+KP+  E+G+  DIV WV     S K+S+L
Sbjct: 864  IAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPV-GEFGDGVDIVQWVRKMTDSNKDSVL 922

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             ++D  +      +   V  +A+LC       RPTMR VVQ+L +
Sbjct: 923  KVLDPRLSSIPIHEVTHVFYVAMLCVEEQAVERPTMREVVQILTE 967



 Score = 62.0 bits (149), Expect(2) = 2e-29
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK LQ +S   +    I G++GYIAP
Sbjct: 812 CSPLIVHRDVKSNNILLDSNFEAHVADFGLAKFLQ-DSGTSECMSAIAGSYGYIAP 866



>gb:AC092781_1735750 Oryza sativa chromosome 3 BAC OSJNBb0094O03
            genomic sequence, complete sequence.
          Length = 1029

 Score = 90.9 bits (224), Expect(2) = 3e-29
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL 451
            +  EY YT KV EKSDVYSFGVVL+ELV+G+KP+  E+G+  DIV WV     S KE ++
Sbjct: 866  IAPEYAYTLKVDEKSDVYSFGVVLLELVTGRKPV-GEFGDGVDIVQWVRMMTDSNKEQVM 924

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             ++D  +      + + V  +A+LC       RPTMR VVQ+L +
Sbjct: 925  KVLDPRLSTVPLHEVMHVFYVALLCIEEQSVQRPTMREVVQILSE 969



 Score = 60.8 bits (146), Expect(2) = 3e-29
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK LQ ++   +    I G++GYIAP
Sbjct: 814 CSPLILHRDVKSNNILLDSDFEAHVADFGLAKFLQ-DTGASECMSAIAGSYGYIAP 868



>pir|B86234|B86234 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890001 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:F21M12_1677874 Sequence of BAC F21M12 from
            Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 921

 Score =  130 bits (327), Expect = 3e-29
 Identities = 59/93 (63%), Positives = 78/93 (83%)
 Frame = -3

Query: 549  LVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVDSAIQEPFKEDAIKVLRIAILCTA 370
            +  GKKPIEAE+GE+ DIV+WVS  LKSKES++ +VD  I E ++EDA+K+LRIAI+CTA
Sbjct: 821  IAPGKKPIEAEFGESKDIVNWVSNNLKSKESVMEIVDKKIGEMYREDAVKMLRIAIICTA 880

Query: 369  ALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA 271
             LP  RPTMR VVQM+EDAEPC+L+ I++SK++
Sbjct: 881  RLPGLRPTMRSVVQMIEDAEPCRLMGIVISKES 913



 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 43/58 (74%), Positives = 51/58 (87%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTK 720
           +RP+IHRDVKSSNILLDEF KPRIADFGLAKILQ ++   ++THV+ GT+GYIAPG K
Sbjct: 769 ERPVIHRDVKSSNILLDEFLKPRIADFGLAKILQASNGGPESTHVVAGTYGYIAPGKK 826



>gb:AF244890_1780447 Glycine max receptor-like protein kinase 3 (RLK3)
            mRNA, complete cds.
          Length = 1012

 Score = 90.9 bits (224), Expect(2) = 9e-29
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL 451
            +  EY YT KV EKSDVYSFGVVL+EL++G+KP+  E+G+  DIV WV     S KE +L
Sbjct: 860  IAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPV-GEFGDGVDIVQWVRKMTDSNKEGVL 918

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             ++D  +      + + V  +A+LC       RPTMR VVQ+L +
Sbjct: 919  KVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTE 963



 Score = 59.3 bits (142), Expect(2) = 9e-29
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD   +  +ADFGLAK LQ +S   +    I G++GYIAP
Sbjct: 808 CSPLIVHRDVKSNNILLDSNHEAHVADFGLAKFLQ-DSGTSECMSAIAGSYGYIAP 862



>gb:AF244889_1780446 Glycine max receptor-like protein kinase 2 (RLK2)
            mRNA, complete cds.
          Length = 1012

 Score = 90.9 bits (224), Expect(2) = 9e-29
 Identities = 48/105 (45%), Positives = 66/105 (62%), Gaps = 1/105 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS-KESIL 451
            +  EY YT KV EKSDVYSFGVVL+EL++G+KP+  E+G+  DIV WV     S KE +L
Sbjct: 860  IAPEYAYTLKVDEKSDVYSFGVVLLELITGRKPV-GEFGDGVDIVQWVRKMTDSNKEGVL 918

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
             ++D  +      + + V  +A+LC       RPTMR VVQ+L +
Sbjct: 919  KVLDPRLPSVPLHEVMHVFYVAMLCVEEQAVERPTMREVVQILTE 963



 Score = 59.3 bits (142), Expect(2) = 9e-29
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD   +  +ADFGLAK LQ +S   +    I G++GYIAP
Sbjct: 808 CSPLIVHRDVKSNNILLDSNHEAHVADFGLAKFLQ-DSGTSECMSAIAGSYGYIAP 862



>gb:AP003768_1833267 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0439E07.
          Length = 1066

 Score = 83.2 bits (204), Expect(2) = 1e-27
 Identities = 46/103 (44%), Positives = 63/103 (61%), Gaps = 1/103 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  E GYT+KV EK DVYSFGVVL+EL +GK   +   GE+  +  W     +S ESI  
Sbjct: 909  MAPECGYTRKVDEKVDVYSFGVVLLELTTGKAANDG--GEHGSLADWARHHYQSGESIPD 966

Query: 447  MVDSAIQEPFKEDAIKVL-RIAILCTAALPNSRPTMRRVVQML 322
              D  I+     D I+V+ R+ ++CT A P SRPTM+ V+Q+L
Sbjct: 967  ATDQCIRYAGYSDEIEVVFRLGVMCTGATPASRPTMKDVLQIL 1009



 Score = 63.2 bits (152), Expect(2) = 1e-27
 Identities = 29/56 (51%), Positives = 40/56 (71%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C  PI+HRDVK+SNILLD  F+ ++ADFGLA++L   +   DT   + G+ GY+AP
Sbjct: 857  CTPPIVHRDVKTSNILLDSEFRAKVADFGLARMLA-QAGTPDTVSAVAGSFGYMAP 911



>gb:AB092809_1525111 Lotus corniculatus var. japonicus HAR1 gene for
            LRR receptor-like kinase, hypothetical proteins, complete
            and partial cds, clone:BAC259.12D-2.>gb:AB092810_1525115
            Lotus corniculatus var. japonicus HAR1 mRNA for LRR
            receptor-like kinase, complete cds.>gb:LCO580824_1684036
            Lotus corniculatus var. japonicus har1 gene and genes for
            transcription factor homolog BTF3-like protein,
            S-receptor kinase-like protein 1, S-receptor kinase-like
            protein 2, S-receptor kinase-like protein 3 and SAR
            DNA-binding protein-like protein.>gb:LJA495843_1684981
            Lotus japonicus har1 gene for hypernodulation aberrant
            root formation protein, exons 1-2.>gb:LJA495844_1684982
            Lotus japonicus mRNA for hypernodulation aberrant root
            formation protein, (har1 gene).
          Length = 986

 Score = 85.1 bits (209), Expect(2) = 2e-27
 Identities = 46/108 (42%), Positives = 64/108 (59%), Gaps = 6/108 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES--- 457
            +  EY YT KV EKSDVYSFGVVL+EL+ G+KP+  E+G+  DIV WV+  +        
Sbjct: 864  IAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPV-GEFGDGVDIVGWVNKTMSELSQPSD 922

Query: 456  ---ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
               +L++VD  +        I +  IA++C   +  +RPTMR VV ML
Sbjct: 923  TALVLAVVDPRLSGYPLTSVIHMFNIAMMCVKEMGPARPTMREVVHML 970



 Score = 60.5 bits (145), Expect(2) = 2e-27
 Identities = 31/56 (55%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILLD  F+  +ADFGLAK L Y+     +   I G++GYIAP
Sbjct: 812 CSPLIIHRDVKSNNILLDADFEAHVADFGLAKFL-YDPGASQSMSSIAGSYGYIAP 866



>sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 precursor (EC
            2.7.1.-).>gb:ATU96879_1557418 Arabidopsis thaliana CLV1
            receptor kinase (CLAVATA1) gene, complete cds.
          Length = 980

 Score = 87.4 bits (215), Expect(2) = 3e-27
 Identities = 52/122 (42%), Positives = 72/122 (59%), Gaps = 6/122 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS------TKLKS 466
            +  EY YT KV EKSDVYSFGVVL+EL++GKKP+  E+GE  DIV WV       T+   
Sbjct: 861  IAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPV-GEFGEGVDIVRWVRNTEEEITQPSD 919

Query: 465  KESILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSII 286
               ++++VD  +        I V +IA++C      +RPTMR VV ML    P K V+ +
Sbjct: 920  AAIVVAIVDPRLTGYPLTSVIHVFKIAMMCVEEEAAARPTMREVVHML--TNPPKSVANL 977

Query: 285  VS 280
            ++
Sbjct: 978  IA 979



 Score = 57.8 bits (138), Expect(2) = 3e-27
 Identities = 29/56 (51%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK L  + +  +    I G++GYIAP
Sbjct: 809 CSPLILHRDVKSNNILLDSDFEAHVADFGLAKFL-VDGAASECMSSIAGSYGYIAP 863



>pir|T50851|T50851 receptor protein kinase homolog [imported] -
            soybean>gb:AF197946_1776384 Glycine max receptor protein
            kinase-like protein (CLV1A) mRNA, complete cds.
          Length = 981

 Score = 84.7 bits (208), Expect(2) = 3e-27
 Identities = 48/110 (43%), Positives = 69/110 (62%), Gaps = 6/110 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS-TKLKSKES-- 457
            +  EY YT KV EKSDVYSFGVVL+EL+ G+KP+  E+G+  DIV WV+ T+L+  +   
Sbjct: 859  IAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPV-GEFGDGVDIVGWVNKTRLELSQPSD 917

Query: 456  ---ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
               +L++VD  +        I +  IA++C   +  +RPTMR VV ML +
Sbjct: 918  AAVVLAVVDPRLSGYPLISVIYMFNIAMMCVKEVGPTRPTMREVVHMLSN 967



 Score = 60.5 bits (145), Expect(2) = 3e-27
 Identities = 31/56 (55%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILLD  F+  +ADFGLAK L Y+     +   I G++GYIAP
Sbjct: 807 CSPLIIHRDVKSNNILLDAHFEAHVADFGLAKFL-YDLGSSQSMSSIAGSYGYIAP 861



>pir|E96787|E96787 protein T4O12.5 [imported] - Arabidopsis
            thaliana>gb:AE005173_895118 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC007396_1535823 Genomic sequence for
            Arabidopsis thaliana BAC T4O12 from chromosome I,
            complete sequence.
          Length = 978

 Score = 87.4 bits (215), Expect(2) = 3e-27
 Identities = 52/122 (42%), Positives = 72/122 (59%), Gaps = 6/122 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS------TKLKS 466
            +  EY YT KV EKSDVYSFGVVL+EL++GKKP+  E+GE  DIV WV       T+   
Sbjct: 859  IAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPV-GEFGEGVDIVRWVRNTEEEITQPSD 917

Query: 465  KESILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSII 286
               ++++VD  +        I V +IA++C      +RPTMR VV ML    P K V+ +
Sbjct: 918  AAIVVAIVDPRLTGYPLTSVIHVFKIAMMCVEEEAAARPTMREVVHML--TNPPKSVANL 975

Query: 285  VS 280
            ++
Sbjct: 976  IA 977



 Score = 57.8 bits (138), Expect(2) = 3e-27
 Identities = 29/56 (51%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK L  + +  +    I G++GYIAP
Sbjct: 807 CSPLILHRDVKSNNILLDSDFEAHVADFGLAKFL-VDGAASECMSSIAGSYGYIAP 861



>gb:AY283519_1594738 Brassica napus CLV1-like receptor kinase
            (CLAVATA1) gene, partial cds.
          Length = 978

 Score = 86.7 bits (213), Expect(2) = 5e-27
 Identities = 48/108 (44%), Positives = 65/108 (60%), Gaps = 6/108 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVST------KLKS 466
            +  EY YT KV EKSDVYSFGVVL+EL++GKKP+  E+GE  DIV WV        +   
Sbjct: 868  IAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPV-GEFGEGVDIVRWVRNTEGEIPQPSD 926

Query: 465  KESILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
              +++++VD  +        I V +IA++C      +RPTMR VV ML
Sbjct: 927  AATVVAIVDQRLTGYPLTSVIHVFKIAMMCVEDEATTRPTMREVVHML 974



 Score = 57.8 bits (138), Expect(2) = 5e-27
 Identities = 29/56 (51%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK L  + +  +    I G++GYIAP
Sbjct: 816 CSPLILHRDVKSNNILLDSDFEAHVADFGLAKFL-LDGAASECMSSIAGSYGYIAP 870



>gb:AC118284_1739500 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1087_C03, complete
            sequence.>gb:AC144740_1744189 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone OSJNBa0075A10,
            complete sequence.
          Length = 1014

 Score = 84.3 bits (207), Expect(2) = 6e-27
 Identities = 46/107 (42%), Positives = 66/107 (61%), Gaps = 1/107 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  E  YT+KV EK DVYSFGVVL+EL++G++  +   GE+  +  W    L+S  SI  
Sbjct: 860  MAPECAYTRKVNEKVDVYSFGVVLLELITGREAHDG--GEHGSLAEWAWRHLQSGRSIAD 917

Query: 447  MVDSAIQEP-FKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             VD  I +  + +DA  V ++ I+CT A P +RPTMR V+Q+L   E
Sbjct: 918  AVDRCITDSGYGDDAEVVFKLGIICTGAQPATRPTMRDVLQILVRCE 964



 Score = 59.7 bits (143), Expect(2) = 6e-27
 Identities = 28/56 (50%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PI+HRD+KSSNILLD     ++ADFGLA++L   +   DT   + G+ GY+AP
Sbjct: 808 CSPPIVHRDIKSSNILLDAELMAKVADFGLARML-VQAGTPDTMTAVAGSFGYMAP 862



>pir|T05335|T05335 hypothetical protein F1C12.190 - Arabidopsis
            thaliana>gb:ATCHRIV52_1545865 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 52.>gb:ATF1C12_1549347
            Arabidopsis thaliana DNA chromosome 4, BAC clone F1C12
            (ESSA project).
          Length = 992

 Score = 84.7 bits (208), Expect(2) = 6e-27
 Identities = 41/107 (38%), Positives = 67/107 (62%), Gaps = 1/107 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLK-SKESIL 451
            +  EY YT ++ EKSDVYSFGVVL+EL++G+KP++    E  DIV W   +   +++ ++
Sbjct: 881  IAPEYAYTLRIDEKSDVYSFGVVLLELITGRKPVDNFGEEGIDIVQWSKIQTNCNRQGVV 940

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             ++D  +      +A+++  +A+LC       RPTMR VVQM+  A+
Sbjct: 941  KIIDQRLSNIPLAEAMELFFVAMLCVQEHSVERPTMREVVQMISQAK 987



 Score = 59.3 bits (142), Expect(2) = 6e-27
 Identities = 28/56 (50%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILL   F+  +ADFGLAK +  ++   +    I G++GYIAP
Sbjct: 828 CSPLIIHRDVKSNNILLGPEFEAHVADFGLAKFMMQDNGASECMSSIAGSYGYIAP 883



>gb:PSA495759_1701999 Pisum sativum sym29 gene for serine-threonine
            protein kinase, exons 1-2.
          Length = 976

 Score = 83.6 bits (205), Expect(2) = 6e-27
 Identities = 47/108 (43%), Positives = 67/108 (62%), Gaps = 6/108 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS-TKLK-----S 466
            +  EY YT KV EKSDVYSFGVVL+EL+ G+KP+  E+G+  DIV W++ T+L+      
Sbjct: 855  IAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPV-GEFGDGVDIVGWINKTELELYQPSD 913

Query: 465  KESILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            K  + ++VD  +        I +  IA++C   +  +RPTMR VV ML
Sbjct: 914  KALVSAVVDPRLTGYPMASVIYMFNIAMMCVKEMGPARPTMREVVHML 961



 Score = 60.5 bits (145), Expect(2) = 6e-27
 Identities = 31/56 (55%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILLD  F+  +ADFGLAK L Y+     +   I G++GYIAP
Sbjct: 803 CSPLIIHRDVKSNNILLDADFEAHVADFGLAKFL-YDPGASQSMSSIAGSYGYIAP 857



>gb:AB092811_1525116 Glycine max NTS1 gene for LRR receptor-like
            kinase, partial cds.
          Length = 1001

 Score = 85.9 bits (211), Expect(2) = 8e-27
 Identities = 48/110 (43%), Positives = 69/110 (62%), Gaps = 6/110 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS-TKLKSKES-- 457
            +  EY YT KV EKSDVYSFGVVL+EL+ G+KP+  E+G+  DIV WV+ T+L+  +   
Sbjct: 879  IAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPV-GEFGDGVDIVGWVNKTRLELAQPSD 937

Query: 456  ---ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
               +L++VD  +        I +  IA++C   +  +RPTMR VV ML +
Sbjct: 938  AALVLAVVDPRLSGYPLTSVIYMFNIAMMCVKEMGPARPTMREVVHMLSE 987



 Score = 57.8 bits (138), Expect(2) = 8e-27
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILLD   +  +ADFGLAK L Y+     +   I G++GYIAP
Sbjct: 827 CSPLIIHRDVKSNNILLDGDLEAHVADFGLAKFL-YDPGASQSMSSIAGSYGYIAP 881



>pir|T50850|T50850 receptor protein kinase homolog [imported] -
            soybean>gb:AY166655_1586208 Glycine max nodule
            autoregulation receptor-like protein kinase precursor
            (NARK) gene, complete cds.>gb:AF197947_1776385 Glycine
            max receptor protein kinase-like protein (CLV1B) mRNA,
            complete cds.
          Length = 987

 Score = 85.9 bits (211), Expect(2) = 8e-27
 Identities = 48/110 (43%), Positives = 69/110 (62%), Gaps = 6/110 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS-TKLKSKES-- 457
            +  EY YT KV EKSDVYSFGVVL+EL+ G+KP+  E+G+  DIV WV+ T+L+  +   
Sbjct: 865  IAPEYAYTLKVDEKSDVYSFGVVLLELIIGRKPV-GEFGDGVDIVGWVNKTRLELAQPSD 923

Query: 456  ---ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
               +L++VD  +        I +  IA++C   +  +RPTMR VV ML +
Sbjct: 924  AALVLAVVDPRLSGYPLTSVIYMFNIAMMCVKEMGPARPTMREVVHMLSE 973



 Score = 57.8 bits (138), Expect(2) = 8e-27
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILLD   +  +ADFGLAK L Y+     +   I G++GYIAP
Sbjct: 813 CSPLIIHRDVKSNNILLDGDLEAHVADFGLAKFL-YDPGASQSMSSIAGSYGYIAP 867



>gb:AB016874_1512940 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K23L20.
          Length = 1236

 Score = 84.0 bits (206), Expect(2) = 1e-26
 Identities = 46/108 (42%), Positives = 67/108 (62%), Gaps = 6/108 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS---KES 457
            +  EY Y+ K  EKSDVYS G+VLME+V+GK P EA + E  D+V WV T L +    E+
Sbjct: 1109 IAPEYAYSLKATEKSDVYSMGIVLMEIVTGKMPTEAMFDEETDMVRWVETVLDTPPGSEA 1168

Query: 456  ILSMVDSAIQE--PFKED-AIKVLRIAILCTAALPNSRPTMRRVVQML 322
               ++DS ++   P +E+ A +VL IA+ CT + P  RP+ R+  + L
Sbjct: 1169 REKLIDSELKSLLPCEEEAAYQVLEIALQCTKSYPQERPSSRQASEYL 1216



 Score = 58.9 bits (141), Expect(2) = 1e-26
 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL--QYNSSCKDTTHVIPGTHGYIAP 729
            C  PI+HRD+KSSN+LLD   +  + DFGLAKIL   Y+++ +  T +  G++GYIAP
Sbjct: 1055 CVPPIVHRDIKSSNVLLDSNIEAHLGDFGLAKILTGNYDTNTESNT-MFAGSYGYIAP 1111



>gb:AB019227_1514079 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MBM17.
          Length = 1102

 Score = 87.0 bits (214), Expect(2) = 1e-26
 Identities = 44/109 (40%), Positives = 71/109 (65%), Gaps = 3/109 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT KV EKSD+YS+GVVL+EL++GK P++    +  D+V+WV + ++       
Sbjct: 975  IAPEYAYTMKVTEKSDIYSYGVVLLELLTGKAPVQ-PIDQGGDVVNWVRSYIRRDALSSG 1033

Query: 447  MVDSAI---QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
            ++D+ +    E      + VL+IA+LCT+  P +RP+MR+VV ML ++E
Sbjct: 1034 VLDARLTLEDERIVSHMLTVLKIALLCTSVSPVARPSMRQVVLMLIESE 1082



 Score = 55.8 bits (133), Expect(2) = 1e-26
 Identities = 27/56 (48%), Positives = 37/56 (66%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I HRD+KS+NILLD+ F+  + DFGLAK++    S   +   I G++GYIAP
Sbjct: 924  CKPRIFHRDIKSNNILLDDKFEAHVGDFGLAKVIDMPHS--KSMSAIAGSYGYIAP 977



>gb:AF049870_1764105 Arabidopsis thaliana beta tubulin 1,
            thaumatin-like protein (TL1), small hydrophobic protein,
            receptor kinase (CLAVATA1), and antifungal protein
            (PDF1.1) genes, complete cds.
          Length = 980

 Score = 87.4 bits (215), Expect(2) = 2e-26
 Identities = 52/122 (42%), Positives = 72/122 (59%), Gaps = 6/122 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS------TKLKS 466
            +  EY YT KV EKSDVYSFGVVL+EL++GKKP+  E+GE  DIV WV       T+   
Sbjct: 861  IAPEYAYTLKVDEKSDVYSFGVVLLELIAGKKPV-GEFGEGVDIVRWVRNTEEEITQPSD 919

Query: 465  KESILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSII 286
               ++++VD  +        I V +IA++C      +RPTMR VV ML    P K V+ +
Sbjct: 920  AAIVVAIVDPRLTGYPLTSVIHVFKIAMMCVEEEAAARPTMREVVHML--TNPPKSVANL 977

Query: 285  VS 280
            ++
Sbjct: 978  IA 979



 Score = 55.1 bits (131), Expect(2) = 2e-26
 Identities = 28/56 (50%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVKS+NILLD  F+  +ADFGLAK L  + +  +    I  ++GYIAP
Sbjct: 809 CSPLILHRDVKSNNILLDSDFEAHVADFGLAKFL-VDGAASECMSSIADSYGYIAP 863



>gb:AP003622_1831610 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0633E08.
          Length = 1072

 Score = 89.7 bits (221), Expect(2) = 8e-26
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 3/109 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGYT K+ EKSDVYS+GVVL+E++SG+  +EA  G++  IV W   K+ S E  ++
Sbjct: 942  IAPEYGYTTKITEKSDVYSYGVVLLEILSGRSAVEAVVGDSLHIVEWAKKKMGSYEPAVN 1001

Query: 447  MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
            ++D  ++   +   ++ ++ L IAI C    P  RPTM+ VV  L++ +
Sbjct: 1002 ILDPKLRGMPDQLVQEMLQTLGIAIFCVNPAPAERPTMKEVVAFLKEVK 1050



 Score = 50.4 bits (119), Expect(2) = 8e-26
 Identities = 26/56 (46%), Positives = 37/56 (66%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRDVK +NILLD  ++  +ADFGLAK++  + +       I G++GYIAP
Sbjct: 890  CVPAILHRDVKCNNILLDTKYEAYLADFGLAKLMN-SPNYHHAMSRIAGSYGYIAP 944



>gb:AC149487_1745022 Solanum demissum chromosome 5 clone PGEC407 map
            MAP_LOC, complete sequence.
          Length = 1250

 Score = 85.5 bits (210), Expect(2) = 1e-25
 Identities = 44/112 (39%), Positives = 69/112 (61%), Gaps = 1/112 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLK-SKESIL 451
            +  EY Y+ K  EKSDVYS G+VLMELV+G+ P +  +GE+ D+V W+ + ++ S+E ++
Sbjct: 1128 IAPEYAYSSKATEKSDVYSMGIVLMELVTGRMPTDGSFGEDIDMVRWIESCIEMSREELI 1187

Query: 450  SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLV 295
              V   +    +  A++VL IA+ CT   P  RP+ R+V  +L  A   K+V
Sbjct: 1188 DPVLKPLLPNEESAALQVLEIALECTKTAPAERPSSRKVCDLLLHAFNDKVV 1239



 Score = 53.9 bits (128), Expect(2) = 1e-25
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKIL--QYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRD+KSSNILLD   +  + DFGLAK +   YNS   ++     G+ GYIAP
Sbjct: 1073 CVPKIIHRDIKSSNILLDSNMEAHLGDFGLAKAVHDNYNSYNTESNLWFAGSFGYIAP 1130



>pir|B84742|B84742 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC002334_1530378 Arabidopsis
            thaliana chromosome 2 clone F25I18 map TEn5, complete
            sequence.
          Length = 1124

 Score = 82.0 bits (201), Expect(2) = 1e-25
 Identities = 48/131 (36%), Positives = 72/131 (54%), Gaps = 5/131 (3%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT KV EK D+YSFGVVL+EL++GK P++    +  D+ +W    ++       
Sbjct: 995  IAPEYAYTMKVTEKCDIYSFGVVLLELLTGKAPVQ-PLEQGGDLATWTRNHIRDHSLTSE 1053

Query: 447  MVDSAI----QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML-EDAEPCKLVSIIV 283
            ++D  +     +      I V +IA+LCT + P+ RPTMR VV ML E  E  +   +IV
Sbjct: 1054 ILDPYLTKVEDDVILNHMITVTKIAVLCTKSSPSDRPTMREVVLMLIESGE--RAGKVIV 1111

Query: 282  SKDAAKLDNPS 250
            S   + L  P+
Sbjct: 1112 STTCSDLPPPA 1122



 Score = 57.4 bits (137), Expect(2) = 1e-25
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRD+KS+NIL+DE F+  + DFGLAK++    S   +   + G++GYIAP
Sbjct: 944  CKPRIIHRDIKSNNILIDENFEAHVGDFGLAKVIDMPLS--KSVSAVAGSYGYIAP 997



>gb:AP003962_1835750 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC
            clone:OJ1705_C03.>gb:AP004397_1841167 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0436B06.
          Length = 977

 Score = 85.9 bits (211), Expect(2) = 2e-25
 Identities = 42/107 (39%), Positives = 72/107 (67%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT ++ EKSDVYSFGVV++EL++GK P   E GE  D+V WV   ++ ++ +  
Sbjct: 858  IAPEYSYTLRITEKSDVYSFGVVMLELLTGKAPAGPELGE-KDLVRWVCGCVE-RDGVDR 915

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
            ++D+ +    +++  + L +A+LC ++LP +RP+MR VV++L +  P
Sbjct: 916  VLDARLAGAPRDETRRALNVALLCASSLPINRPSMRSVVKLLLELRP 962



 Score = 53.1 bits (126), Expect(2) = 2e-25
 Identities = 26/56 (46%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PI+HRDVKS+NILLD   + ++ADFG+A+ +  +++       I G+ GYIAP
Sbjct: 807 CAPPIVHRDVKSNNILLDADLRAKVADFGVARAV--SAAPPTAVSAIAGSCGYIAP 860



>gb:AP006163_1861161 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:B1364A02.
          Length = 1109

 Score = 78.6 bits (192), Expect(2) = 2e-25
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 3/129 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY +T KV EK D+YSFGVVL+ELV+G+ PI+    +  D+V+ V     S  +   
Sbjct: 978  IAPEYAFTMKVTEKCDIYSFGVVLLELVTGQSPIQ-PLEQGGDLVNLVRRMTNSSTTNSE 1036

Query: 447  MVDSAI---QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK 277
            + DS +        E+   VL+IA+ CT+  P  RP+MR V+ ML DA      S     
Sbjct: 1037 IFDSRLNLNSRRVLEEISLVLKIALFCTSESPLDRPSMREVISMLMDARASAYDSFSSPA 1096

Query: 276  DAAKLDNPS 250
              A +++ S
Sbjct: 1097 SEAPIEDDS 1105



 Score = 60.1 bits (144), Expect(2) = 2e-25
 Identities = 28/56 (50%), Positives = 39/56 (69%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   +IHRD+KS+NILLDE  +  + DFGLAK++  ++S   T   I G++GYIAP
Sbjct: 927  CKPKVIHRDIKSNNILLDEMMEAHVGDFGLAKLIDISNS--RTMSAIAGSYGYIAP 980



>gb:AP003282_1827213 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0583G08.
          Length = 1117

 Score = 90.1 bits (222), Expect(2) = 3e-25
 Identities = 43/105 (40%), Positives = 65/105 (61%), Gaps = 3/105 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYG   K+  KSDVYSFGVVL+E+++G++PIEA +GE   +V WV   L  K     
Sbjct: 958  IAPEYGCMTKITTKSDVYSFGVVLLEIITGRRPIEAAFGEGQTVVQWVREHLHRKRDPAE 1017

Query: 447  MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            ++DS +Q   +   ++ ++ L IA+LC +  P  RPTM+ V  +L
Sbjct: 1018 VIDSRLQGRSDTQVQEMLQALGIALLCASTRPEDRPTMKDVAALL 1062



 Score = 48.1 bits (113), Expect(2) = 3e-25
 Identities = 24/52 (46%), Positives = 34/52 (65%)
 Frame = -1

Query: 884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            I+HRDVKS NILL E ++  +ADFGLA++   +     +     G++GYIAP
Sbjct: 911  ILHRDVKSDNILLGERYEACLADFGLARVA--DDGANSSPPPFAGSYGYIAP 960



>gb:AP005394_1851029 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0620H05.
          Length = 1019

 Score = 74.7 bits (182), Expect(2) = 3e-25
 Identities = 41/104 (39%), Positives = 62/104 (59%), Gaps = 2/104 (1%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYG   KV EK DVY+FGVVL+EL +G+  +  + G +  +  W   + K+   +  
Sbjct: 856  MAPEYGCRAKVNEKVDVYAFGVVLLELTTGR--VANDGGADWCLAEWAWRRYKAGGELHD 913

Query: 447  MVDSAIQE--PFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            +VD AIQ+   F EDA+ V  + ++CT   P SRPTM+ V++ L
Sbjct: 914  VVDEAIQDRAAFLEDAVAVFLLGMICTGDDPASRPTMKEVLEQL 957



 Score = 63.5 bits (153), Expect(2) = 3e-25
 Identities = 33/56 (58%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C +PI+HRDVKSSNILLD  F+ +IADFGLA+IL   S   ++   I GT GY+AP
Sbjct: 804 CAQPIMHRDVKSSNILLDPAFRAKIADFGLARILA-KSGEPNSISAIGGTFGYMAP 858



>gb:AP005394_1851023 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0620H05.
          Length = 1004

 Score = 77.0 bits (188), Expect(2) = 3e-25
 Identities = 43/129 (33%), Positives = 68/129 (52%), Gaps = 2/129 (1%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY Y  KV  K DVYSFGVVL+EL +G+ P +      + +  W S +  +   +  
Sbjct: 873  IAPEYAYRSKVSVKVDVYSFGVVLLELATGRGPQDGGTESGSCLAKWASKRYNNGGPVAD 932

Query: 447  MVDSAIQEP-FKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSI-IVSKD 274
            +VD  IQ+P + +D + V  + ++CT+  P SRP M  V+  L   +     S  +V+K 
Sbjct: 933  LVDGEIQDPSYLDDMVAVFELGVVCTSEEPASRPPMSDVLHRLMQFDHSGTHSDGVVAKG 992

Query: 273  AAKLDNPSD 247
               +D+ SD
Sbjct: 993  VFDIDDSSD 1001



 Score = 61.2 bits (147), Expect(2) = 3e-25
 Identities = 31/54 (57%), Positives = 39/54 (72%)
 Frame = -1

Query: 890 RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +P+IHRDVK SNILLD  F+ +IADFGLA+IL   S   ++   + GT GYIAP
Sbjct: 823 QPVIHRDVKCSNILLDREFRAKIADFGLARILA-KSGESESASAVCGTFGYIAP 875



>pir|T05322|T05322 hypothetical protein F18F4.240 - Arabidopsis
            thaliana>gb:ATCHRIV52_1545852 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 52.>gb:ATF1C12_1549334
            Arabidopsis thaliana DNA chromosome 4, BAC clone F1C12
            (ESSA project).
          Length = 1232

 Score = 82.4 bits (202), Expect(2) = 5e-25
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 4/106 (3%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESIL- 451
            +  EY Y+ K  EKSDVYS G+VLME+V+GK P ++ +G   D+V WV T L+   S   
Sbjct: 1113 IAPEYAYSLKATEKSDVYSMGIVLMEIVTGKMPTDSVFGAEMDMVRWVETHLEVAGSARD 1172

Query: 450  SMVDSAIQE--PFKED-AIKVLRIAILCTAALPNSRPTMRRVVQML 322
             ++D  ++   PF+ED A +VL IA+ CT   P  RP+ R+    L
Sbjct: 1173 KLIDPKLKPLLPFEEDAACQVLEIALQCTKTSPQERPSSRQACDSL 1218



 Score = 55.1 bits (131), Expect(2) = 5e-25
 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 1/57 (1%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCK-DTTHVIPGTHGYIAP 729
            C  PI+HRD+KSSN+LLD   +  + DFGLAK+L  N     D+      ++GYIAP
Sbjct: 1059 CVPPIVHRDIKSSNVLLDSNMEAHLGDFGLAKVLTENCDTNTDSNTWFACSYGYIAP 1115



>gb:ATH550162_1552878 Arabidopsis thaliana mRNA for LRR receptor-like
            kinase 1 (rch1 gene).
          Length = 1135

 Score = 80.5 bits (197), Expect(2) = 5e-25
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 3/107 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGY+ K+ EKSDVYS+GVV++E+++GK+PI+    +   IV WV      K   + 
Sbjct: 964  IAPEYGYSMKITEKSDVYSYGVVVLEVLTGKQPIDPTIPDGLHIVDWV-----KKIRDIQ 1018

Query: 447  MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            ++D  +Q   E   E+ ++ L +A+LC   +P  RPTM+ V  ML +
Sbjct: 1019 VIDQGLQARPESEVEEMMQTLGVALLCINPIPEDRPTMKDVAAMLSE 1065



 Score = 57.0 bits (136), Expect(2) = 5e-25
 Identities = 26/56 (46%), Positives = 40/56 (71%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C  PI+HRD+K++NIL+   F+P I DFGLAK++      + +++ I G++GYIAP
Sbjct: 912  CVPPIVHRDIKANNILIGPDFEPYIGDFGLAKLVDDGDFAR-SSNTIAGSYGYIAP 966



>gb:ATH550163_1552879 Arabidopsis thaliana mRNA for LRR receptor-like
            kinase 2 (rch2 gene).
          Length = 1120

 Score = 81.6 bits (200), Expect(2) = 5e-25
 Identities = 41/107 (38%), Positives = 68/107 (63%), Gaps = 3/107 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGY+ K+ EKSDVYS+GVV++E+++GK+PI+    E   +V WV    +     L 
Sbjct: 963  IAPEYGYSMKITEKSDVYSYGVVVLEVLTGKQPIDPTVPEGIHLVDWV----RQNRGSLE 1018

Query: 447  MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            ++DS ++   E   ++ ++VL  A+LC  + P+ RPTM+ V  ML++
Sbjct: 1019 VLDSTLRSRTEAEADEMMQVLGTALLCVNSSPDERPTMKDVAAMLKE 1065



 Score = 55.8 bits (133), Expect(2) = 5e-25
 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYN--SSCKDTTHVIPGTHGYIAP 729
            C  PI+HRD+K++NIL+   F+P IADFGLAK++       C +T   + G++GYIAP
Sbjct: 911  CLPPIVHRDIKANNILIGLDFEPYIADFGLAKLVDEGDIGRCSNT---VAGSYGYIAP 965



>gb:PSY250467_1702600 Pinus sylvestris mRNA for receptor protein
            kinase (upk gene).
          Length = 1145

 Score = 79.0 bits (193), Expect(2) = 1e-24
 Identities = 40/109 (36%), Positives = 67/109 (61%), Gaps = 5/109 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKE--SI 454
            +  EYGYT K+ +K DVYSFGVVL+E+V+GK+PI+    E   +V W    ++S +    
Sbjct: 970  IAPEYGYTMKITQKIDVYSFGVVLLEVVTGKQPIDPTIPEGVHLVEWARDAVQSNKLADS 1029

Query: 453  LSMVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
              ++D  +Q   +   ++ ++VL +A LC  + P+ RPTM+ V  +L++
Sbjct: 1030 AEVIDPRLQGRPDTQIQEMLQVLGVAFLCVNSNPDERPTMKDVAALLKE 1078



 Score = 57.4 bits (137), Expect(2) = 1e-24
 Identities = 27/56 (48%), Positives = 40/56 (71%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C  PI+HRDVK++NILL   ++P +ADFGLAK++      + +T  + G++GYIAP
Sbjct: 918  CRPPILHRDVKANNILLGSQYEPYLADFGLAKLVDSADFNRSST-TVAGSYGYIAP 972



>gb:AP003758_1833017 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1562_B11.
          Length = 671

 Score = 79.0 bits (193), Expect(2) = 1e-24
 Identities = 42/105 (40%), Positives = 68/105 (64%), Gaps = 2/105 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPI-EAEYGENNDIVSWVSTKLKSKESIL 451
           L  E G+T K    +DV++FG  L+E+  G++PI + E+G    +V WV T+  SK +++
Sbjct: 520 LAPELGHTGKATPSTDVFAFGAFLLEVTCGRRPIVQDEHGNRAVLVDWV-TEQWSKGALV 578

Query: 450 SMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           ++VD+ I   F  D +  VL++ +LC+  LPN+RPTMR+V Q L+
Sbjct: 579 NVVDARIPSCFDPDEVSLVLKLGLLCSHPLPNARPTMRQVAQYLD 623



 Score = 57.4 bits (137), Expect(2) = 1e-24
 Identities = 28/56 (50%), Positives = 40/56 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           +IHRDVK+SN+LLD+    R+ DFGLA++  + +  + TTHV+ GT GY+AP   H
Sbjct: 473 VIHRDVKASNVLLDDEMNGRLGDFGLARLYDHGAVAQ-TTHVV-GTMGYLAPELGH 526



>gb:AP004564_1841660 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0479C12.>gb:AP004665_1842911 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0429B05.
          Length = 1112

 Score = 73.6 bits (179), Expect(2) = 2e-24
 Identities = 44/136 (32%), Positives = 69/136 (50%), Gaps = 5/136 (3%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  E  ++ +   +SDVYS+GV+L+EL++ K+ ++  + +N DIV WV+  L   + I  
Sbjct: 984  MAPELAFSTRSSIESDVYSYGVILLELLTKKQVVDPSFPDNMDIVGWVTATLNGTDQIEL 1043

Query: 447  MVDSAIQEPFK-----EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV 283
            + DS + E        E+  KVL +A+ C A   + RP M  VV+ L D          V
Sbjct: 1044 VCDSTLMEEVYGTVEIEEVSKVLSLALRCAAKEASRRPPMADVVKELTD----------V 1093

Query: 282  SKDAAKLDNPSDNTSK 235
             K A KL  P    S+
Sbjct: 1094 RKSAGKLSKPEKTASR 1109



 Score = 62.4 bits (150), Expect(2) = 2e-24
 Identities = 32/56 (57%), Positives = 39/56 (69%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRD+K SNILL+    P IADFG+AK++  +SS   TT VI GT GY+AP
Sbjct: 932  CQPAIIHRDIKPSNILLNGDMVPHIADFGIAKLMDQSSSAPQTTGVI-GTFGYMAP 986



>pir|E86312|E86312 F11A6.9 protein - Arabidopsis
            thaliana>gb:AE005172_890741 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC034257_1539927 Arabidopsis thaliana
            chromosome I BAC F11A6 genomic sequence, complete
            sequence.
          Length = 1088

 Score = 77.4 bits (189), Expect(2) = 2e-24
 Identities = 44/115 (38%), Positives = 66/115 (57%), Gaps = 9/115 (7%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES--- 457
            +  E  Y     ++SDVYS+GVVL+ELV+GK+ ++  + E+ +IVSWV + L S E    
Sbjct: 963  IAPENAYKTVRSKESDVYSYGVVLLELVTGKRALDRSFPEDINIVSWVRSVLSSYEDEDD 1022

Query: 456  ------ILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
                     +VD  +    +E AI+V  +A+ CT   P +RP+MR VV+ L D E
Sbjct: 1023 TAGPIVDPKLVDELLDTKLREQAIQVTDLALRCTDKRPENRPSMRDVVKDLTDLE 1077



 Score = 58.5 bits (140), Expect(2) = 2e-24
 Identities = 29/56 (51%), Positives = 37/56 (66%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C  PIIHRD+K  NIL+D   +P I DFGLA+IL  ++    +T  + GT GYIAP
Sbjct: 913  CHPPIIHRDIKPENILMDSDMEPHIGDFGLARILDDSTV---STATVTGTTGYIAP 965



>gb:AK118356_1816339 Arabidopsis thaliana At5g62710 mRNA for
           putative receptor like protein kinase, complete cds,
           clone: RAFL19-62-H10.
          Length = 604

 Score = 73.9 bits (180), Expect(2) = 3e-24
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 1/104 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN-DIVSWVSTKLKSKESIL 451
           L  EY    +  EKSDVYSFGV+L+ELV+GK+P +  + +   ++V W++T LK +  + 
Sbjct: 481 LAPEYLQNGRATEKSDVYSFGVLLLELVTGKRPTDPIFVKRGLNVVGWMNTVLK-ENRLE 539

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            ++D    +  +E    +L IA  CT A P +RP M +V Q+LE
Sbjct: 540 DVIDKRCTDVDEESVEALLEIAERCTDANPENRPAMNQVAQLLE 583



 Score = 61.2 bits (147), Expect(2) = 3e-24
 Identities = 29/56 (51%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRD+KSSNILL++  +PR++DFGLAK+L    +    T V+ GT GY+AP
Sbjct: 430 CSPKIVHRDIKSSNILLNDKLEPRVSDFGLAKLLVDEDA--HVTTVVAGTFGYLAP 483



>gb:AB009053_1510681 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQB2.
          Length = 580

 Score = 73.9 bits (180), Expect(2) = 3e-24
 Identities = 41/104 (39%), Positives = 63/104 (60%), Gaps = 1/104 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN-DIVSWVSTKLKSKESIL 451
           L  EY    +  EKSDVYSFGV+L+ELV+GK+P +  + +   ++V W++T LK +  + 
Sbjct: 457 LAPEYLQNGRATEKSDVYSFGVLLLELVTGKRPTDPIFVKRGLNVVGWMNTVLK-ENRLE 515

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            ++D    +  +E    +L IA  CT A P +RP M +V Q+LE
Sbjct: 516 DVIDKRCTDVDEESVEALLEIAERCTDANPENRPAMNQVAQLLE 559



 Score = 61.2 bits (147), Expect(2) = 3e-24
 Identities = 29/56 (51%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRD+KSSNILL++  +PR++DFGLAK+L    +    T V+ GT GY+AP
Sbjct: 406 CSPKIVHRDIKSSNILLNDKLEPRVSDFGLAKLLVDEDA--HVTTVVAGTFGYLAP 459



>gb:AP005826_1858573 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0758B01.
          Length = 997

 Score = 73.6 bits (179), Expect(2) = 3e-24
 Identities = 37/103 (35%), Positives = 64/103 (62%), Gaps = 1/103 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYG+  KV EK DVYSFGVVL+E+++G+  +  + GE   +  W   + +     + 
Sbjct: 870  MAPEYGHRLKVNEKIDVYSFGVVLLEIITGR--VANDGGEYYCLAQWAWRQYQEYGLSVD 927

Query: 447  MVDSAIQEP-FKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            ++D  I++P   EDA++V  +A++CT   P+ RP+M+ V+ +L
Sbjct: 928  LLDEGIRDPTHVEDALEVFTLAVICTGEHPSMRPSMKDVLNIL 970



 Score = 61.2 bits (147), Expect(2) = 3e-24
 Identities = 31/60 (51%), Positives = 40/60 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           C  PI+HRDVK +NILLD  F+ ++ADFGLAKIL   +   ++   I GT GY+AP   H
Sbjct: 818 CSPPIVHRDVKCANILLDHNFRAKMADFGLAKIL-LKAGDDESFSAIAGTFGYMAPEYGH 876



>gb:AP005826_1858575 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0758B01.
          Length = 993

 Score = 73.6 bits (179), Expect(2) = 3e-24
 Identities = 37/103 (35%), Positives = 64/103 (62%), Gaps = 1/103 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYG+  KV EK DVYSFGVVL+E+++G+  +  + GE   +  W   + +     + 
Sbjct: 868  MAPEYGHRLKVNEKIDVYSFGVVLLEIITGR--VANDGGEYYCLAQWAWRQYQEYGLSVD 925

Query: 447  MVDSAIQEP-FKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            ++D  I++P   EDA++V  +A++CT   P+ RP+M+ V+ +L
Sbjct: 926  LLDEGIRDPTHVEDALEVFTLAVICTGEHPSMRPSMKDVLHVL 968



 Score = 61.2 bits (147), Expect(2) = 3e-24
 Identities = 31/60 (51%), Positives = 40/60 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           C  PI+HRDVK +NILLD  F+ ++ADFGLAKIL   +   ++   I GT GY+AP   H
Sbjct: 816 CSPPIVHRDVKCANILLDHNFRAKMADFGLAKIL-LKAGDDESFSAIAGTFGYMAPEYGH 874



>pir|H84770|H84770 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006068_1533368 Arabidopsis
           thaliana chromosome 2 clone T20F21 map ve016, complete
           sequence.
          Length = 567

 Score = 74.3 bits (181), Expect(2) = 3e-24
 Identities = 44/111 (39%), Positives = 67/111 (60%), Gaps = 3/111 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN-DIVSWVSTKLKSKESIL 451
           L  EY  + +  EK+DVYSFGV+++E++SGK P +A + E   +IV W++  L S+    
Sbjct: 448 LAPEYMQSGRATEKTDVYSFGVLVLEVLSGKLPTDASFIEKGFNIVGWLNF-LISENRAK 506

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED--AEPC 304
            +VD + +   +E    +L IA  C ++ P+ RPTM RVVQ+LE     PC
Sbjct: 507 EIVDLSCEGVERESLDALLSIATKCVSSSPDERPTMHRVVQLLESEVMTPC 557



 Score = 60.5 bits (145), Expect(2) = 3e-24
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRD+KSSNILLD   + R++DFGLAK+L+   S    T ++ GT GY+AP
Sbjct: 397 CSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEES--HITTIVAGTFGYLAP 450



>gb:AB182388_1529231 Oryza sativa (japonica cultivar-group) FON1 mRNA
            for CLV1-like LRR receptor kinase, complete
            cds.>gb:AB182389_1529232 Oryza sativa (japonica
            cultivar-group) FON1 gene for CLV1-like LRR receptor
            kinase, complete cds.>gb:AC091774_1735045 Oryza sativa
            chromosome 6 BAC OJ1540_H01 genomic sequence, complete
            sequence.>gb:AP003614_1831419 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0481E08.>gb:AP003769_1833292 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0541C02.
          Length = 994

 Score = 75.9 bits (185), Expect(2) = 4e-24
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSW---VSTKLKSKE- 460
            +  EY YT +V EKSDVYSFGVVL+EL++G++P+   +G+  DIV W   V+ +L     
Sbjct: 871  IAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPV-GGFGDGVDIVHWVRKVTAELPDNSD 929

Query: 459  --SILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
              ++L++ D  +        + + ++A+ C      +RPTMR VV ML +
Sbjct: 930  TAAVLAVADRRLTPEPVALMVNLYKVAMACVEEASTARPTMREVVHMLSN 979



 Score = 58.5 bits (140), Expect(2) = 4e-24
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILLD  F+  +ADFGLAK L    +  +    I G++GYIAP
Sbjct: 820 CAPRIIHRDVKSNNILLDSAFEAHVADFGLAKFL--GGATSECMSAIAGSYGYIAP 873



>gb:BT004058_1637167 Arabidopsis thaliana clone RAFL15-09-P09 (R20481)
            putative receptor protein kinase (At5g25930) mRNA,
            complete cds.>gb:T1N24_1723664 Arabidopsis thaliana BAC
            T1N24.
          Length = 1005

 Score = 71.2 bits (173), Expect(2) = 6e-24
 Identities = 38/103 (36%), Positives = 61/103 (59%), Gaps = 1/103 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT KV EK DVYSFGVVL+ELV+G++    +  E+ ++  W     +S +    
Sbjct: 864  IAPEYAYTSKVDEKIDVYSFGVVLLELVTGREGNNGD--EHTNLADWSWKHYQSGKPTAE 921

Query: 447  MVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQML 322
              D  I+E    +A+  V ++ ++CT  LP+ RP+M+ V+ +L
Sbjct: 922  AFDEDIKEASTTEAMTTVFKLGLMCTNTLPSHRPSMKEVLYVL 964



 Score = 62.8 bits (151), Expect(2) = 6e-24
 Identities = 32/56 (57%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKSSNILLD  F  +IADFGLAK+L   +    T   + G+ GYIAP
Sbjct: 811 CTPAIIHRDVKSSNILLDSEFNAKIADFGLAKLLIKQNQEPHTMSAVAGSFGYIAP 866



>pir|T03784|T03784 probable receptor protein kinase -
            rice>gb:OSLRK2GEN_1698264 O.sativa DNA for LRK2 gene.
          Length = 990

 Score = 75.9 bits (185), Expect(2) = 6e-24
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSW---VSTKLKSKE- 460
            +  EY YT +V EKSDVYSFGVVL+EL++G++P+   +G+  DIV W   V+ +L     
Sbjct: 867  IAPEYAYTLRVDEKSDVYSFGVVLLELITGRRPV-GGFGDGVDIVHWVRKVTAELPDNSD 925

Query: 459  --SILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
              ++L++ D  +        + + ++A+ C      +RPTMR VV ML +
Sbjct: 926  TAAVLAVADRRLTPEPVALMVNLYKVAMACVEEASTARPTMREVVHMLSN 975



 Score = 58.2 bits (139), Expect(2) = 6e-24
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKS+NILLD  F+  +ADFGLAK L    +  +    I G++GYIAP
Sbjct: 816 CAPRIIHRDVKSNNILLDSAFEGHVADFGLAKFL--GGATSECMSAIAGSYGYIAP 869



>gb:OSJN00189_1696455 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0095H06, complete sequence.
          Length = 1135

 Score = 80.1 bits (196), Expect(2) = 7e-24
 Identities = 42/129 (32%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGY  K+ EKSDVYS+GVV++E+++GK+PI+    +   +V WV  + K    +L 
Sbjct: 969  IAPEYGYMMKITEKSDVYSYGVVVLEVLTGKQPIDPTIPDGQHVVDWVRRR-KGAADVLD 1027

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE----DAEPCKLVSIIVS 280
                   +   ++ ++V+ +A+LC A  P+ RP M+ V  ML     D +    V +++ 
Sbjct: 1028 PALRGRSDAEVDEMLQVMGVALLCVAPSPDDRPAMKDVAAMLNEIRLDRDDYANVDLLLK 1087

Query: 279  KDAAKLDNP 253
              AA    P
Sbjct: 1088 SGAAAASPP 1096



 Score = 53.5 bits (127), Expect(2) = 7e-24
 Identities = 25/56 (44%), Positives = 40/56 (71%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C  PI+HRD+K++NIL+   F+  IADFGLAK++  +     +++ + G++GYIAP
Sbjct: 917  CVPPIVHRDIKANNILIGLDFEAYIADFGLAKLVD-DGDFGRSSNTVAGSYGYIAP 971



>gb:AY056243_1563564 Arabidopsis thaliana unknown protein
           (At2g13780) mRNA, complete cds.
          Length = 620

 Score = 68.2 bits (165), Expect(2) = 8e-24
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 464 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 522

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 523 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 569



 Score = 65.5 bits (158), Expect(2) = 8e-24
 Identities = 32/56 (57%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIHRDVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 413 CDQKIIHRDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 466



>gb:CQ768567_1451801 Sequence 62 from Patent WO2004007712.
          Length = 615

 Score = 68.2 bits (165), Expect(2) = 8e-24
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 459 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 517

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 518 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 564



 Score = 65.5 bits (158), Expect(2) = 8e-24
 Identities = 32/56 (57%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIHRDVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 408 CDQKIIHRDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 461



>gb:AX120071_1461715 Sequence 54 from Patent WO0129240.
          Length = 596

 Score = 68.2 bits (165), Expect(2) = 8e-24
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 440 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 498

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 499 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 545



 Score = 65.5 bits (158), Expect(2) = 8e-24
 Identities = 32/56 (57%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIHRDVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 389 CDQKIIHRDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 442



>pir|G84510|G84510 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006436_1534245 Arabidopsis
           thaliana chromosome 2 clone F13J11 map mi398, complete
           sequence.
          Length = 520

 Score = 68.2 bits (165), Expect(2) = 8e-24
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 364 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 422

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 423 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 469



 Score = 65.5 bits (158), Expect(2) = 8e-24
 Identities = 32/56 (57%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIHRDVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 313 CDQKIIHRDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 366



>gb:AE016959_1021015 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC091724_1734924 Oryza sativa
            chromosome 10 clone OSJNBa0004E08, complete
            sequence.>gb:AE017058_1750834 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 12 of 77 of the
            complete sequence.
          Length = 1155

 Score = 76.6 bits (187), Expect(2) = 1e-23
 Identities = 40/107 (37%), Positives = 65/107 (60%), Gaps = 5/107 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKE--SI 454
            +  E+GY+ ++ EKSDVYS+GVVL+EL+  K P++  +G+  DIV+W+ + L   +  +I
Sbjct: 1033 IAPEHGYSTRLSEKSDVYSYGVVLLELLCRKMPVDPAFGDGVDIVTWMGSNLNQADHSNI 1092

Query: 453  LSMVDSAI---QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            +  +D  I    E  K   + +L +A+ CT      RP+MR VV +L
Sbjct: 1093 MRFLDEEIIYWPEHEKAKVLDLLDLAMTCTQVSCQLRPSMREVVSIL 1139



 Score = 56.6 bits (135), Expect(2) = 1e-23
 Identities = 29/56 (51%), Positives = 36/56 (64%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRDVKSSNIL+D    P++ DFG+ KI+  +     T  V+ GT GYIAP
Sbjct: 981  CVPMIIHRDVKSSNILMDAELVPKLTDFGMGKIID-DDDADATVSVVVGTLGYIAP 1035



>gb:OSJN00095_1694822 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0004A17, complete sequence.
          Length = 1012

 Score = 74.3 bits (181), Expect(2) = 1e-23
 Identities = 39/102 (38%), Positives = 64/102 (62%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
            EYG +     K DVYSFG+VL+EL++G++P++      + D+VSWV  ++K ++    + 
Sbjct: 907  EYGQSPVATYKGDVYSFGIVLLELLTGRRPVDMCRPKGSRDVVSWV-LQMKKEDRETEVF 965

Query: 441  DSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            D  I +   E   I++L IA+LC  A P SRPT +++V+ L+
Sbjct: 966  DPTIYDKENESQLIRILEIALLCVTAAPKSRPTSQQLVEWLD 1007



 Score = 58.9 bits (141), Expect(2) = 1e-23
 Identities = 31/59 (52%), Positives = 40/59 (67%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
            C+  I+HRD+KSSNILLDE F+  +ADFGLA+++     C   THV   + GT GYI P
Sbjct: 853  CEPHILHRDIKSSNILLDENFEAHLADFGLARLI-----CAYETHVTTDVVGTLGYIPP 906



>gb:AP002865_1823339 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0034C11.>gb:AP003074_1824596 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0004G10.
          Length = 346

 Score = 74.3 bits (181), Expect(2) = 1e-23
 Identities = 42/108 (38%), Positives = 65/108 (60%), Gaps = 2/108 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND-IVSWVSTKLKSKESIL 451
           L  EY  T +   K DVYS+GVVL+EL++G +P +  + EN   +V+WV   ++ K    
Sbjct: 236 LAPEYFETGRATTKGDVYSYGVVLLELLTGMRPTDESFLENGTRLVTWVKETMEEKRE-E 294

Query: 450 SMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             VDSA++  F  + +K V ++A  C  + P +RPTM  VV++LE A+
Sbjct: 295 HAVDSALESSFPAEEVKLVFKVADKCLESEPCNRPTMAEVVKLLEQAK 342



 Score = 58.9 bits (141), Expect(2) = 1e-23
 Identities = 29/56 (51%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   +IHRD+KSSNILLD   + R++DFGLA +++ N S    T V+ GT GY+AP
Sbjct: 185 CIPHVIHRDIKSSNILLDHNMEARVSDFGLATLMKPNHS--HVTTVVAGTFGYLAP 238



>gb:AC007789_1536200 Oryza sativa BAC OSJNBa0049B20 genomic
           sequence, complete sequence.
          Length = 303

 Score = 74.3 bits (181), Expect(2) = 1e-23
 Identities = 42/108 (38%), Positives = 65/108 (60%), Gaps = 2/108 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND-IVSWVSTKLKSKESIL 451
           L  EY  T +   K DVYS+GVVL+EL++G +P +  + EN   +V+WV   ++ K    
Sbjct: 193 LAPEYFETGRATTKGDVYSYGVVLLELLTGMRPTDESFLENGTRLVTWVKETMEEKRE-E 251

Query: 450 SMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             VDSA++  F  + +K V ++A  C  + P +RPTM  VV++LE A+
Sbjct: 252 HAVDSALESSFPAEEVKLVFKVADKCLESEPCNRPTMAEVVKLLEQAK 299



 Score = 58.9 bits (141), Expect(2) = 1e-23
 Identities = 29/56 (51%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   +IHRD+KSSNILLD   + R++DFGLA +++ N S    T V+ GT GY+AP
Sbjct: 142 CIPHVIHRDIKSSNILLDHNMEARVSDFGLATLMKPNHS--HVTTVVAGTFGYLAP 195



>gb:AF384970_1794545 Arabidopsis thaliana somatic embryogenesis
           receptor-like kinase 3 (SERK3) mRNA, complete cds.
          Length = 615

 Score = 71.2 bits (173), Expect(2) = 2e-23
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 459 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 517

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + ++VD  +Q  +K++ + +++++A+LCT + P  RP M  VV+MLE
Sbjct: 518 LEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 564



 Score = 61.2 bits (147), Expect(2) = 2e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 408 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 461



>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated
           receptor kinase 1 precursor (EC 2.7.1.37)
           (BRI1-associated receptor kinase 1) (Somatic
           embryogenesis receptor-like kinase
           3).>gb:CQ768561_1451798 Sequence 56 from Patent
           WO2004007712.
          Length = 615

 Score = 71.2 bits (173), Expect(2) = 2e-23
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 459 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 517

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + ++VD  +Q  +K++ + +++++A+LCT + P  RP M  VV+MLE
Sbjct: 518 LEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 564



 Score = 61.2 bits (147), Expect(2) = 2e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 408 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 461



>pir|B86440|B86440 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AE005172_892007 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC027135_1539879 Arabidopsis thaliana
           chromosome 1 BAC T8E3 genomic sequence, complete
           sequence.
          Length = 590

 Score = 72.0 bits (175), Expect(2) = 2e-23
 Identities = 42/111 (37%), Positives = 62/111 (55%), Gaps = 3/111 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN-DIVSWVSTKLKSKESIL 451
           L  EY  + +  EK+DVYSFGV+++E++SGK+P +A + E   ++V W+   +  K    
Sbjct: 471 LAPEYMQSGRATEKTDVYSFGVLVLEVLSGKRPTDASFIEKGLNVVGWLKFLISEKRP-R 529

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED--AEPC 304
            +VD   +    E    +L IA  C +  P  RPTM RVVQ+LE     PC
Sbjct: 530 DIVDPNCEGMQMESLDALLSIATQCVSPSPEERPTMHRVVQLLESEVMTPC 580



 Score = 60.5 bits (145), Expect(2) = 2e-23
 Identities = 30/56 (53%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRD+KSSNILLD   + R++DFGLAK+L+   S    T ++ GT GY+AP
Sbjct: 420 CSPRIIHRDIKSSNILLDGNLEARVSDFGLAKLLEDEES--HITTIVAGTFGYLAP 473



>gb:AX120065_1461712 Sequence 48 from Patent WO0129240.
          Length = 591

 Score = 71.2 bits (173), Expect(2) = 2e-23
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 435 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 493

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + ++VD  +Q  +K++ + +++++A+LCT + P  RP M  VV+MLE
Sbjct: 494 LEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 540



 Score = 61.2 bits (147), Expect(2) = 2e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 384 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 437



>pir|T05994|T05994 protein kinase homolog F17M5.190 - Arabidopsis
           thaliana>gb:ATCHRIV79_1547263 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 79.>gb:ATF17M5_1549022
           Arabidopsis thaliana DNA chromosome 4, BAC clone F17M5
           (ESSA project).
          Length = 523

 Score = 71.2 bits (173), Expect(2) = 2e-23
 Identities = 38/107 (35%), Positives = 69/107 (64%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 367 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 425

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + ++VD  +Q  +K++ + +++++A+LCT + P  RP M  VV+MLE
Sbjct: 426 LEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 472



 Score = 61.2 bits (147), Expect(2) = 2e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 316 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 369



>gb:AE016959_1021016 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC091724_1734925 Oryza sativa
            chromosome 10 clone OSJNBa0004E08, complete
            sequence.>gb:AE017058_1750835 Oryza sativa (japonica
            cultivar-group) chromosome 10, section 12 of 77 of the
            complete sequence.
          Length = 1130

 Score = 75.9 bits (185), Expect(2) = 2e-23
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 5/107 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKL--KSKESI 454
            +  E+GY  ++ EKSDVYS+GVVL+EL+  K P++  +G++ DIV+W+ + L    +  I
Sbjct: 1019 IAPEHGYYTRLTEKSDVYSYGVVLLELLCRKMPVDPAFGDSVDIVTWMRSNLTQADRRVI 1078

Query: 453  LSMVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            +  +D  I    E  +  A+ +L +A+ CT     SRP+MR VV  L
Sbjct: 1079 MECLDEEIMYWPEDEQAKALDLLDLAMYCTQLACQSRPSMREVVNNL 1125



 Score = 56.2 bits (134), Expect(2) = 2e-23
 Identities = 28/56 (50%), Positives = 37/56 (66%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRDVKSSNIL+D    P++ DFG+ KI++ +     T  V+ GT GYIAP
Sbjct: 967  CVPMIVHRDVKSSNILMDTELVPKLTDFGMGKIVE-DDDLDATVSVVVGTLGYIAP 1021



>gb:AP004752_1844402 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0501G04.
          Length = 1040

 Score =  111 bits (277), Expect = 2e-23
 Identities = 70/185 (37%), Positives = 102/185 (55%), Gaps = 11/185 (5%)
 Frame = -3

Query: 771  HHSCHSRNSWIHRSRYKTFQVLL*ALSKFMQLFY*ASMHA*RLS*PIKLVA--------E 616
            HH CH     IHR   K+  +LL A  +     +  +    R    + +VA        E
Sbjct: 835  HHDCHP--PVIHRD-IKSNNILLDANMEARIADFGLARALGRAGESVSVVAGSYGYIAPE 891

Query: 615  YGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS---KESILSM 445
            YGYT KV +KSD YS+GVVLMEL++G++ +EA +GE  DIV WV  K++S   ++ +   
Sbjct: 892  YGYTMKVDQKSDTYSYGVVLMELITGRRAVEAAFGEGQDIVGWVRNKIRSNTVEDHLDGQ 951

Query: 444  VDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK 265
            +  A     +E+ + VLRIA+LCTA LP  RP+MR V+ ML +A+P +         +AK
Sbjct: 952  LVGAGCPHVREEMLLVLRIAVLCTARLPRDRPSMRDVITMLGEAKPRRKSGSSTGSASAK 1011

Query: 264  LDNPS 250
               P+
Sbjct: 1012 APTPA 1016



 Score = 60.1 bits (144), Expect = 6e-08
 Identities = 29/56 (51%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  P+IHRD+KS+NILLD   + RIADFGLA+ L       ++  V+ G++GYIAP
Sbjct: 838 CHPPVIHRDIKSNNILLDANMEARIADFGLARAL---GRAGESVSVVAGSYGYIAP 890



>pir|A96574|A96574 protein F12M16.30 [imported] - Arabidopsis
            thaliana>gb:AE005173_893243 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC008007_1536424 Genomic sequence for
            Arabidopsis thaliana BAC F12M16 from chromosome I,
            complete sequence.
          Length = 854

 Score = 75.9 bits (185), Expect(2) = 2e-23
 Identities = 45/130 (34%), Positives = 78/130 (60%), Gaps = 6/130 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND--IVSWVSTKLKSKESI 454
            +  EY     + +K+DVYSFG+V +E+V G+   + E  +NN   ++ WV   L+ K ++
Sbjct: 694  MAPEYAMRGHLTDKADVYSFGIVALEIVHGRSN-KIERSKNNTFYLIDWVEV-LREKNNL 751

Query: 453  LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED---AEPCKLVSII 286
            L +VD  +   + +E+A+ +++IAI+CT++ P  RP+M  VV+MLE     E  KL    
Sbjct: 752  LELVDPRLGSEYNREEAMTMIQIAIMCTSSEPCERPSMSEVVKMLEGKKMVEVEKLEEAS 811

Query: 285  VSKDAAKLDN 256
            V ++  +L+N
Sbjct: 812  VHRETKRLEN 821



 Score = 56.2 bits (134), Expect(2) = 2e-23
 Identities = 27/55 (49%), Positives = 41/55 (74%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           I+HRD+K++N+LLD+   P+I+DFGLAK+ +     +D+TH+   I GT GY+AP
Sbjct: 647 IVHRDIKATNVLLDKQLNPKISDFGLAKLDE-----EDSTHISTRIAGTFGYMAP 696



>pir|T45878|T45878 receptor lectin kinase-like protein - Arabidopsis
           thaliana>gb:ATF4P12_1550723 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F4P12.
          Length = 715

 Score = 69.7 bits (169), Expect(2) = 4e-23
 Identities = 42/110 (38%), Positives = 64/110 (58%), Gaps = 8/110 (7%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-------YGENNDIVSWVSTKLK 469
           L  EY  T +  EK+DV+S+G V++E+VSG++PIE +        G N ++V WV   L 
Sbjct: 543 LAPEYLLTGRASEKTDVFSYGAVVLEVVSGRRPIEKDLNVQRHNVGVNPNLVEWV-WGLY 601

Query: 468 SKESILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQML 322
            +  + +  DS ++  F E  + +VL + + C+   P  RPTMR VVQML
Sbjct: 602 KEGKVSAAADSRLEGKFDEGEMWRVLVVGLACSHPDPAFRPTMRSVVQML 651



 Score = 61.6 bits (148), Expect(2) = 4e-23
 Identities = 29/56 (51%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  +IHRDVKSSNI+LDE F  ++ DFGLA+ ++++ S + T  V  GT GY+AP
Sbjct: 492 CENQVIHRDVKSSNIMLDESFNAKLGDFGLARQIEHDKSPEAT--VAAGTMGYLAP 545



>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS
            precursor (EC 2.7.1.37) (Extra sporogenous cells protein)
            (EXCESS MICROSPOROCYTES1 protein).>pir|T48499|T48499
            receptor-like protein kinase-like protein - Arabidopsis
            thaliana>gb:ATH488154_1552685 Arabidopsis thaliana mRNA
            for receptor-like protein kinase-like protein (ems1
            gene).>gb:ATT28J14_1555609 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 1192

 Score = 71.6 bits (174), Expect(2) = 5e-23
 Identities = 35/103 (33%), Positives = 60/103 (58%), Gaps = 2/103 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEY--GENNDIVSWVSTKLKSKESILSM 445
            EYG + +   K DVYSFGV+L+ELV+GK+P   ++   E  ++V W   K+   +++  +
Sbjct: 1089 EYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAIQKINQGKAVDVI 1148

Query: 444  VDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
                +    K   +++L+IA+LC A  P  RP M  V++ L++
Sbjct: 1149 DPLLVSVALKNSQLRLLQIAMLCLAETPAKRPNMLDVLKALKE 1191



 Score = 59.3 bits (142), Expect(2) = 5e-23
 Identities = 30/53 (56%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = -1

Query: 884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP 729
            IIHRD+K+SNILLD  F+P++ADFGLA+++   S+C+   + VI GT GYI P
Sbjct: 1039 IIHRDIKASNILLDGDFEPKVADFGLARLI---SACESHVSTVIAGTFGYIPP 1088



>gb:OSJN00075_1694384 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0036B21, complete sequence.
          Length = 628

 Score = 69.7 bits (169), Expect(2) = 5e-23
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 476 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 534

Query: 456 ILSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  F E  ++ ++++A+LCT   P  RP M  VV+MLE
Sbjct: 535 VEMLVDPDLQSGFVEHEVESLIQVALLCTQGSPMDRPKMSEVVRMLE 581



 Score = 61.2 bits (147), Expect(2) = 5e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 425 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 478



>gb:AY652735_1620180 Oryza sativa (japonica cultivar-group) somatic
           embryogenesis protein kinase 1 mRNA, complete cds.
          Length = 628

 Score = 69.7 bits (169), Expect(2) = 5e-23
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 476 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 534

Query: 456 ILSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  F E  ++ ++++A+LCT   P  RP M  VV+MLE
Sbjct: 535 VEMLVDPDLQSGFVEHEVESLIQVALLCTQGSPMDRPKMSEVVRMLE 581



 Score = 61.2 bits (147), Expect(2) = 5e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 425 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 478



>gb:CQ768565_1451800 Sequence 60 from Patent WO2004007712.
          Length = 601

 Score = 68.2 bits (165), Expect(2) = 5e-23
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 445 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 503

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 504 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 550



 Score = 62.8 bits (151), Expect(2) = 5e-23
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIH DVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 394 CDQKIIHLDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 447



>gb:AX120069_1461714 Sequence 52 from Patent WO0129240.
          Length = 577

 Score = 68.2 bits (165), Expect(2) = 5e-23
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 421 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 479

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 480 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 526



 Score = 62.8 bits (151), Expect(2) = 5e-23
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIH DVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 370 CDQKIIHLDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 423



>pir|H84510|H84510 probable receptor-like protein kinase [imported]
           - Arabidopsis thaliana>gb:AC006436_1534246 Arabidopsis
           thaliana chromosome 2 clone F13J11 map mi398, complete
           sequence.
          Length = 524

 Score = 68.2 bits (165), Expect(2) = 5e-23
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 368 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 426

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 427 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 473



 Score = 62.8 bits (151), Expect(2) = 5e-23
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIH DVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 317 CDQKIIHLDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 370



>gb:AY094412_1575714 Arabidopsis thaliana At2g13800/F13J11.15 mRNA,
           complete cds.>gb:BT001116_1635371 Arabidopsis thaliana
           At2g13800/F13J11.15 mRNA, complete cds.
          Length = 484

 Score = 68.2 bits (165), Expect(2) = 5e-23
 Identities = 38/107 (35%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +GV+L+EL++G+K  +     N+D   ++ WV   LK K+ 
Sbjct: 328 IAPEYLSTGKSSEKTDVFGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKK- 386

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + S+VD+ ++  + E  + +++++A+LCT +    RP M  VV+MLE
Sbjct: 387 LESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLE 433



 Score = 62.8 bits (151), Expect(2) = 5e-23
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD+ IIH DVK++NILLDE F+  + DFGLAK++ YN S    T  + GT G+IAP
Sbjct: 277 CDQKIIHLDVKAANILLDEEFEAVVGDFGLAKLMNYNDS--HVTTAVRGTIGHIAP 330



>gb:AC135205_1742004 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1012B02, complete sequence.
          Length = 392

 Score = 78.2 bits (191), Expect(2) = 5e-23
 Identities = 36/115 (31%), Positives = 76/115 (66%), Gaps = 1/115 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN-NDIVSWVSTKLKSKESIL 451
           L  EY    ++ +K+D+YSFGV+++E++SG+   ++ +G++ N +V W + KL+ +  +L
Sbjct: 224 LAPEYALLGQLTKKADIYSFGVLVLEVISGESSSKSTWGQDMNVLVEW-TWKLREQGRLL 282

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSII 286
            +VD  ++E  +E+ ++ +++A++CT A    RP+M++VV ML +     L +++
Sbjct: 283 EIVDPELEEYPEEEMLRFIKVALVCTQATSQQRPSMKQVVDMLSNPTEISLENLV 337



 Score = 52.8 bits (125), Expect(2) = 5e-23
 Identities = 29/56 (51%), Positives = 38/56 (67%), Gaps = 4/56 (7%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT-THV---IPGTHGYIAP 729
           I+HRD+K+SNILLD+   P+I DFGLAK+        DT TH+   + GT GY+AP
Sbjct: 177 IVHRDIKASNILLDKKLLPKIGDFGLAKLF------PDTITHISTRVAGTMGYLAP 226



>gb:AP004140_1838185 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1534_E09.
          Length = 392

 Score = 76.6 bits (187), Expect(2) = 5e-23
 Identities = 40/102 (39%), Positives = 67/102 (65%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
           EY  T ++ EKSDVYS+G+VL+EL++GKKP++ E   ++ I+S       +  +++ MVD
Sbjct: 231 EYACTSRLNEKSDVYSYGIVLLELLTGKKPVDNECNLHHLILS-----KAADNTVMEMVD 285

Query: 438 SAIQEPFKE--DAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             I +  K+  +  KV ++A+LC+   P+ RPTM  VV++L+
Sbjct: 286 PDIADTCKDLGEVKKVFQLALLCSKRQPSDRPTMHEVVRVLD 327



 Score = 54.3 bits (129), Expect(2) = 5e-23
 Identities = 30/59 (50%), Positives = 37/59 (62%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           C+  IIHRDVKS NILLD+ ++  +ADFG+AK     S C   TH    + GT GYI P
Sbjct: 177 CNPRIIHRDVKSKNILLDKDYEAHLADFGIAK-----SLCTSKTHTSTYVMGTIGYIDP 230



>gb:ATH496433_1552814 Arabidopsis thaliana mRNA for extra sporogenous
            cells (ESP gene).
          Length = 1192

 Score = 71.6 bits (174), Expect(2) = 6e-23
 Identities = 35/103 (33%), Positives = 60/103 (58%), Gaps = 2/103 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEY--GENNDIVSWVSTKLKSKESILSM 445
            EYG + +   K DVYSFGV+L+ELV+GK+P   ++   E  ++V W   K+   +++  +
Sbjct: 1089 EYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAIQKINQGKAVDVI 1148

Query: 444  VDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
                +    K   +++L+IA+LC A  P  RP M  V++ L++
Sbjct: 1149 DPLLVSVALKNSQLRLLQIAMLCLAETPAKRPNMLDVLKALKE 1191



 Score = 58.9 bits (141), Expect(2) = 6e-23
 Identities = 30/53 (56%), Positives = 41/53 (77%), Gaps = 1/53 (1%)
 Frame = -1

Query: 884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKD-TTHVIPGTHGYIAP 729
            IIHRD+K+SNILLD  F+P++ADFGLA+++   S+C+   + VI GT GYI P
Sbjct: 1039 IIHRDIKASNILLDGDFEPKVADFGLARLI---SACESHISTVIAGTFGYIPP 1088



>gb:AP004564_1841662 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0479C12.>gb:AP004665_1842913 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0429B05.
          Length = 1010

 Score = 74.7 bits (182), Expect(2) = 6e-23
 Identities = 43/110 (39%), Positives = 66/110 (60%), Gaps = 5/110 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  E  ++ K   + DVYS+GVVL+EL++ K  +++ +  N DIVSWVS+KL     I +
Sbjct: 884  MAPEMAFSTKATTEFDVYSYGVVLLELITRKMAVDSSFPGNMDIVSWVSSKLNETNQIET 943

Query: 447  MVDSA-IQEPF----KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDA 313
            + D A I E +     E+  K+L +A+ CTA   + RP+M  VV+ L DA
Sbjct: 944  ICDPALITEVYGTHEMEEVRKLLSLALRCTAKEASQRPSMAVVVKELTDA 993



 Score = 55.8 bits (133), Expect(2) = 6e-23
 Identities = 27/56 (48%), Positives = 36/56 (64%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRD+K  NILLD    P I+DFG+AK++    +   TT ++ GT GY+AP
Sbjct: 832 CHPAIIHRDIKPKNILLDNDMVPHISDFGIAKLMDQYPAALQTTGIV-GTIGYMAP 886



>gb:ZMA400869_1731517 Zea mays serk2 gene for somatic embryogenesis
           receptor-like kinase 2, exons 1-11.
          Length = 626

 Score = 69.3 bits (168), Expect(2) = 6e-23
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 474 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 532

Query: 456 ILSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q+ ++E  ++ ++++A+LCT   P  RP M  VV+MLE
Sbjct: 533 VEMLVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLE 579



 Score = 61.2 bits (147), Expect(2) = 6e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 423 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 476



>gb:ZMA277703_1731488 Zea mays mRNA for SERK2 protein.
          Length = 626

 Score = 69.3 bits (168), Expect(2) = 6e-23
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 474 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 532

Query: 456 ILSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q+ ++E  ++ ++++A+LCT   P  RP M  VV+MLE
Sbjct: 533 VEMLVDPDLQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLE 579



 Score = 61.2 bits (147), Expect(2) = 6e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 423 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 476



>gb:AY048200_1561662 Arabidopsis thaliana At1g71830/F14O23_24 mRNA,
           complete cds.>gb:BT002217_1635820 Arabidopsis thaliana
           At1g71830/F14O23_24 mRNA, complete cds.
          Length = 625

 Score = 69.3 bits (168), Expect(2) = 6e-23
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 472 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 530

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  ++E  + +V+++A+LCT   P  RP M  VV+MLE
Sbjct: 531 LEMLVDPDLQTNYEERELEQVIQVALLCTQGSPMERPKMSEVVRMLE 577



 Score = 61.2 bits (147), Expect(2) = 6e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 421 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 474



>gb:A67827_1450282 Sequence 32 from Patent
           WO9743427.>gb:CQ768543_1451789 Sequence 38 from Patent
           WO2004007712.>gb:AX120037_1461704 Sequence 20 from
           Patent WO0129240.>gb:AX138071_1462207 Sequence 17 from
           Patent EP1094113.
          Length = 625

 Score = 69.3 bits (168), Expect(2) = 6e-23
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 472 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 530

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  ++E  + +V+++A+LCT   P  RP M  VV+MLE
Sbjct: 531 LEMLVDPDLQTNYEERELEQVIQVALLCTQGSPMERPKMSEVVRMLE 577



 Score = 61.2 bits (147), Expect(2) = 6e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 421 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 474



>pir|H96740|H96740 hypothetical protein F14O23.21 [imported] -
           Arabidopsis thaliana>gb:AE005173_894730 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F14O23_1677509 Arabidopsis thaliana
           chromosome 1 BAC F14O23 sequence, complete sequence.
          Length = 601

 Score = 69.3 bits (168), Expect(2) = 6e-23
 Identities = 38/107 (35%), Positives = 66/107 (61%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 448 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 506

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  ++E  + +V+++A+LCT   P  RP M  VV+MLE
Sbjct: 507 LEMLVDPDLQTNYEERELEQVIQVALLCTQGSPMERPKMSEVVRMLE 553



 Score = 61.2 bits (147), Expect(2) = 6e-23
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 397 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 450



>gb:AP005807_1858200 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OSJNBb0018H10.>gb:AP005809_1858233 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:OSJNBb0039M16.
          Length = 1084

 Score = 77.8 bits (190), Expect(2) = 8e-23
 Identities = 40/107 (37%), Positives = 64/107 (59%), Gaps = 3/107 (2%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE---AEYGENNDIVSWVSTKLKSKESILS 448
            EY  T +V +K+DVYS+GVVLMEL+S KK ++   + YG   +IV+W    L+   +   
Sbjct: 972  EYAMTCRVSDKADVYSYGVVLMELISDKKALDPSFSPYGNGFNIVAWACMLLRQGRAREF 1031

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
             +D        +D ++ L +A++CT    + RPTM++VVQ L+  +P
Sbjct: 1032 FIDGLWDVGPHDDLVETLHLAVMCTVDSLSVRPTMKQVVQRLKQLQP 1078



 Score = 52.4 bits (124), Expect(2) = 8e-23
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRDVK SNILLD  +   ++DFGLA++L  NS    TT V  GT GY+AP
Sbjct: 918  CVPRILHRDVKPSNILLDTEYNAYLSDFGLARLLG-NSETHATTGV-AGTFGYVAP 971



>gb:AC104280_1737456 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1430_B02, complete sequence.
          Length = 424

 Score = 71.2 bits (173), Expect(2) = 8e-23
 Identities = 41/125 (32%), Positives = 69/125 (55%), Gaps = 2/125 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDI-VSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYS+GVVL+EL++G+ P++ +      + V+W    L  +E ++ ++
Sbjct: 305 EYALTGHLTTKSDVYSYGVVLLELLTGRVPVDMKRPPGEGVLVNWALPMLTDREKVVQIL 364

Query: 441 DSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK 265
           D A++  +  +DA++V  IA +C     + RP M  VVQ         LV ++ ++   K
Sbjct: 365 DPALEGQYSLKDAVQVAAIAAMCVQQEADYRPLMADVVQ--------SLVPLVKNRSTPK 416

Query: 264 LDNPS 250
             NPS
Sbjct: 417 TCNPS 421



 Score = 58.9 bits (141), Expect(2) = 8e-23
 Identities = 29/53 (54%), Positives = 39/53 (73%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           P+IHRD KSSNILLD+ F+ R++DFGLAK+    +    +T V+ GT GY+AP
Sbjct: 253 PVIHRDFKSSNILLDKDFRARVSDFGLAKLGSDRAGGHVSTRVL-GTQGYVAP 304



>gb:AB103395_1526454 Oryza sativa (japonica cultivar-group) MSP1 mRNA
            for putative leucin-rich repeat protein kinase, complete
            cds.>gb:AP003451_1829652 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0413C03.
          Length = 1294

 Score = 66.6 bits (161), Expect(2) = 1e-22
 Identities = 44/119 (36%), Positives = 65/119 (54%), Gaps = 4/119 (3%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPI-EAEYGENNDIVSWVSTKL-KSKESILSM 445
            EYG T K   K DVYSFGVV++EL++G+ P  + E     ++V WV   + + K++ L  
Sbjct: 1175 EYGLTMKSTTKGDVYSFGVVMLELLTGRPPTGQEEVQGGGNLVGWVRWMIARGKQNELFD 1234

Query: 444  VDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE--DAEPCKLVSIIVSKD 274
                +   ++E   +VL IA  CTA  P  RPTM  VV+ L+      C  + + VS+D
Sbjct: 1235 PCLPVSSVWREQMARVLAIARDCTADEPFKRPTMLEVVKGLKMTHGMECGPLVVTVSRD 1293



 Score = 62.8 bits (151), Expect(2) = 1e-22
 Identities = 35/55 (63%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
            IIHRD+KSSNILLDE F+PR++DFGLA+I+   S+C+  THV   I GT GYI P
Sbjct: 1125 IIHRDMKSSNILLDENFEPRVSDFGLARII---SACE--THVSTDIAGTFGYIPP 1174



>gb:AC084817_1733839 Oryza sativa (japonica cultivar-group) chromosome
            5 clone P0419C04, complete sequence.>gb:AC087553_1734104
            Oryza sativa (japonica cultivar-group) chromosome 5 clone
            P0685E10, complete sequence.
          Length = 1123

 Score = 82.0 bits (201), Expect(2) = 1e-22
 Identities = 38/105 (36%), Positives = 63/105 (60%), Gaps = 3/105 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYG   K+  KSDVYSFGVVL+E+++G++P++  +GE   +V WV   L  K     
Sbjct: 951  IAPEYGCMTKITTKSDVYSFGVVLLEMITGRRPLDPAFGEGQSVVQWVRDHLCRKRDPAE 1010

Query: 447  MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            ++D  +Q   +   ++ ++ L +A+LC +  P  RPTM+ V  +L
Sbjct: 1011 IIDVRLQGRPDTQVQEMLQALGMALLCASPRPEDRPTMKDVAALL 1055



 Score = 47.4 bits (111), Expect(2) = 1e-22
 Identities = 25/56 (44%), Positives = 36/56 (64%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRDVK+ NILL + ++  +ADFGLA++    +S   +     G++GYIAP
Sbjct: 900  CVPGIIHRDVKADNILLADRYEACLADFGLARVADDGAS--SSPPPFAGSYGYIAP 953



>pir|T10659|T10659 probable serine/threonine-specific protein kinase
            (EC 2.7.1.-) T5F17.100 - Arabidopsis
            thaliana>gb:ATCHRIV69_1546745 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 69.
          Length = 1013

 Score =  108 bits (270), Expect = 1e-22
 Identities = 70/166 (42%), Positives = 99/166 (59%), Gaps = 11/166 (6%)
 Frame = -3

Query: 771  HHSCHSRNSWIHRSRYKTFQVLL*A-LSKFMQLFY*ASMHA*RLS*PIKLVA-------- 619
            HH CH     IHR   K+  +LL A L   +  F  A M A R    + +VA        
Sbjct: 820  HHDCHP--PVIHRD-IKSNNILLDANLDARIADFGLARMMA-RKKETVSMVAGSYGYIAP 875

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYGYT KV EK D+YS+GVVL+EL++G++P+E E+GE+ DIV WV  K++   S+   +D
Sbjct: 876  EYGYTLKVDEKIDIYSYGVVLLELLTGRRPLEPEFGESVDIVEWVRRKIRDNISLEEALD 935

Query: 438  SAIQ--EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
              +      +E+ + VL+IA+LCT  LP  RP+MR V+ ML +A+P
Sbjct: 936  PNVGNCRYVQEEMLLVLQIALLCTTKLPKDRPSMRDVISMLGEAKP 981



 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 29/56 (51%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  P+IHRD+KS+NILLD     RIADFGLA+++   +  K+T  ++ G++GYIAP
Sbjct: 823 CHPPVIHRDIKSNNILLDANLDARIADFGLARMM---ARKKETVSMVAGSYGYIAP 875



>gb:AB115767_1527521 Citrus unshiu SERK mRNA for somatic
           embryogenesis receptor kinase 1, complete cds.
          Length = 621

 Score = 67.8 bits (164), Expect(2) = 2e-22
 Identities = 37/107 (34%), Positives = 65/107 (60%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 468 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 526

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  + E  + +++++A+LCT   P  RP M  VV+MLE
Sbjct: 527 LEMLVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLE 573



 Score = 61.2 bits (147), Expect(2) = 2e-22
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 417 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 470



>pir|D86466|D86466 69.4K hypothetical protein F23M19.11 -
           Arabidopsis thaliana>gb:AE005172_892224 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:CQ768559_1451797 Sequence 54 from Patent
           WO2004007712.>gb:AX120063_1461711 Sequence 46 from
           Patent WO0129240.>gb:F23M19_1677952 Arabidopsis thaliana
           chromosome 1 BAC F23M19 sequence, complete sequence.
          Length = 628

 Score = 68.6 bits (166), Expect(2) = 2e-22
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 475 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 533

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  + E  + +++++A+LCT + P  RP M  VV+MLE
Sbjct: 534 LEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 580



 Score = 60.1 bits (144), Expect(2) = 2e-22
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLA+++ Y    KDT  T  + GT G+IAP
Sbjct: 424 CDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDY----KDTHVTTAVRGTIGHIAP 477



>pir|T14354|T14354 probable somatic embryogenesis receptor-like
           kinase - carrot>gb:A67797_1450276 Sequence 2 from Patent
           WO9743427.>gb:DCU93048_1675787 Daucus carota somatic
           embryogenesis receptor-like kinase mRNA, complete cds.
          Length = 553

 Score = 66.6 bits (161), Expect(2) = 2e-22
 Identities = 35/107 (32%), Positives = 66/107 (61%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV + LK K+ 
Sbjct: 400 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKSLLKEKK- 458

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  ++  + +  + +++++A+LCT   P  RP M  VV+MLE
Sbjct: 459 LEMLVDPDLENNYIDTEVEQLIQVALLCTQGSPMERPKMSEVVRMLE 505



 Score = 62.0 bits (149), Expect(2) = 2e-22
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLA+++ Y    KDT  T  + GT GYIAP
Sbjct: 349 CDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDY----KDTHVTTAVRGTLGYIAP 402



>gb:AC104473_1737662 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1626B05, complete sequence.
          Length = 467

 Score = 69.7 bits (169), Expect(2) = 2e-22
 Identities = 44/127 (34%), Positives = 74/127 (58%), Gaps = 4/127 (3%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESILSM 445
           EY  T  + E SD+YSFGV+LMEL+SGK+P++     GE N +V W    + S+  +  +
Sbjct: 335 EYASTGMLNESSDIYSFGVLLMELISGKRPVDYSKSVGEVN-LVEWFKGMVGSRR-VEQL 392

Query: 444 VDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVSIIVSKDA 271
           VD  I++P    A+ +VL + + C  +  + RP M ++V MLE D  P + +  ++++  
Sbjct: 393 VDPRIEDPPGARALNRVLLVCLRCIDSDAHKRPKMGQIVHMLEGDEFPFRTLRWLLAESK 452

Query: 270 AKLDNPS 250
              D+P+
Sbjct: 453 VFSDSPA 459



 Score = 58.9 bits (141), Expect(2) = 2e-22
 Identities = 27/52 (51%), Positives = 39/52 (75%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++HRD+KSSNILLD+ + P+++DFG+AK+L   SS   T   + GT GY+AP
Sbjct: 285 VVHRDIKSSNILLDKKWNPKVSDFGMAKVLGSGSSYVTTR--VMGTFGYVAP 334



>gb:AX038197_1457678 Sequence 12 from Patent
           WO0060086.>gb:ATAC010871_1543190 Arabidopsis thaliana
           chromosome III BAC T16O11 genomic sequence, complete
           sequence.
          Length = 384

 Score = 71.6 bits (174), Expect(2) = 2e-22
 Identities = 33/107 (30%), Positives = 61/107 (57%), Gaps = 1/107 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDI-VSWVSTKLKSKESIL 451
           L  EY    ++ +K+DVYSFG++++E++SG     A +G+   + V WV  K   +  +L
Sbjct: 205 LAPEYALLGQLTKKADVYSFGILVLEVISGNSSTRAAFGDEYMVLVEWVKLKASEERRLL 264

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             VD  + +   ++  + +++A+ CT A    RP M++V++ML   E
Sbjct: 265 ECVDPELTKFPADEVTRFIKVALFCTQAAAQKRPNMKQVMEMLRRKE 311



 Score = 57.0 bits (136), Expect(2) = 2e-22
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           ++HRD+K+SNILLD  F P+I DFGLAK+   N      THV   + GT GY+AP
Sbjct: 158 VVHRDIKASNILLDSNFSPKIGDFGLAKLFPDN-----VTHVSTRVAGTVGYLAP 207



>gb:AP004991_1846852 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0016O19.
          Length = 978

 Score = 76.3 bits (186), Expect(2) = 3e-22
 Identities = 40/102 (39%), Positives = 66/102 (64%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EY  T ++ EKSDVYS+G+VL+EL++GKKP++ E   ++ I+S       +  +++  VD
Sbjct: 817  EYARTSRLNEKSDVYSYGIVLLELLTGKKPVDNECNLHHLILS-----KTANNAVMETVD 871

Query: 438  SAIQEPFKE--DAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
              I +  K+  +  KV ++A+LCT   P+ RPTM  VV++L+
Sbjct: 872  PDIADTCKDLGEVKKVFQLALLCTKRQPSDRPTMHEVVRVLD 913



 Score = 52.0 bits (123), Expect(2) = 3e-22
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           C   IIHRDVKS NILLD+ ++  + DFG+AK     S C   TH    + GT GYI P
Sbjct: 763 CSPRIIHRDVKSKNILLDKDYEAHLTDFGIAK-----SLCVSKTHTSTYVMGTIGYIDP 816



>gb:AY125515_1580323 Arabidopsis thaliana AT4g02010/T10M13_2 mRNA,
           complete cds.>gb:BT009694_1640155 Arabidopsis thaliana
           At4g02010/T10M13_2 gene, complete cds.
          Length = 725

 Score = 78.6 bits (192), Expect(2) = 3e-22
 Identities = 42/102 (41%), Positives = 65/102 (63%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYS+GVVL+EL++G+KP++ ++     ++V+W    L+ K+ +  +V
Sbjct: 555 EYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPSGQENLVTWTRPVLRDKDRLEELV 614

Query: 441 DSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           DS ++  + KED I+V  IA  C A   + RPTM  VVQ L+
Sbjct: 615 DSRLEGKYPKEDFIRVCTIAAACVAPEASQRPTMGEVVQSLK 656



 Score = 49.7 bits (117), Expect(2) = 3e-22
 Identities = 26/52 (50%), Positives = 34/52 (65%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD K+SNILL+  F  ++ADFGLAK          +T V+ GT GY+AP
Sbjct: 504 VIHRDFKASNILLENNFNAKVADFGLAKQAPEGRGNHLSTRVM-GTFGYVAP 554



>pir|T01502|T01502 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) T10M13.2 - Arabidopsis
           thaliana>gb:ATAF001308_1543828 Arabidopsis thaliana BAC
           T10M13 from chromosome IV, from 10.8 cM to 11.6 cM,
           complete sequence.>gb:ATCHRIV5_1545724 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 5.
          Length = 707

 Score = 78.6 bits (192), Expect(2) = 3e-22
 Identities = 42/102 (41%), Positives = 65/102 (63%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYS+GVVL+EL++G+KP++ ++     ++V+W    L+ K+ +  +V
Sbjct: 537 EYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPSGQENLVTWTRPVLRDKDRLEELV 596

Query: 441 DSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           DS ++  + KED I+V  IA  C A   + RPTM  VVQ L+
Sbjct: 597 DSRLEGKYPKEDFIRVCTIAAACVAPEASQRPTMGEVVQSLK 638



 Score = 49.7 bits (117), Expect(2) = 3e-22
 Identities = 26/52 (50%), Positives = 34/52 (65%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD K+SNILL+  F  ++ADFGLAK          +T V+ GT GY+AP
Sbjct: 486 VIHRDFKASNILLENNFNAKVADFGLAKQAPEGRGNHLSTRVM-GTFGYVAP 536



>gb:CQ768553_1451794 Sequence 48 from Patent WO2004007712.
          Length = 603

 Score = 70.1 bits (170), Expect(2) = 3e-22
 Identities = 42/113 (37%), Positives = 70/113 (61%), Gaps = 4/113 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGE--NNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FGV+++EL++G K I+   G+     I+SWV T LK+++  
Sbjct: 458 IAPEYLSTGQSSEKTDVFGFGVLILELITGHKMIDQGNGQVRKGMILSWVRT-LKAEKRF 516

Query: 453 LSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLED-AEPCK 301
             MVD  ++  F +  + +V+ +A+LCT   PN RP M +V+++LE   E C+
Sbjct: 517 AEMVDRDLKGEFDDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQCE 569



 Score = 58.2 bits (139), Expect(2) = 3e-22
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++NILLDE F+  + DFGLAK+L    S    T  + GT G+IAP
Sbjct: 407 CNPKIIHRDVKAANILLDESFEAIVGDFGLAKLLDQRDS--HVTTAVRGTIGHIAP 460



>gb:AB012245_1511781 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRA19.
          Length = 570

 Score = 70.1 bits (170), Expect(2) = 3e-22
 Identities = 42/113 (37%), Positives = 70/113 (61%), Gaps = 4/113 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGE--NNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FGV+++EL++G K I+   G+     I+SWV T LK+++  
Sbjct: 425 IAPEYLSTGQSSEKTDVFGFGVLILELITGHKMIDQGNGQVRKGMILSWVRT-LKAEKRF 483

Query: 453 LSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLED-AEPCK 301
             MVD  ++  F +  + +V+ +A+LCT   PN RP M +V+++LE   E C+
Sbjct: 484 AEMVDRDLKGEFDDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQCE 536



 Score = 58.2 bits (139), Expect(2) = 3e-22
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++NILLDE F+  + DFGLAK+L    S    T  + GT G+IAP
Sbjct: 374 CNPKIIHRDVKAANILLDESFEAIVGDFGLAKLLDQRDS--HVTTAVRGTIGHIAP 427



>gb:AX138094_1462211 Sequence 40 from Patent EP1094113.
          Length = 541

 Score = 70.1 bits (170), Expect(2) = 3e-22
 Identities = 42/113 (37%), Positives = 70/113 (61%), Gaps = 4/113 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGE--NNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FGV+++EL++G K I+   G+     I+SWV T LK+++  
Sbjct: 396 IAPEYLSTGQSSEKTDVFGFGVLILELITGHKMIDQGNGQVRKGMILSWVRT-LKAEKRF 454

Query: 453 LSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLED-AEPCK 301
             MVD  ++  F +  + +V+ +A+LCT   PN RP M +V+++LE   E C+
Sbjct: 455 AEMVDRDLKGEFDDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQCE 507



 Score = 58.2 bits (139), Expect(2) = 3e-22
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++NILLDE F+  + DFGLAK+L    S    T  + GT G+IAP
Sbjct: 345 CNPKIIHRDVKAANILLDESFEAIVGDFGLAKLLDQRDS--HVTTAVRGTIGHIAP 398



>gb:AX120059_1461709 Sequence 42 from Patent WO0129240.
          Length = 532

 Score = 70.1 bits (170), Expect(2) = 3e-22
 Identities = 42/113 (37%), Positives = 70/113 (61%), Gaps = 4/113 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGE--NNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FGV+++EL++G K I+   G+     I+SWV T LK+++  
Sbjct: 387 IAPEYLSTGQSSEKTDVFGFGVLILELITGHKMIDQGNGQVRKGMILSWVRT-LKAEKRF 445

Query: 453 LSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLED-AEPCK 301
             MVD  ++  F +  + +V+ +A+LCT   PN RP M +V+++LE   E C+
Sbjct: 446 AEMVDRDLKGEFDDLVLEEVVELALLCTQPHPNLRPRMSQVLKVLEGLVEQCE 498



 Score = 58.2 bits (139), Expect(2) = 3e-22
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++NILLDE F+  + DFGLAK+L    S    T  + GT G+IAP
Sbjct: 336 CNPKIIHRDVKAANILLDESFEAIVGDFGLAKLLDQRDS--HVTTAVRGTIGHIAP 389



>gb:AY064978_1566153 Arabidopsis thaliana At1g21590/F24J8_9 mRNA,
           complete cds.>gb:AY141999_1582836 Arabidopsis thaliana
           At1g21590/F24J8_9 mRNA, complete cds.
          Length = 756

 Score = 70.1 bits (170), Expect(2) = 4e-22
 Identities = 45/119 (37%), Positives = 68/119 (57%), Gaps = 3/119 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND-IVSWVSTKLKSKESIL 451
           L  EY    K+  K DVY++GVVL+EL+SG+KP+ +E  +  D +V W    L  KE   
Sbjct: 578 LAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQDSLVMWAKPILDDKE-YS 636

Query: 450 SMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVSIIVS 280
            ++DS++Q+    D + K+   A LC    P +RPTM  V+++L+ D E  K   + VS
Sbjct: 637 QLLDSSLQDDNNSDQMEKMALAATLCIRHNPQTRPTMGMVLELLKGDVEMLKWAKLQVS 695



 Score = 57.8 bits (138), Expect(2) = 4e-22
 Identities = 29/57 (50%), Positives = 41/57 (71%), Gaps = 3/57 (5%)
 Frame = -1

Query: 890 RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSS---CKDTTHVIPGTHGYIAP 729
           +P+IHRDVKSSNILL + F+P+++DFGLAK    +++   C D    + GT GY+AP
Sbjct: 528 QPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASESTTQIICSD----VAGTFGYLAP 580



>pir|G86348|G86348 hypothetical protein F24J8.18 - Arabidopsis
           thaliana>gb:AE005172_891106 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC015447_1538009 Arabidopsis thaliana
           chromosome I BAC F24J8 genomic sequence, complete
           sequence.
          Length = 705

 Score = 70.1 bits (170), Expect(2) = 4e-22
 Identities = 45/119 (37%), Positives = 68/119 (57%), Gaps = 3/119 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND-IVSWVSTKLKSKESIL 451
           L  EY    K+  K DVY++GVVL+EL+SG+KP+ +E  +  D +V W    L  KE   
Sbjct: 527 LAPEYFMYGKMNNKIDVYAYGVVLLELLSGRKPVNSESPKAQDSLVMWAKPILDDKE-YS 585

Query: 450 SMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVSIIVS 280
            ++DS++Q+    D + K+   A LC    P +RPTM  V+++L+ D E  K   + VS
Sbjct: 586 QLLDSSLQDDNNSDQMEKMALAATLCIRHNPQTRPTMGMVLELLKGDVEMLKWAKLQVS 644



 Score = 57.8 bits (138), Expect(2) = 4e-22
 Identities = 29/57 (50%), Positives = 41/57 (71%), Gaps = 3/57 (5%)
 Frame = -1

Query: 890 RPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSS---CKDTTHVIPGTHGYIAP 729
           +P+IHRDVKSSNILL + F+P+++DFGLAK    +++   C D    + GT GY+AP
Sbjct: 477 QPVIHRDVKSSNILLSDDFEPQLSDFGLAKWASESTTQIICSD----VAGTFGYLAP 529



>gb:AF384969_1794544 Arabidopsis thaliana somatic embryogenesis
           receptor-like kinase 2 (SERK2) mRNA, complete cds.
          Length = 628

 Score = 67.8 bits (164), Expect(2) = 4e-22
 Identities = 37/107 (34%), Positives = 66/107 (61%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 475 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 533

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  + E  + +++++A+LCT + P  RP M  VV+MLE
Sbjct: 534 LEMLVDPDLQGNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLE 580



 Score = 60.1 bits (144), Expect(2) = 4e-22
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLA+++ Y    KDT  T  + GT G+IAP
Sbjct: 424 CDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDY----KDTHVTTAVRGTIGHIAP 477



>gb:AB017061_1513313 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K19E20.
          Length = 1110

 Score = 80.5 bits (197), Expect(2) = 5e-22
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 3/107 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGY+ K+ EKSDVYS+GVV++E+++GK+PI+    +   IV WV      K   + 
Sbjct: 939  IAPEYGYSMKITEKSDVYSYGVVVLEVLTGKQPIDPTIPDGLHIVDWV-----KKIRDIQ 993

Query: 447  MVDSAIQ---EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            ++D  +Q   E   E+ ++ L +A+LC   +P  RPTM+ V  ML +
Sbjct: 994  VIDQGLQARPESEVEEMMQTLGVALLCINPIPEDRPTMKDVAAMLSE 1040



 Score = 47.0 bits (110), Expect(2) = 5e-22
 Identities = 22/49 (44%), Positives = 35/49 (71%)
 Frame = -1

Query: 875  RDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            RD+K++NIL+   F+P I DFGLAK++      + +++ I G++GYIAP
Sbjct: 894  RDIKANNILIGPDFEPYIGDFGLAKLVDDGDFAR-SSNTIAGSYGYIAP 941



>gb:CQ768551_1451793 Sequence 46 from Patent WO2004007712.
          Length = 627

 Score = 64.3 bits (155), Expect(2) = 5e-22
 Identities = 36/106 (33%), Positives = 61/106 (57%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E      +   ++ WV  KL  +  +
Sbjct: 458 IAPEYLSTGQSSEKTDVFGFGILLLELITGMRALEFGKSVSQKGAMLEWVR-KLHKEMKV 516

Query: 453 LSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  +   +    + ++L++A+LCT  LP  RP M  VVQMLE
Sbjct: 517 EELVDRELGTTYDRIEVGEMLQVALLCTQFLPAHRPKMSEVVQMLE 562



 Score = 63.2 bits (152), Expect(2) = 5e-22
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE+F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 407 CDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLNHEDS--HVTTAVRGTVGHIAP 460



>gb:ZMA277702_1731487 Zea mays mRNA for SERK1
           protein.>gb:ZMA400868_1731516 Zea mays serk1 gene for
           somatic embryogenesis receptor-like kinase 1, exons
           1-11.
          Length = 622

 Score = 66.2 bits (160), Expect(2) = 5e-22
 Identities = 35/107 (32%), Positives = 64/107 (59%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 470 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKALLKEKK- 528

Query: 456 ILSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  + +  ++ ++++A+LCT   P  RP M  V +MLE
Sbjct: 529 LEQLVDPDLQGRYVDQEVESLIQVALLCTQGSPMERPKMSEVARMLE 575



 Score = 61.2 bits (147), Expect(2) = 5e-22
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 419 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 472



>gb:AY463361_1607685 Oryza sativa (indica cultivar-group)
           benzothiadiazole-induced somatic embryogenesis receptor
           kinase 1 (BISERK1) mRNA, complete cds.
          Length = 624

 Score = 66.2 bits (160), Expect(2) = 5e-22
 Identities = 36/107 (33%), Positives = 64/107 (59%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K  
Sbjct: 471 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKR- 529

Query: 456 ILSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  + +  ++ ++++A+LCT   P  RP M  VV+MLE
Sbjct: 530 LEMLVDPDLQSNYIDVEVESLIQVALLCTQGSPTERPKMAEVVRMLE 576



 Score = 61.2 bits (147), Expect(2) = 5e-22
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 420 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 473



>gb:AB188247_1529358 Oryza sativa (japonica cultivar-group) OsSERK1
           mRNA for SERK-family receptor-like protein kinase,
           complete cds.>gb:AP005164_1848543 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0054L03.
          Length = 624

 Score = 66.2 bits (160), Expect(2) = 5e-22
 Identities = 36/107 (33%), Positives = 64/107 (59%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K  
Sbjct: 471 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKR- 529

Query: 456 ILSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  +Q  + +  ++ ++++A+LCT   P  RP M  VV+MLE
Sbjct: 530 LEMLVDPDLQSNYIDVEVESLIQVALLCTQGSPTERPKMAEVVRMLE 576



 Score = 61.2 bits (147), Expect(2) = 5e-22
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 420 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 473



>pir|G84630|G84630 probable LRR receptor protein kinase [imported] -
           Arabidopsis thaliana>gb:AC005170_1532295 Arabidopsis
           thaliana chromosome 2 clone T29E15 map CIC06C07,
           complete sequence.
          Length = 607

 Score = 64.3 bits (155), Expect(2) = 5e-22
 Identities = 36/106 (33%), Positives = 61/106 (57%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E      +   ++ WV  KL  +  +
Sbjct: 438 IAPEYLSTGQSSEKTDVFGFGILLLELITGMRALEFGKSVSQKGAMLEWVR-KLHKEMKV 496

Query: 453 LSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  +   +    + ++L++A+LCT  LP  RP M  VVQMLE
Sbjct: 497 EELVDRELGTTYDRIEVGEMLQVALLCTQFLPAHRPKMSEVVQMLE 542



 Score = 63.2 bits (152), Expect(2) = 5e-22
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE+F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 387 CDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLNHEDS--HVTTAVRGTVGHIAP 440



>gb:AX120057_1461708 Sequence 40 from Patent WO0129240.
          Length = 515

 Score = 64.3 bits (155), Expect(2) = 5e-22
 Identities = 36/106 (33%), Positives = 61/106 (57%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E      +   ++ WV  KL  +  +
Sbjct: 346 IAPEYLSTGQSSEKTDVFGFGILLLELITGMRALEFGKSVSQKGAMLEWVR-KLHKEMKV 404

Query: 453 LSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  +   +    + ++L++A+LCT  LP  RP M  VVQMLE
Sbjct: 405 EELVDRELGTTYDRIEVGEMLQVALLCTQFLPAHRPKMSEVVQMLE 450



 Score = 63.2 bits (152), Expect(2) = 5e-22
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE+F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 295 CDPKIIHRDVKAANILLDEYFEAVVGDFGLAKLLNHEDS--HVTTAVRGTVGHIAP 348



>gb:AC120509_1739833 Oryza sativa chromosome 3 BAC OSJNBb0081K01
            genomic sequence, complete sequence.
          Length = 1049

 Score = 74.3 bits (181), Expect(2) = 7e-22
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 3/107 (2%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE---AEYGENNDIVSWVSTKLKSKESILS 448
            EY  T +V +K+DVYS+GVVL+EL+S KK ++   + YG   +IV+W    L+   +   
Sbjct: 940  EYAMTCRVSDKADVYSYGVVLLELISDKKALDPSFSPYGNGFNIVAWACMLLQKGRAREF 999

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
             ++        +D +++L + I CT    +SRPTM++VV+ L++  P
Sbjct: 1000 FIEGLWDVAPHDDLVEILHLGIKCTVDSLSSRPTMKQVVRRLKELRP 1046



 Score = 52.8 bits (125), Expect(2) = 7e-22
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRDVK SNILLD  +   ++DFGLA++L  NS    TT V  GT GY+AP
Sbjct: 886  CVPRILHRDVKPSNILLDNEYNAYLSDFGLARLLG-NSETHATTGV-AGTFGYVAP 939



>gb:AC136220_1743067 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0075J06, complete sequence.
          Length = 1007

 Score = 72.8 bits (177), Expect(2) = 7e-22
 Identities = 37/102 (36%), Positives = 61/102 (59%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY    ++ EK D+++FGVV++E V+G+        E+   +   +  L  KE  L 
Sbjct: 855  LAPEYAMRGRLTEKVDIFAFGVVMLETVAGRSNTNNSLMESEIYLFEWAWDLYEKEQPLG 914

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            +VD ++ E  K++A++V+R+A+LCT   P+ RP M +VV ML
Sbjct: 915  IVDPSLMEYDKDEALRVIRVALLCTQGSPHQRPPMSKVVAML 956



 Score = 54.3 bits (129), Expect(2) = 7e-22
 Identities = 26/52 (50%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SN+LLD    P+I+DFGLAK+  Y+      +  I GT GY+AP
Sbjct: 808 IVHRDIKASNVLLDTDLTPKISDFGLAKL--YDEKQTHVSTRIAGTFGYLAP 857



>gb:AP004791_1845157 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0491D10.
          Length = 698

 Score = 65.9 bits (159), Expect(2) = 7e-22
 Identities = 37/111 (33%), Positives = 69/111 (62%), Gaps = 4/111 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE--YGENNDIVSWVSTKLKSKESI 454
           L  EY  + K  E++DV+S+GVV++E+  G++PI+ +   G+N ++V WV  +L  ++ +
Sbjct: 538 LAPEYLQSGKATEQTDVFSYGVVVLEVCCGRRPIDKDDGGGKNVNLVDWV-WRLHGEDRL 596

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQML-EDAEP 307
           +   D  +   F +++ +++L + + C     + RP MRRVVQ+L  +AEP
Sbjct: 597 IDAADPRLAGGFYRDEMLRLLLVGLSCANPNCDERPAMRRVVQILNREAEP 647



 Score = 61.2 bits (147), Expect(2) = 7e-22
 Identities = 28/56 (50%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C++ +IHRD+K+SNILLD    PR+ DFGLA+++ +N S   T  +  GT GY+AP
Sbjct: 487 CEQRVIHRDIKTSNILLDGNLSPRLGDFGLARLMDHNKSPVST--LTAGTMGYLAP 540



>gb:AP003282_1827220 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0583G08.
          Length = 628

 Score = 63.9 bits (154), Expect(2) = 7e-22
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK+SN+LLDE+F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 423 CDPKIIHRDVKASNVLLDEYFEAIVGDFGLAKLLDHRES--HVTTAVRGTVGHIAP 476



 Score = 63.2 bits (152), Expect(2) = 7e-22
 Identities = 34/106 (32%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FGV+L+EL++G+K ++      +   ++ WV  KL  ++ +
Sbjct: 474 IAPEYLSTGQSSEKTDVFGFGVLLVELITGQKALDFGRLANQKGGVLDWVK-KLHQEKQL 532

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             MVD  +   + + +  +++++A+LCT   P+ RP M  V++MLE
Sbjct: 533 SMMVDKDLGSNYDRVELEEMVQVALLCTQYYPSHRPRMSEVIRMLE 578



>pir|B86479|B86479 hypothetical protein F14D7.1 - Arabidopsis
            thaliana>gb:AE005172_892360 Arabidopsis thaliana
            chromosome 1, top arm complete sequence.>gb:F14D7_1677431
            Sequence of BAC F14D7 from Arabidopsis thaliana
            chromosome 1, complete sequence.
          Length = 1120

 Score = 70.5 bits (171), Expect(2) = 9e-22
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            E+ YT KV EK DVYSFGV+++EL+ GK P         D+VS +S+      S+ S+ D
Sbjct: 1026 EFAYTMKVTEKCDVYSFGVLILELIIGKHP--------GDLVSSLSSSPGEALSLRSISD 1077

Query: 438  SAIQEP---FKEDAIKVLRIAILCTAALPNSRPTM 343
              + EP    +E  +K++ +A+LC  A P SRPTM
Sbjct: 1078 ERVLEPRGQNREKLLKMVEMALLCLQANPESRPTM 1112



 Score = 56.2 bits (134), Expect(2) = 9e-22
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = -1

Query: 887  PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            PI+HRD+ S NILLD  +  +I+DFG AK+L+ +SS       + GT+GY+AP
Sbjct: 976  PIVHRDISSGNILLDNDYTAKISDFGTAKLLKTDSS---NWSAVAGTYGYVAP 1025



>gb:AP005836_1858768 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBa0013F08.
          Length = 670

 Score = 66.6 bits (161), Expect(2) = 9e-22
 Identities = 41/103 (39%), Positives = 61/103 (59%), Gaps = 1/103 (0%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
           EY  T +V E SDVYSFGVVL+E+ +G+ PI      N  I+  V  K+ S + I S+ D
Sbjct: 540 EYHITGRVTESSDVYSFGVVLLEVATGQGPI---LQGNGHIIQHVKEKVASGD-ISSIAD 595

Query: 438 SAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLEDA 313
             +   +   ++ KV+ IA+LCT  LP  RP+M  VV  ++++
Sbjct: 596 ERLNGGYNVSSMWKVVEIALLCTKPLPAQRPSMTTVVVQMKES 638



 Score = 60.1 bits (144), Expect(2) = 9e-22
 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKI-LQYNSSCKDTTHVIPGTHGYIAP 729
           C+RPIIHRDVK+SNILLD+    +IADFGL+KI L    S   TT  + GT GYI P
Sbjct: 485 CNRPIIHRDVKTSNILLDQNLHAKIADFGLSKIYLSDTQSGLSTT--VAGTMGYIDP 539



>gb:AP005905_1859878 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:B1080A02.
          Length = 652

 Score = 65.5 bits (158), Expect(2) = 9e-22
 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN---DIVSWVSTKLKSKES 457
           L  EY    K  EKSDVYS+GVVL+E+ +G++PIE+   ++    ++V WV   L SK  
Sbjct: 498 LAPEYLQMGKATEKSDVYSYGVVLLEICTGRRPIESAAPDSMNMVNVVDWV-WNLHSKGK 556

Query: 456 ILSMVDSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +L  VD  +   +     ++ L + + C       RP MR V+ MLE
Sbjct: 557 VLDAVDPTLNGEYDAGQMMRFLLVGLSCVNPFSEERPVMRTVLDMLE 603



 Score = 61.2 bits (147), Expect(2) = 9e-22
 Identities = 29/55 (52%), Positives = 39/55 (70%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           D+ +IHRD+K SNILLD  F PR+ DFGLA++   N+S + T  +  GT GY+AP
Sbjct: 448 DKQVIHRDIKCSNILLDSHFNPRLGDFGLARLKDPNTSPRST--LAAGTVGYLAP 500



>gb:AC132492_1741212 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0605G01, complete sequence.
          Length = 491

 Score = 72.8 bits (177), Expect(2) = 9e-22
 Identities = 40/104 (38%), Positives = 61/104 (58%), Gaps = 2/104 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDI-VSWVSTKLKSKESIL 451
           L  EY  T K+  KSDVYS+GVVL+EL++G+ P++ +      + VSW   +L ++E ++
Sbjct: 338 LAPEYASTGKLTTKSDVYSYGVVLLELLTGRVPVDTKRPPGQHVLVSWALPRLTNREKLV 397

Query: 450 SMVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            MVD A+   F  +D ++V  I  +C     + RP M  VVQ L
Sbjct: 398 QMVDPALIGQFSLKDLVQVAAITAMCIQTKADYRPLMTDVVQSL 441



 Score = 53.9 bits (128), Expect(2) = 9e-22
 Identities = 26/52 (50%), Positives = 38/52 (73%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD K SNILLD  ++ R++DFG+AK+    ++ + TT V+ GT GY+AP
Sbjct: 290 VIHRDFKCSNILLDHNYRARVSDFGMAKLGSNKANGQVTTRVL-GTTGYLAP 340



>pir|T01711|T01711 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) A_IG002N01.22 - Arabidopsis
           thaliana>gb:ATCHRIV3_1544819 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 3.>gb:IG002N01_1683033
           Arabidopsis thaliana BAC IG002N01.
          Length = 450

 Score = 70.1 bits (170), Expect(2) = 9e-22
 Identities = 40/103 (38%), Positives = 62/103 (60%), Gaps = 3/103 (2%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESILSM 445
           EY  T  + EKSD+YSFG+++ME+++G+ P++     GE N +V W+ T + ++ S   +
Sbjct: 332 EYACTGMLTEKSDIYSFGILIMEIITGRNPVDYSRPQGEVN-LVEWLKTMVGNRRS-EEV 389

Query: 444 VDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           VD  I EP    A+K VL +A+ C     N RP M  ++ MLE
Sbjct: 390 VDPKIPEPPTSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 432



 Score = 56.6 bits (135), Expect(2) = 9e-22
 Identities = 28/52 (53%), Positives = 40/52 (76%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++HRD+KSSNILLD  +  +++DFGLAK+L ++ S   TT V+ GT GY+AP
Sbjct: 282 VVHRDIKSSNILLDRQWNAKVSDFGLAKLL-FSESSYVTTRVM-GTFGYVAP 331



>gb:AY075617_1567762 Arabidopsis thaliana AT3g25560/MWL2_18 mRNA,
           complete cds.>gb:BT002619_1636222 Arabidopsis thaliana
           At3g25560/MWL2_18 mRNA, complete cds.
          Length = 635

 Score = 64.3 bits (155), Expect(2) = 1e-21
 Identities = 36/106 (33%), Positives = 65/106 (61%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN--NDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E     N    I+ WV  KL+ ++ +
Sbjct: 478 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK-KLQQEKKL 536

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  ++  + + +  +++++A+LCT  LP  RP M  VV+MLE
Sbjct: 537 EQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLE 582



 Score = 62.0 bits (149), Expect(2) = 1e-21
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLD++F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 427 CDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEES--HVTTAVRGTVGHIAP 480



>gb:AB025639_1516701 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MWL2.
          Length = 630

 Score = 64.3 bits (155), Expect(2) = 1e-21
 Identities = 36/106 (33%), Positives = 65/106 (61%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN--NDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E     N    I+ WV  KL+ ++ +
Sbjct: 473 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK-KLQQEKKL 531

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  ++  + + +  +++++A+LCT  LP  RP M  VV+MLE
Sbjct: 532 EQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLE 577



 Score = 62.0 bits (149), Expect(2) = 1e-21
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLD++F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 422 CDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEES--HVTTAVRGTVGHIAP 475



>gb:AB125890_1528232 Ipomoea batatas SRF6 mRNA for leucine-rich
           repeat receptor-like kinase, complete cds.
          Length = 627

 Score = 66.2 bits (160), Expect(2) = 1e-21
 Identities = 37/106 (34%), Positives = 65/106 (61%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND--IVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G+K ++   G N    I+ WV T L  +  +
Sbjct: 474 IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKT-LHQEGKL 532

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             MVD  ++  F + +  +++++A+LCT   P+ RP M  V++MLE
Sbjct: 533 NLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLE 578



 Score = 60.1 bits (144), Expect(2) = 1e-21
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S   T   + GT G+IAP
Sbjct: 423 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVST--AVRGTVGHIAP 476



>gb:CQ768569_1451802 Sequence 64 from Patent WO2004007712.
          Length = 625

 Score = 64.3 bits (155), Expect(2) = 1e-21
 Identities = 36/106 (33%), Positives = 65/106 (61%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN--NDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E     N    I+ WV  KL+ ++ +
Sbjct: 468 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK-KLQQEKKL 526

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  ++  + + +  +++++A+LCT  LP  RP M  VV+MLE
Sbjct: 527 EQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLE 572



 Score = 62.0 bits (149), Expect(2) = 1e-21
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLD++F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 417 CDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEES--HVTTAVRGTVGHIAP 470



>gb:AX120073_1461716 Sequence 56 from Patent WO0129240.
          Length = 601

 Score = 64.3 bits (155), Expect(2) = 1e-21
 Identities = 36/106 (33%), Positives = 65/106 (61%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN--NDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E     N    I+ WV  KL+ ++ +
Sbjct: 444 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAILDWVK-KLQQEKKL 502

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  ++  + + +  +++++A+LCT  LP  RP M  VV+MLE
Sbjct: 503 EQIVDKDLKSNYDRIEVEEMVQVALLCTQYLPIHRPKMSEVVRMLE 548



 Score = 62.0 bits (149), Expect(2) = 1e-21
 Identities = 30/56 (53%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLD++F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 393 CDPKIIHRDVKAANILLDDYFEAVVGDFGLAKLLDHEES--HVTTAVRGTVGHIAP 446



>pir|A86146|A86146 hypothetical protein F22L4.8 - Arabidopsis
           thaliana>gb:AE005172_889202 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F22L4_1677883 Sequence of BAC F22L4 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 497

 Score = 70.5 bits (171), Expect(2) = 1e-21
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 3/103 (2%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESILSM 445
           EY  T  + EKSD+YSFG+++ME+++G+ P++     GE N +V W+ + + ++ S   +
Sbjct: 351 EYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETN-LVDWLKSMVGNRRS-EEV 408

Query: 444 VDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           VD  I EP    A+K VL +A+ C     N RP M  ++ MLE
Sbjct: 409 VDPKIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 451



 Score = 55.8 bits (133), Expect(2) = 1e-21
 Identities = 27/52 (51%), Positives = 37/52 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++HRD+KSSNILLD  +  +++DFGLAK+L   SS   T   + GT GY+AP
Sbjct: 301 VVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTR--VMGTFGYVAP 350



>gb:AY093964_1575470 Arabidopsis thaliana At1g01540/F22L4_6 mRNA,
           complete cds.>gb:AF367265_1791718 Arabidopsis thaliana
           At1g01540/F22L4_6 mRNA, complete cds.
          Length = 479

 Score = 70.5 bits (171), Expect(2) = 1e-21
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 3/103 (2%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESILSM 445
           EY  T  + EKSD+YSFG+++ME+++G+ P++     GE N +V W+ + + ++ S   +
Sbjct: 326 EYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETN-LVDWLKSMVGNRRS-EEV 383

Query: 444 VDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           VD  I EP    A+K VL +A+ C     N RP M  ++ MLE
Sbjct: 384 VDPKIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 426



 Score = 55.8 bits (133), Expect(2) = 1e-21
 Identities = 27/52 (51%), Positives = 37/52 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++HRD+KSSNILLD  +  +++DFGLAK+L   SS   T   + GT GY+AP
Sbjct: 276 VVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTR--VMGTFGYVAP 325



>gb:ATY12776_1557476 Arabidopsis thaliana DNA, 40 kb surrounding
           ACS1 locus.>gb:AF332429_1787241 Arabidopsis thaliana
           clone C00102 (h) putative protein serine/threonine
           kinase (At1g01540) mRNA, complete cds.
          Length = 472

 Score = 70.5 bits (171), Expect(2) = 1e-21
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 3/103 (2%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESILSM 445
           EY  T  + EKSD+YSFG+++ME+++G+ P++     GE N +V W+ + + ++ S   +
Sbjct: 326 EYACTGMLNEKSDIYSFGILIMEIITGRNPVDYSRPQGETN-LVDWLKSMVGNRRS-EEV 383

Query: 444 VDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
           VD  I EP    A+K VL +A+ C     N RP M  ++ MLE
Sbjct: 384 VDPKIPEPPSSKALKRVLLVALRCVDPDANKRPKMGHIIHMLE 426



 Score = 55.8 bits (133), Expect(2) = 1e-21
 Identities = 27/52 (51%), Positives = 37/52 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++HRD+KSSNILLD  +  +++DFGLAK+L   SS   T   + GT GY+AP
Sbjct: 276 VVHRDIKSSNILLDRQWNAKVSDFGLAKLLGSESSYVTTR--VMGTFGYVAP 325



>gb:AY085009_1570091 Arabidopsis thaliana clone 124301 mRNA,
           complete sequence.
          Length = 393

 Score = 69.3 bits (168), Expect(2) = 1e-21
 Identities = 35/107 (32%), Positives = 63/107 (58%), Gaps = 1/107 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYG-ENNDIVSWVSTKLKSKESIL 451
           L  EY    ++ +K+DVYSFG++++E++SG     A +G E   +V WV  KL+ +  +L
Sbjct: 215 LAPEYALLGQLTKKADVYSFGILVLEVISGNSSTRAAFGDEYMVLVEWV-WKLREERRLL 273

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             VD  + +   ++  + +++A+ CT A    RP M++V++ML   E
Sbjct: 274 ECVDPELTKFPADEVTRFIKVALFCTQAAAQKRPNMKQVMEMLRRKE 320



 Score = 57.0 bits (136), Expect(2) = 1e-21
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           ++HRD+K+SNILLD  F P+I DFGLAK+   N      THV   + GT GY+AP
Sbjct: 168 VVHRDIKASNILLDSNFSPKIGDFGLAKLFPDN-----VTHVSTRVAGTVGYLAP 217



>gb:ATAC009326_1542913 Arabidopsis thaliana chromosome III P1 MZB10
           genomic sequence, complete sequence.
          Length = 383

 Score = 69.3 bits (168), Expect(2) = 1e-21
 Identities = 35/107 (32%), Positives = 63/107 (58%), Gaps = 1/107 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYG-ENNDIVSWVSTKLKSKESIL 451
           L  EY    ++ +K+DVYSFG++++E++SG     A +G E   +V WV  KL+ +  +L
Sbjct: 205 LAPEYALLGQLTKKADVYSFGILVLEVISGNSSTRAAFGDEYMVLVEWV-WKLREERRLL 263

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             VD  + +   ++  + +++A+ CT A    RP M++V++ML   E
Sbjct: 264 ECVDPELTKFPADEVTRFIKVALFCTQAAAQKRPNMKQVMEMLRRKE 310



 Score = 57.0 bits (136), Expect(2) = 1e-21
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           ++HRD+K+SNILLD  F P+I DFGLAK+   N      THV   + GT GY+AP
Sbjct: 158 VVHRDIKASNILLDSNFSPKIGDFGLAKLFPDN-----VTHVSTRVAGTVGYLAP 207



>gb:AX038195_1457677 Sequence 10 from Patent WO0060086.
          Length = 383

 Score = 69.3 bits (168), Expect(2) = 1e-21
 Identities = 35/107 (32%), Positives = 63/107 (58%), Gaps = 1/107 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYG-ENNDIVSWVSTKLKSKESIL 451
           L  EY    ++ +K+DVYSFG++++E++SG     A +G E   +V WV  KL+ +  +L
Sbjct: 205 LAPEYALLGQLTKKADVYSFGILVLEVISGNSSTRAAFGDEYMVLVEWV-WKLREERRLL 263

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
             VD  + +   ++  + +++A+ CT A    RP M++V++ML   E
Sbjct: 264 ECVDPELTKFPADEVTRFIKVALFCTQAAAQKRPNMKQVMEMLRRKE 310



 Score = 57.0 bits (136), Expect(2) = 1e-21
 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           ++HRD+K+SNILLD  F P+I DFGLAK+   N      THV   + GT GY+AP
Sbjct: 158 VVHRDIKASNILLDSNFSPKIGDFGLAKLFPDN-----VTHVSTRVAGTVGYLAP 207



>gb:AB125885_1528227 Ipomoea batatas SRF6 mRNA for putative
           serine/threonine protein kinase, partial cds.
          Length = 232

 Score = 66.2 bits (160), Expect(2) = 1e-21
 Identities = 37/106 (34%), Positives = 65/106 (61%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND--IVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G+K ++   G N    I+ WV T L  +  +
Sbjct: 79  IAPEYLSTGQSSEKTDVFGFGILLLELITGQKAVDFGRGANQKGVILDWVKT-LHQEGKL 137

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             MVD  ++  F + +  +++++A+LCT   P+ RP M  V++MLE
Sbjct: 138 NLMVDKDLKNNFDRVELEEMVQVALLCTQFNPSHRPKMSEVLRMLE 183



 Score = 60.1 bits (144), Expect(2) = 1e-21
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S   T   + GT G+IAP
Sbjct: 28  CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVST--AVRGTVGHIAP 81



>gb:OSJN00165_1696020 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0029L02, complete sequence.
          Length = 861

 Score = 72.4 bits (176), Expect(2) = 1e-21
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 1/113 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY     + EK+DV++FGVV++E V+G+        EN   +   +  +  K+  L 
Sbjct: 716  LAPEYAMRGHLSEKADVFAFGVVMLETVAGRPNTNNSLEENKIYLLEWAWGMYDKDQALE 775

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML-EDAEPCKLVS 292
            +VD  I++  K++A +V+ +A+LCT   P+ RP M RVV ML  D +  K+V+
Sbjct: 776  IVDPTIKDFDKDEAFRVINVALLCTQGSPHQRPPMSRVVAMLTRDVDVPKVVT 828



 Score = 53.5 bits (127), Expect(2) = 1e-21
 Identities = 26/52 (50%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SN+LLD    P+I+DFGLAK+  Y+      +  I GT GY+AP
Sbjct: 669 IVHRDIKASNVLLDTDLTPKISDFGLAKL--YDEKQTHVSTRIAGTLGYLAP 718



>gb:AP005457_1852178 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0532H03.
          Length = 776

 Score = 68.6 bits (166), Expect(2) = 1e-21
 Identities = 36/107 (33%), Positives = 65/107 (60%), Gaps = 4/107 (3%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEA---EYGENNDIVSWV-STKLKSKESIL 451
           EYG       + DVYSFGVVL+EL++G++P+EA    +G+  ++V WV   +L+ +++  
Sbjct: 667 EYGQAWVATRRGDVYSFGVVLLELLTGRRPVEAASPPHGQQRELVRWVLQMRLQGRQA-- 724

Query: 450 SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
            ++D+ +    +   + VL +A LC  + P SRP ++ VV  L++ +
Sbjct: 725 EVLDTRLSGGNEAQMLYVLDLACLCVDSTPFSRPAIQEVVSWLDNVD 771



 Score = 57.4 bits (137), Expect(2) = 1e-21
 Identities = 31/59 (52%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           C   I+HRD+KSSNILLDE  + R+ADFGLA+++       D THV   + GT GYI P
Sbjct: 613 CKPQIVHRDIKSSNILLDEAGEARVADFGLARLI-----LPDRTHVTTELVGTPGYIPP 666



>gb:AY162176_1585779 Medicago truncatula somatic embryogenesis
           receptor kinase 1 (SERK1) mRNA, complete
           cds.>gb:AY162177_1585780 Medicago truncatula somatic
           embryogenesis receptor kinase 1 (SERK1) gene, complete
           cds.
          Length = 627

 Score = 64.7 bits (156), Expect(2) = 1e-21
 Identities = 36/107 (33%), Positives = 65/107 (60%), Gaps = 4/107 (3%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKES 457
           +  EY  T K  EK+DV+ +G++L+EL++G++  +     N+D   ++ WV   LK K+ 
Sbjct: 474 IAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKK- 532

Query: 456 ILSMVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +  +VD  ++  + E  + +++++A+LCT   P  RP M  VV+MLE
Sbjct: 533 LEMLVDPDLKTNYIEAEVEQLIQVALLCTQGSPMDRPKMSDVVRMLE 579



 Score = 61.2 bits (147), Expect(2) = 1e-21
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT--THVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK++ Y    KDT  T  + GT G+IAP
Sbjct: 423 CDPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDY----KDTHVTTAVRGTIGHIAP 476



>pir|E84846|E84846 probable receptor-like protein kinase [imported] -
            Arabidopsis thaliana>gb:AC002339_1530506 Arabidopsis
            thaliana chromosome 2 clone T11A7 map CIC11C08, complete
            sequence.
          Length = 890

 Score = 87.8 bits (216), Expect(2) = 2e-21
 Identities = 41/109 (37%), Positives = 69/109 (63%), Gaps = 3/109 (2%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWV---STKLKSKESILS 448
            EY YT +V    +VYS+GVVL+E+++ + P+E E+GE  D+V WV   S + ++ E IL 
Sbjct: 782  EYAYTMQVTAPGNVYSYGVVLLEILTSRAPVEEEFGEGVDLVKWVHGASARGETPEQILD 841

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCK 301
               S +   ++ + +  L++A+LCT   P  RP M++VV+ML++ +  K
Sbjct: 842  AKLSTVSFAWRREMLAALKVALLCTDITPAKRPKMKKVVEMLQEVKQIK 890



 Score = 37.7 bits (86), Expect(2) = 2e-21
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIH DV SSN+LLD  +K  + +  ++K+L  +      + V  G+ GYI P
Sbjct: 731 IIHLDVSSSNVLLDSGYKAVLGEIEISKLLDPSRGTASISSV-AGSFGYIPP 781



>gb:AP004121_1837906 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1442_E05.
          Length = 1060

 Score = 67.0 bits (162), Expect(2) = 2e-21
 Identities = 35/103 (33%), Positives = 65/103 (63%), Gaps = 3/103 (2%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESILSM 445
            EYG++     + DVYS GVVL+ELV+G++P++     G   D+ SW + +++ +     +
Sbjct: 951  EYGHSSVATYRGDVYSLGVVLLELVTGRRPVDMARPAGGGRDVTSW-ALRMRREARGDEV 1009

Query: 444  VDSAIQE-PFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            VD+++ E   +++A +VL +A  C +  P SRPT +++V+ L+
Sbjct: 1010 VDASVGERRHRDEACRVLDVACACVSDNPKSRPTAQQLVEWLD 1052



 Score = 58.2 bits (139), Expect(2) = 2e-21
 Identities = 28/56 (50%), Positives = 40/56 (71%)
 Frame = -1

Query: 884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
            ++HRD+KSSNILLD   +PR+ADFGLA++++ +     TT ++ GT GYI P   H
Sbjct: 900  VLHRDIKSSNILLDARLEPRLADFGLARLVRAHDDTHVTTDLV-GTLGYIPPEYGH 954



>gb:AP003858_1834409 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1014_H11.
          Length = 1023

 Score = 70.9 bits (172), Expect(2) = 2e-21
 Identities = 42/117 (35%), Positives = 65/117 (55%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY     + EK DV+SFGVV +E V+G+   +    E+   +   +  L  +E  L 
Sbjct: 857  LAPEYAMRGHLTEKVDVFSFGVVALETVAGRSNTDYSLVEDKKYLFEWAWGLYEREQALG 916

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSK 277
            +VD  ++E  +E+ ++V+R++ LCT   P+ RP M RVV ML    P   VS +V+K
Sbjct: 917  IVDPRLEEINEEEVLRVIRMSFLCTQGSPHQRPPMSRVVAMLTGDIP---VSDVVAK 970



 Score = 54.3 bits (129), Expect(2) = 2e-21
 Identities = 26/52 (50%), Positives = 35/52 (67%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SNILLD    P+I+DFGLAK+  Y+         + GT GY+AP
Sbjct: 810 IVHRDIKASNILLDPDLTPKISDFGLAKL--YDEKKTHVNTKVAGTFGYLAP 859



>gb:AF285172_1783120 Phaseolus vulgaris leaf senescence-associated
            receptor-like protein kinase (SARK) mRNA, complete cds.
          Length = 904

 Score = 64.3 bits (155), Expect(2) = 2e-21
 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 1/108 (0%)
 Frame = -3

Query: 636  PIKLVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKES 457
            P  L  +Y    ++ EKSDVYSFGVVL+E+++G+  I A   E + I+ WV + L +   
Sbjct: 765  PGYLDPDYYTNNRLTEKSDVYSFGVVLLEIITGQLVI-ARNEERSHIIEWVRS-LVAIGD 822

Query: 456  ILSMVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            I ++VDS ++  F    A K + IA+ C +  PN RP M  VV  L++
Sbjct: 823  IKAIVDSRLEGDFDINSAWKAVEIAMACVSLRPNQRPIMSVVVFELKE 870



 Score = 60.8 bits (146), Expect(2) = 2e-21
 Identities = 30/56 (53%), Positives = 42/56 (75%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  PIIHRDVKSSNILL+E F+ +++DFGL+KI+  + +   +T V+ GT GY+ P
Sbjct: 716 CKPPIIHRDVKSSNILLNEHFQAKLSDFGLSKIIPDDGASHLST-VVAGTPGYLDP 770



>gb:AC134931_1741947 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0079L11, complete sequence.
          Length = 771

 Score = 66.6 bits (161), Expect(2) = 2e-21
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
           L  EY  T +  E +DV+SFG +++E+  G++PI A  G  N++V WV   L     +L 
Sbjct: 589 LAPEYLLTGRATEATDVFSFGALVLEVACGRRPIGATEGRCNNLVEWV-WSLHGAGQVLD 647

Query: 447 MVDSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQML-EDAEP 307
            VD+ ++  + E +  + + + + C++  P  RP MR VVQML  +A+P
Sbjct: 648 AVDARLRGEYDEAEMRRAMLVGLACSSPEPALRPGMRAVVQMLGGEADP 696



 Score = 58.5 bits (140), Expect(2) = 2e-21
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+R +IHRDVKSSN++LD+ ++ R+ DFGLA+  ++  S   T     GT GY+AP
Sbjct: 538 CERRVIHRDVKSSNVMLDDAYRARLGDFGLARQAEHGESPDAT--AAAGTMGYLAP 591



>gb:AC079357_1732541 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0033D06, complete sequence.
          Length = 702

 Score = 67.0 bits (162), Expect(2) = 2e-21
 Identities = 42/139 (30%), Positives = 79/139 (56%), Gaps = 8/139 (5%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY    ++ EK+D+YS+GV+++E+++G+K +   A   E + ++S +  K  ++ ++
Sbjct: 516 MAPEYIVHGQLTEKADIYSYGVLVLEIITGRKSLNSVASSAEGHSLMSLI-WKHYNEGTL 574

Query: 453 LSMVDSAIQEPFKED-AIKVLRIAILCTAALPNSRPTMRRVVQML-----EDAEPCKLVS 292
           + ++D  +QE   E+ A+KV  + +LC  A PN RP M +VV+ML     E   P +   
Sbjct: 575 MELLDPNLQEQCTEEGALKVFHVGLLCAQASPNLRPPMWKVVEMLGSRNNELPRPTQPPF 634

Query: 291 IIVSKDAAKLDNPSDNTSK 235
           I +    AK D+   ++ K
Sbjct: 635 INIKGSNAKSDSSGSSSLK 653



 Score = 58.2 bits (139), Expect(2) = 2e-21
 Identities = 29/52 (55%), Positives = 38/52 (73%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+K+SN+LLDE F+P+IADFGLA+    + S   T   + GT GY+AP
Sbjct: 469 IIHRDIKASNVLLDERFRPKIADFGLARNFMEDQSHLSTG--LAGTFGYMAP 518



>gb:AP005533_1853634 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0018M09.
          Length = 607

 Score = 67.0 bits (162), Expect(2) = 2e-21
 Identities = 36/106 (33%), Positives = 67/106 (63%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESI 454
           +  EY  T K  E++DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ +  +
Sbjct: 454 IAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLQREGQL 513

Query: 453 LSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
            S+VD  + + + ++ ++ +++IA+LCT + P  RP+M  VV+MLE
Sbjct: 514 GSIVDRNLNQNYDDEEVEMMIQIALLCTQSSPEDRPSMSEVVRMLE 559



 Score = 58.2 bits (139), Expect(2) = 2e-21
 Identities = 28/56 (50%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+P + DFGLAK++    +    T  + GT G+IAP
Sbjct: 403 CNPKIIHRDVKAANVLLDEDFEPVVGDFGLAKLVDVQKT--SVTTQVRGTMGHIAP 456



>gb:AE016959_1023140 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC051632_1540141
           Oryza sativa chromosome 10 BAC OSJNBa0012L23 genomic
           sequence, complete sequence.>gb:AE017106_1752959 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           60 of 77 of the complete sequence.
          Length = 373

 Score = 67.0 bits (162), Expect(2) = 2e-21
 Identities = 36/101 (35%), Positives = 62/101 (61%), Gaps = 2/101 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
           EY    ++ EK D YSFGVV++E++SG+K  +A    ++  +   + KL    +++ +VD
Sbjct: 226 EYAIHGQLSEKVDTYSFGVVVLEIISGRKLNDARLDPDSQYLLEWAWKLYENNNLIELVD 285

Query: 438 SAI--QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            ++  +E   E+  K+++IA+LCT +   SRPTM  VV +L
Sbjct: 286 KSLDPKEYNPEEVKKIIQIALLCTQSAVASRPTMSEVVVLL 326



 Score = 58.2 bits (139), Expect(2) = 2e-21
 Identities = 30/52 (57%), Positives = 38/52 (73%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+KSSN+LLD+ F+P+IADFGLA++L  + S   T     GT GY AP
Sbjct: 176 IIHRDIKSSNVLLDDEFQPKIADFGLARLLPDDHSHLSTK--FAGTLGYTAP 225



>gb:AP004739_1844116 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0090E14.
          Length = 1041

 Score = 64.7 bits (156), Expect(2) = 3e-21
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 1/103 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EYGY+++V EK DVYSFGVVL+EL +GK  +  +   +  +  W   + +       
Sbjct: 883  MAPEYGYSKRVNEKVDVYSFGVVLLELTTGK--VANDAAADFCLAEWAWRRYQKGPPFDD 940

Query: 447  MVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            ++D+ I+E     D + V  + ++CT   P +RP+M+ V+  L
Sbjct: 941  VIDADIREQASLPDIMSVFTLGVICTGENPPARPSMKEVLHHL 983



 Score = 60.1 bits (144), Expect(2) = 3e-21
 Identities = 31/56 (55%), Positives = 40/56 (71%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C + I+HRDVKSSNILLD  F+ +IADFGLA++L   S   ++   I GT GY+AP
Sbjct: 831 CAQAIVHRDVKSSNILLDPEFQAKIADFGLARML-VKSGEPESVSAIGGTFGYMAP 885



>gb:OSJN00093_1694778 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 948

 Score = 70.1 bits (170), Expect(2) = 3e-21
 Identities = 38/113 (33%), Positives = 66/113 (58%), Gaps = 1/113 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY    ++ EK DV++FGVVL+E+++G+   +    E+   +   +  L    + L 
Sbjct: 789  LAPEYAMRGRMTEKVDVFAFGVVLLEILAGRPNYDDALEEDKIYIFEWAWDLYENNNPLG 848

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVS 292
            +VD  ++E  +E+ ++ +R+A+LCT   P+ RP M RVV ML  D E  ++V+
Sbjct: 849  LVDPKLEEFNREEVLRAIRVALLCTQGSPHQRPPMSRVVTMLAGDVEAPEVVT 901



 Score = 54.7 bits (130), Expect(2) = 3e-21
 Identities = 25/52 (48%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD+K+SN+LLD    P+I+DFGLAK+  Y+      +  + GT GY+AP
Sbjct: 742 VIHRDIKASNVLLDANLNPKISDFGLAKL--YDDKKTHVSTKVAGTFGYLAP 791



>gb:AP003237_1825950 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0046E05.
          Length = 682

 Score = 67.4 bits (163), Expect(2) = 3e-21
 Identities = 43/111 (38%), Positives = 66/111 (59%), Gaps = 8/111 (7%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND-IVSW---VSTKLKSKE 460
           L  EY  T KV ++SDV+SFGV+L+EL++GKKPI   +G+  D +VSW   +  +   +E
Sbjct: 461 LAPEYAATGKVNDRSDVFSFGVMLLELITGKKPIMVSHGDQPDTLVSWARPLLVRAVEEE 520

Query: 459 SILSMVDSAIQEPFKEDAIKVLRIAILCTAA----LPNSRPTMRRVVQMLE 319
           +   +VD  ++  +  DA  + R+ I C AA       SRP M ++V+ LE
Sbjct: 521 NFEELVDPRLENNY--DAYDMGRL-IACAAAAVRHTARSRPRMSQIVRYLE 568



 Score = 57.4 bits (137), Expect(2) = 3e-21
 Identities = 28/56 (50%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRD+K++NILLD  F+P++ADFGLAK      +   T   + GT GY+AP
Sbjct: 410 CHPKIIHRDIKAANILLDYTFEPKVADFGLAKYQATEQTAVSTR--VMGTFGYLAP 463



>gb:AC134344_1741747 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0059K16, complete
           sequence.>gb:AC136224_1743126 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0006B22,
           complete sequence.
          Length = 478

 Score = 69.7 bits (169), Expect(2) = 3e-21
 Identities = 40/109 (36%), Positives = 62/109 (56%), Gaps = 2/109 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
           EY    K+ EKSDVY+FGVVL+EL+ G+KP+E     +   IV+W   +L  +  + S+V
Sbjct: 351 EYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVTWAMPQLTDRSKLPSIV 410

Query: 441 DSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL 298
           D  I++    +   +V  +A+LC  A P+ RP +  V+  L    P +L
Sbjct: 411 DPVIKDTMDPKHLYQVAAVAVLCVQAEPSYRPLITDVLHSLVPLVPTEL 459



 Score = 55.1 bits (131), Expect(2) = 3e-21
 Identities = 29/56 (51%), Positives = 36/56 (64%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C  P+IHRD+KSSNILLD  F  +IADFGLA     + S    +  + GT GY+AP
Sbjct: 298 CSPPVIHRDLKSSNILLDSDFNAKIADFGLA---VSSGSVNKGSVKLSGTLGYVAP 350



>gb:AP004006_1836240 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1197_D06.
          Length = 1274

 Score = 74.3 bits (181), Expect(2) = 4e-21
 Identities = 37/106 (34%), Positives = 60/106 (56%), Gaps = 4/106 (3%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKS----KE 460
            +  E GY+ K  EKSDVYS G+V+MELV+G  P +  +G + D+V WV +++++    +E
Sbjct: 1154 MAPECGYSLKTTEKSDVYSMGIVMMELVTGLTPTDKAFGGDVDMVRWVQSRVEAPSPGRE 1213

Query: 459  SILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
             +       +    +    +VL +A+ CT   P  RPT R+V  +L
Sbjct: 1214 QVFDPALKPLAPREESSMTEVLEVALRCTRTAPGERPTARQVSDLL 1259



 Score = 50.1 bits (118), Expect(2) = 4e-21
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYN-SSCKDTTHVIPGTHGYIAP 729
            C   ++HRD+KSSN+LLD   +  + DFGLAK +  N     D+     G++GY+AP
Sbjct: 1100 CVPRVVHRDIKSSNVLLDGDMEAHLGDFGLAKSVADNRKDFTDSASCFAGSYGYMAP 1156



>gb:AE005173_894394 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC008113_1536528 Genomic sequence
            for Arabidopsis thaliana BAC F12A21 from chromosome I,
            complete sequence.
          Length = 1184

 Score = 74.3 bits (181), Expect(2) = 4e-21
 Identities = 41/104 (39%), Positives = 65/104 (62%), Gaps = 2/104 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESILSMV 442
            EY  +Q++ EKSDVYSFGVVL EL+SGKKP+ AE +G   +IV W  + ++ K  +  ++
Sbjct: 748  EYYASQQLTEKSDVYSFGVVLFELLSGKKPVSAEDFGPELNIVHWARSLIR-KGDVCGII 806

Query: 441  DSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLEDA 313
            D  I    K +++ +V  +A  C     ++RP M+ V+  ++DA
Sbjct: 807  DPCIASNVKIESVWRVAEVANQCVEQRGHNRPRMQEVIVAIQDA 850



 Score = 50.1 bits (118), Expect(2) = 4e-21
 Identities = 26/56 (46%), Positives = 35/56 (62%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVKSSNILLD   + +++DFGL++  Q        + V  GT GY+ P
Sbjct: 694 CNPSIIHRDVKSSNILLDINMRAKVSDFGLSR--QTEEDLTHVSSVAKGTVGYLDP 747



>gb:AY714491_1624022 Oryza sativa (indica cultivar-group) clone
            OsInlk2 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625384 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1046

 Score = 68.9 bits (167), Expect(2) = 4e-21
 Identities = 37/101 (36%), Positives = 61/101 (60%), Gaps = 1/101 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       + DVYSFGVVL+EL++G++P+      + ++V WV  +++SK ++L ++D
Sbjct: 943  EYGQAWVATLRGDVYSFGVVLLELLTGRRPVSI-LSTSKELVPWV-LEMRSKGNLLEVLD 1000

Query: 438  SAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
              +    ++E  +KVL +A  C    P  RPT+R VV  L+
Sbjct: 1001 PTLHGTGYEEQMLKVLEVACKCVNCNPCMRPTIREVVSCLD 1041



 Score = 55.5 bits (132), Expect(2) = 4e-21
 Identities = 28/56 (50%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRD+KSSNILLD+ FK  +ADFGL++++  N +    T  + GT GYI P
Sbjct: 889  CKPHIVHRDIKSSNILLDKEFKAYVADFGLSRLILPNKN--HVTTELVGTLGYIPP 942



>gb:OSJN00093_1694776 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0093O08, complete sequence.
          Length = 1028

 Score = 67.8 bits (164), Expect(2) = 4e-21
 Identities = 36/102 (35%), Positives = 59/102 (57%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY    ++ EK DV++FGVVL+E ++G+   +    E+   +   + +L      L 
Sbjct: 869  LAPEYAMRGRLTEKVDVFAFGVVLLETLAGRPNYDDALEEDKIYIFEWAWELYENNYPLG 928

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            +VD  + E   E+A++ +R+A+LCT   P+ RP+M RVV ML
Sbjct: 929  VVDPRLTEYDGEEALRAIRVALLCTQGSPHQRPSMSRVVTML 970



 Score = 56.6 bits (135), Expect(2) = 4e-21
 Identities = 24/52 (46%), Positives = 37/52 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++HRD+K+SN+LLD +  P+I+DFGLAK+  Y+      +  + GT GY+AP
Sbjct: 822 VVHRDIKASNVLLDAYLNPKISDFGLAKL--YDDKKTHVSTKVAGTFGYLAP 871



>gb:AY332474_1600056 Oryza sativa (japonica cultivar-group)
            transmembrane protein kinase (PK3) mRNA, complete cds.
          Length = 999

 Score = 69.3 bits (168), Expect(2) = 4e-21
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 2/121 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EY  T ++ EKSDVYSFG+VL+EL++GKK ++ E   +  I+S          +++  VD
Sbjct: 843  EYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQLILS-----KADDNTVMEAVD 897

Query: 438  SAIQEPFKEDAI--KVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK 265
            S +     +  +  K  ++A+LCT   P+ RPTM  V ++L    P   ++   + D ++
Sbjct: 898  SEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVLLSLLPASAMTTPKTVDYSR 957

Query: 264  L 262
            L
Sbjct: 958  L 958



 Score = 55.1 bits (131), Expect(2) = 4e-21
 Identities = 30/56 (53%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVKSSNILLDE F+  ++DFG+AK +  ++    +T+V+ GT GYI P
Sbjct: 789 CNPRIIHRDVKSSNILLDENFEAHLSDFGIAKCVP-SAKSHASTYVL-GTIGYIDP 842



>gb:AP000391_1819980 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0538C01.>gb:AP000559_1820304 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6,
            clone:P0493C11.
          Length = 980

 Score = 69.3 bits (168), Expect(2) = 4e-21
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 2/121 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EY  T ++ EKSDVYSFG+VL+EL++GKK ++ E   +  I+S          +++  VD
Sbjct: 824  EYARTSRLNEKSDVYSFGIVLLELLTGKKAVDNESNLHQLILS-----KADDNTVMEAVD 878

Query: 438  SAIQEPFKEDAI--KVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAAK 265
            S +     +  +  K  ++A+LCT   P+ RPTM  V ++L    P   ++   + D ++
Sbjct: 879  SEVSVTCTDMGLVRKAFQLALLCTKRHPSDRPTMHEVARVLLSLLPASAMTTPKTVDYSR 938

Query: 264  L 262
            L
Sbjct: 939  L 939



 Score = 55.1 bits (131), Expect(2) = 4e-21
 Identities = 30/56 (53%), Positives = 41/56 (73%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVKSSNILLDE F+  ++DFG+AK +  ++    +T+V+ GT GYI P
Sbjct: 770 CNPRIIHRDVKSSNILLDENFEAHLSDFGIAKCVP-SAKSHASTYVL-GTIGYIDP 823



>pir|T51383|T51383 receptor protein kinase-like protein -
           Arabidopsis thaliana>gb:CQ768557_1451796 Sequence 52
           from Patent WO2004007712.>gb:ATF1N13_1549389 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F1N13 (ESSA
           project).>gb:AY074263_1567425 Arabidopsis thaliana
           putative receptor protein kinase (At5g16000) mRNA,
           complete cds.>gb:BT002366_1635969 Arabidopsis thaliana
           clone U19571 putative receptor protein kinase
           (At5g16000) mRNA, complete cds.
          Length = 638

 Score = 65.5 bits (158), Expect(2) = 4e-21
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 5/108 (4%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND--IVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+ELV+G++  E     N    ++ WV  K+  ++ +
Sbjct: 478 IAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVK-KIHQEKKL 536

Query: 453 LSMVDSAIQEPFKEDAI---KVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  + +    D I   +++R+A+LCT  LP  RP M  VV+MLE
Sbjct: 537 ELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLE 584



 Score = 58.9 bits (141), Expect(2) = 4e-21
 Identities = 29/56 (51%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLD++ +  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 427 CDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDS--HVTTAVRGTVGHIAP 480



>gb:AY088040_1573064 Arabidopsis thaliana clone 40594 mRNA, complete
           sequence.
          Length = 629

 Score = 65.5 bits (158), Expect(2) = 4e-21
 Identities = 38/108 (35%), Positives = 63/108 (58%), Gaps = 5/108 (4%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND--IVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+ELV+G++  E     N    ++ WV  K+  ++ +
Sbjct: 469 IAPEYLSTGQSSEKTDVFGFGILLLELVTGQRAFEFGKAANQKGVMLDWVK-KIHQEKKL 527

Query: 453 LSMVDSAIQEPFKEDAI---KVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  + +    D I   +++R+A+LCT  LP  RP M  VV+MLE
Sbjct: 528 ELLVDKELLKKKSYDEIELDEMVRVALLCTQYLPGHRPKMSEVVRMLE 575



 Score = 58.9 bits (141), Expect(2) = 4e-21
 Identities = 29/56 (51%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLD++ +  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 418 CDPKIIHRDVKAANILLDDYCEAVVGDFGLAKLLDHQDS--HVTTAVRGTVGHIAP 471



>gb:AC008262_1536615 Genomic sequence for Arabidopsis thaliana BAC
            F4N2 from chromosome I, complete sequence.
          Length = 857

 Score = 70.9 bits (172), Expect(2) = 5e-21
 Identities = 36/110 (32%), Positives = 64/110 (58%), Gaps = 3/110 (2%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN---DIVSWVSTKLKSKESILS 448
            EY  T +V EK+DVYS+G+VL+EL+S K+ ++  +  +    +IVSW    L   ++   
Sbjct: 748  EYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEV 807

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL 298
                  +    +D ++VL +A+ CT    + RPTM++ V++L+  +P +L
Sbjct: 808  FTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRIQPSRL 857



 Score = 53.1 bits (126), Expect(2) = 5e-21
 Identities = 25/56 (44%), Positives = 36/56 (64%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   ++HRD+K SNILLD  +   ++DFGL+K+L   +S    T  + GT GY+AP
Sbjct: 694 CSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLL--GTSQSHVTTGVAGTFGYVAP 747



>gb:AC087553_1734111 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0685E10, complete sequence.
          Length = 685

 Score = 66.2 bits (160), Expect(2) = 5e-21
 Identities = 40/126 (31%), Positives = 73/126 (57%), Gaps = 4/126 (3%)
 Frame = -3

Query: 630 KLVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEA---EYGENNDIVSWVSTKLKSKE 460
           ++  EY  T +  EK+DVY FG +L+EL++G+K +E    EY E   I+ W    L+  +
Sbjct: 454 RIPPEYLMTGQTSEKTDVYGFGFLLIELITGRKTMELHEDEYQEGG-ILDWAKELLEGNK 512

Query: 459 SILSMVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIV 283
            + S VDS +++ +   +  ++++IA+LCT   P+ RP+M  +  ML++++   +     
Sbjct: 513 -LRSFVDSRLRDNYVIAELEEMVKIALLCTMYNPDQRPSMAEIAGMLQESDGSVVEKWET 571

Query: 282 SKDAAK 265
            KDA +
Sbjct: 572 LKDAER 577



 Score = 57.8 bits (138), Expect(2) = 5e-21
 Identities = 28/56 (50%), Positives = 36/56 (64%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRD+K+SN+LLDE+F+  +ADFGL K+L          H + GT G I P
Sbjct: 411 CDPKIIHRDIKASNVLLDEYFEAVVADFGLVKLLD---------HAVRGTMGRIPP 457



>gb:AB013395_1512172 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQN23.
          Length = 617

 Score = 68.9 bits (167), Expect(2) = 5e-21
 Identities = 37/99 (37%), Positives = 62/99 (62%), Gaps = 3/99 (3%)
 Frame = -3

Query: 606 TQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESILSMVDSA 433
           T K  EK+DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +  +VD  
Sbjct: 471 TGKSSEKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKK 530

Query: 432 IQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + E + KE+   ++++A+LCT A P  RP M  VV+MLE
Sbjct: 531 LDEDYIKEEVEMMIQVALLCTQAAPEERPAMSEVVRMLE 569



 Score = 55.1 bits (131), Expect(2) = 5e-21
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 413 CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 466



>gb:CQ768547_1451791 Sequence 42 from Patent WO2004007712.
          Length = 618

 Score = 68.9 bits (167), Expect(2) = 5e-21
 Identities = 37/99 (37%), Positives = 62/99 (62%), Gaps = 3/99 (3%)
 Frame = -3

Query: 606 TQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESILSMVDSA 433
           T K  EK+DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +  +VD  
Sbjct: 472 TGKSSEKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKK 531

Query: 432 IQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + E + KE+   ++++A+LCT A P  RP M  VV+MLE
Sbjct: 532 LDEDYIKEEVEMMIQVALLCTQAAPEERPAMSEVVRMLE 570



 Score = 55.1 bits (131), Expect(2) = 5e-21
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 414 CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 467



>gb:AX138087_1462209 Sequence 33 from Patent EP1094113.
          Length = 579

 Score = 68.9 bits (167), Expect(2) = 5e-21
 Identities = 37/99 (37%), Positives = 62/99 (62%), Gaps = 3/99 (3%)
 Frame = -3

Query: 606 TQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESILSMVDSA 433
           T K  EK+DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +  +VD  
Sbjct: 433 TGKSSEKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKK 492

Query: 432 IQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + E + KE+   ++++A+LCT A P  RP M  VV+MLE
Sbjct: 493 LDEDYIKEEVEMMIQVALLCTQAAPEERPAMSEVVRMLE 531



 Score = 55.1 bits (131), Expect(2) = 5e-21
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 375 CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 428



>gb:AX120053_1461706 Sequence 36 from Patent WO0129240.
          Length = 571

 Score = 68.9 bits (167), Expect(2) = 5e-21
 Identities = 37/99 (37%), Positives = 62/99 (62%), Gaps = 3/99 (3%)
 Frame = -3

Query: 606 TQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESILSMVDSA 433
           T K  EK+DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +  +VD  
Sbjct: 425 TGKSSEKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKK 484

Query: 432 IQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + E + KE+   ++++A+LCT A P  RP M  VV+MLE
Sbjct: 485 LDEDYIKEEVEMMIQVALLCTQAAPEERPAMSEVVRMLE 523



 Score = 55.1 bits (131), Expect(2) = 5e-21
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 367 CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 420



>pir|G96716|G96716 hypothetical protein F23O10.15 [imported] -
           Arabidopsis thaliana>gb:AE005173_894537 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC018364_1538336 Arabidopsis thaliana
           chromosome 1 BAC F23O10 genomic sequence, complete
           sequence.>gb:ATU55875_1557092 Arabidopsis thaliana
           protein kinase (RPK1) mRNA, complete
           cds.>gb:AY099858_1576883 Arabidopsis thaliana receptor
           protein kinase, putative (At1g69270) mRNA, complete
           cds.>gb:BT008896_1640092 Arabidopsis thaliana At1g69270
           mRNA, complete cds.
          Length = 540

 Score = 70.9 bits (172), Expect(2) = 5e-21
 Identities = 36/110 (32%), Positives = 64/110 (58%), Gaps = 3/110 (2%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN---DIVSWVSTKLKSKESILS 448
           EY  T +V EK+DVYS+G+VL+EL+S K+ ++  +  +    +IVSW    L   ++   
Sbjct: 431 EYAMTCRVSEKADVYSYGIVLLELISDKRALDPSFSSHENGFNIVSWAHMMLSQGKAKEV 490

Query: 447 MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL 298
                 +    +D ++VL +A+ CT    + RPTM++ V++L+  +P +L
Sbjct: 491 FTTGLWETGPPDDLVEVLHLALKCTVDSLSIRPTMKQAVRLLKRIQPSRL 540



 Score = 53.1 bits (126), Expect(2) = 5e-21
 Identities = 25/56 (44%), Positives = 36/56 (64%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   ++HRD+K SNILLD  +   ++DFGL+K+L   +S    T  + GT GY+AP
Sbjct: 377 CSPKVLHRDIKPSNILLDNNYNAYLSDFGLSKLL--GTSQSHVTTGVAGTFGYVAP 430



>pir|T49152|T49152 serine/threonine-specific protein kinase-like
           protein - Arabidopsis thaliana>gb:ATT20N10_1555052
           Arabidopsis thaliana DNA chromosome 3, BAC clone T20N10.
          Length = 386

 Score = 67.0 bits (162), Expect(2) = 5e-21
 Identities = 34/101 (33%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDI-VSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYS+GVVL+EL++G+ P++ +      + VSW   +L  ++ ++ ++
Sbjct: 249 EYALTGHLTTKSDVYSYGVVLLELLTGRVPVDMKRATGEGVLVSWALPQLADRDKVVDIM 308

Query: 441 DSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           D  ++  +  ++ ++V  IA +C  A  + RP M  VVQ L
Sbjct: 309 DPTLEGQYSTKEVVQVAAIAAMCVQAEADYRPLMADVVQSL 349



 Score = 57.0 bits (136), Expect(2) = 5e-21
 Identities = 28/53 (52%), Positives = 37/53 (69%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           P+IHRD KSSNILLD  F  +++DFGLAK+    +    +T V+ GT GY+AP
Sbjct: 197 PVIHRDFKSSNILLDRNFNAKVSDFGLAKVGSDKAGGHVSTRVL-GTQGYVAP 248



>gb:AY059844_1564688 Arabidopsis thaliana receptor-like protein
           kinase (At5g65240; MQN23.19) mRNA, complete
           cds.>gb:BT006309_1639201 Arabidopsis thaliana At5g65240
           mRNA, complete cds.
          Length = 276

 Score = 68.9 bits (167), Expect(2) = 6e-21
 Identities = 37/99 (37%), Positives = 62/99 (62%), Gaps = 3/99 (3%)
 Frame = -3

Query: 606 TQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESILSMVDSA 433
           T K  EK+DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +  +VD  
Sbjct: 130 TGKSSEKTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRLEDIVDKK 189

Query: 432 IQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           + E + KE+   ++++A+LCT A P  RP M  VV+MLE
Sbjct: 190 LDEDYIKEEVEMMIQVALLCTQAAPEERPAMSEVVRMLE 228



 Score = 55.1 bits (131), Expect(2) = 6e-21
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 72  CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 125



>gb:OSJN00183_1696341 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0081C01, complete sequence.
          Length = 673

 Score = 68.2 bits (165), Expect(2) = 7e-21
 Identities = 39/109 (35%), Positives = 63/109 (57%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDI-VSWVSTKLKSKESIL 451
           L  E G+T K  + SDV++FG  ++E+  G+KP+  +  +N  + V WV  + ++  +I 
Sbjct: 520 LAPELGHTGKASKASDVFAFGAFMLEVACGRKPVAQDARDNRVVLVDWVLDRWRA-GAIT 578

Query: 450 SMVDSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
             VD  +   F E +A  VLR+ +LC+  LP +RP  R++VQ LE   P
Sbjct: 579 DTVDPRLHGDFVESEASLVLRLGLLCSHPLPGARPGTRQLVQYLEGDVP 627



 Score = 55.5 bits (132), Expect(2) = 7e-21
 Identities = 26/59 (44%), Positives = 40/59 (67%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           ++ ++HRD+K+SN+LLD     R+ DFGLA++  + +    TTHV+ GT GY+AP   H
Sbjct: 470 EQVVVHRDIKASNVLLDADMNGRLGDFGLARLYDHGTD-PHTTHVV-GTMGYLAPELGH 526



>gb:AP003770_1833317 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC
            clone:P0550B04.>gb:AP005457_1852184 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 6, PAC
            clone:P0532H03.
          Length = 1066

 Score = 66.2 bits (160), Expect(2) = 9e-21
 Identities = 37/105 (35%), Positives = 64/105 (60%), Gaps = 2/105 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEA-EYGENNDIVSWVSTKLKSKESILSMV 442
            EYG       + DVYSFGVVL+EL++G++P+EA  +G+  ++V WV  +++S+     ++
Sbjct: 960  EYGQALAATLRGDVYSFGVVLLELLTGRRPVEALPHGQQRELVRWV-LQMRSQGRHGEVL 1018

Query: 441  DSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
            D  ++    E   + VL +A LC  + P SRP ++ +V  L++ E
Sbjct: 1019 DQRLRGKGDEAQMLYVLDLACLCVDSTPLSRPAIQDIVSWLDNVE 1063



 Score = 57.0 bits (136), Expect(2) = 9e-21
 Identities = 31/59 (52%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
            C   I+HRD+KSSNILLDE  + R+ADFGLA+++       D THV   + GT GYI P
Sbjct: 906  CKPQIVHRDIKSSNILLDEAGEARVADFGLARLI-----LPDRTHVTTELVGTLGYIPP 959



>gb:AP003858_1834408 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1014_H11.
          Length = 1024

 Score = 68.9 bits (167), Expect(2) = 9e-21
 Identities = 37/113 (32%), Positives = 64/113 (56%), Gaps = 1/113 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY   + + EK DV++FGVV +E+V+G+   +    E+   +   +  L  KE  L 
Sbjct: 858  LAPEYAMRRHLTEKVDVFAFGVVALEIVAGRSNTDNSLEESKIYLFEWAWSLYEKEQALG 917

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVS 292
            +VD  ++E  +++  +V+ +A++CT   P  RP M +VV ML  D E  ++V+
Sbjct: 918  IVDPRLEEFSRDEVYRVIHVALICTQGSPYQRPPMSKVVAMLTGDVEVAEVVT 970



 Score = 54.3 bits (129), Expect(2) = 9e-21
 Identities = 26/52 (50%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SN+LLD    P+I+DFGLAK+  Y+      +  I GT GY+AP
Sbjct: 811 IVHRDIKASNVLLDTDLTPKISDFGLAKL--YDEKKTHVSTGIAGTFGYLAP 860



>gb:AY042808_1560873 Arabidopsis thaliana Unknown protein (F14D7.1)
           mRNA, complete cds.
          Length = 397

 Score = 67.0 bits (162), Expect(2) = 9e-21
 Identities = 38/95 (40%), Positives = 56/95 (58%), Gaps = 3/95 (3%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
           E+ YT KV EK DVYSFGV+++EL+ GK P         D+VS +S+      S+ S+ D
Sbjct: 303 EFAYTMKVTEKCDVYSFGVLILELIIGKHPA--------DLVSSLSSSPAEALSLRSISD 354

Query: 438 SAIQEP---FKEDAIKVLRIAILCTAALPNSRPTM 343
             +  P    ++  +K++ +A+LC  A P SRPTM
Sbjct: 355 ERVLAPRGQNRQKLLKMVEMALLCLQANPESRPTM 389



 Score = 56.2 bits (134), Expect(2) = 9e-21
 Identities = 26/53 (49%), Positives = 37/53 (69%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           PI+HRD+ S NILLD  +  +I+DFG AK+L+ +SS       + GT+GY+AP
Sbjct: 253 PIVHRDISSGNILLDNDYTAKISDFGTAKLLKTDSS---NWSAVAGTYGYVAP 302



>sp|Q9ZVR7|PSKR_ARATH Putative phytosulfokine receptor precursor (EC
            2.7.1.37) (Phytosulfokine LRR receptor
            kinase).>pir|D84434|D84434 probable receptor-like protein
            kinase [imported] - Arabidopsis thaliana
          Length = 1008

 Score = 66.2 bits (160), Expect(2) = 1e-20
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 2/103 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN-NDIVSWVSTKLKSKESILSMV 442
            EYG       K DVYSFGVVL+EL++ K+P++    +   D++SWV  K+K +     + 
Sbjct: 906  EYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCKPKGCRDLISWV-VKMKHESRASEVF 964

Query: 441  DSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            D  I  +   ++  +VL IA LC +  P  RPT +++V  L+D
Sbjct: 965  DPLIYSKENDKEMFRVLEIACLCLSENPKQRPTTQQLVSWLDD 1007



 Score = 56.6 bits (135), Expect(2) = 1e-20
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            CD  I+HRD+KSSNILLDE F   +ADFGLA+++    +   T  V  GT GYI P
Sbjct: 852  CDPHILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLV--GTLGYIPP 905



>gb:AC137612_1743549 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBa0022B03, complete
            sequence.>gb:AC137615_1743589 Genomic sequence for Oryza
            sativa, Nipponbare strain, clone OSJNBa0053F13, from
            chromosome 5, complete sequence.
          Length = 870

 Score = 68.2 bits (165), Expect(2) = 1e-20
 Identities = 36/113 (31%), Positives = 66/113 (58%), Gaps = 1/113 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY     + EK+D+++FGVV++E V+G+   +    E+   +   +  L  K+  L 
Sbjct: 736  LAPEYAMRGHLSEKADIFAFGVVMLETVAGRPNTDNSLEESKICLLEWAWGLYEKDQALG 795

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVS 292
            +VD +++E  K++A + + +A++CT   P+ RP M +VV ML  D +  K+V+
Sbjct: 796  IVDPSLKEFGKDEAFRAICVALVCTQGSPHQRPPMSKVVAMLTGDVDVAKVVT 848



 Score = 54.7 bits (130), Expect(2) = 1e-20
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SN+LLD    P+I+DFGLAK+   N +   T   I GT GY+AP
Sbjct: 689 IVHRDIKASNVLLDTNLVPKISDFGLAKLYDENQTHVSTR--IAGTLGYLAP 738



>gb:AC005936_1533211 Arabidopsis thaliana chromosome 2 clone F5O4
           map CIC11A04, complete sequence.
          Length = 719

 Score = 66.2 bits (160), Expect(2) = 1e-20
 Identities = 38/103 (36%), Positives = 59/103 (57%), Gaps = 2/103 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN-NDIVSWVSTKLKSKESILSMV 442
           EYG       K DVYSFGVVL+EL++ K+P++    +   D++SWV  K+K +     + 
Sbjct: 617 EYGQASVATYKGDVYSFGVVLLELLTDKRPVDMCKPKGCRDLISWV-VKMKHESRASEVF 675

Query: 441 DSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
           D  I  +   ++  +VL IA LC +  P  RPT +++V  L+D
Sbjct: 676 DPLIYSKENDKEMFRVLEIACLCLSENPKQRPTTQQLVSWLDD 718



 Score = 56.6 bits (135), Expect(2) = 1e-20
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  I+HRD+KSSNILLDE F   +ADFGLA+++    +   T  V  GT GYI P
Sbjct: 563 CDPHILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLV--GTLGYIPP 616



>pir|H96533|H96533 hypothetical protein F14J22.6 [imported] -
           Arabidopsis thaliana>gb:AE005173_892904 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011807_1537448 Arabidopsis thaliana
           chromosome I BAC F14J22 genomic sequence, complete
           sequence.
          Length = 663

 Score = 64.7 bits (156), Expect(2) = 1e-20
 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 10/131 (7%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
           EY  TQ++ EKSDVYS+GVVL+EL++G++ ++    E  ++V      L +K   L +VD
Sbjct: 500 EYVVTQELTEKSDVYSYGVVLLELITGRRAVD----EGRNLVEMSQRFLLAKSKHLELVD 555

Query: 438 SAIQEPFKEDAIK----VLRIAILCTAALPNSRPTMRRVVQML-EDAEP-----CKLVSI 289
             I++   +   K    V+ +  LCT     SRP++++V+++L E  +P      K V  
Sbjct: 556 PRIKDSINDAGGKQLDAVVTVVRLCTEKEGRSRPSIKQVLRLLCESCDPVHSAFAKAVEE 615

Query: 288 IVSKDAAKLDN 256
            +  D+ K  N
Sbjct: 616 EIGWDSRKRSN 626



 Score = 58.2 bits (139), Expect(2) = 1e-20
 Identities = 29/57 (50%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV-IPGTHGYIAP 729
           CD P+ HRD+KSSNILLDE F  +++DFGLA   +  S C +  +  I GT GY+ P
Sbjct: 443 CDPPLCHRDIKSSNILLDENFVAKLSDFGLAHSSRDGSVCFEPVNTDIRGTPGYVDP 499



>gb:CQ768545_1451790 Sequence 40 from Patent
           WO2004007712.>gb:AY056294_1563607 Arabidopsis thaliana
           putative receptor kinase (At1g60800) mRNA, complete
           cds.>gb:AY150495_1585060 Arabidopsis thaliana putative
           receptor kinase (At1g60800) mRNA, complete cds.
          Length = 632

 Score = 62.0 bits (149), Expect(2) = 1e-20
 Identities = 32/106 (30%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G+K ++      +   ++ WV  KL  +  +
Sbjct: 471 IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK-KLHQEGKL 529

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             ++D  + + F + +  +++++A+LCT   P+ RP M  V++MLE
Sbjct: 530 KQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLE 575



 Score = 60.8 bits (146), Expect(2) = 1e-20
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 420 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDS--HVTTAVRGTVGHIAP 473



>gb:AX138085_1462208 Sequence 31 from Patent EP1094113.
          Length = 597

 Score = 62.0 bits (149), Expect(2) = 1e-20
 Identities = 32/106 (30%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G+K ++      +   ++ WV  KL  +  +
Sbjct: 436 IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK-KLHQEGKL 494

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             ++D  + + F + +  +++++A+LCT   P+ RP M  V++MLE
Sbjct: 495 KQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLE 540



 Score = 60.8 bits (146), Expect(2) = 1e-20
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 385 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDS--HVTTAVRGTVGHIAP 438



>pir|E96633|E96633 probable Serine/Threonine protein kinase F8A5.31
           [imported] - Arabidopsis thaliana>gb:AE005173_893755
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AX120051_1461705 Sequence 34 from Patent
           WO0129240.>gb:AC002292_1530159 Arabidopsis thaliana BAC
           F8A5, complete sequence.
          Length = 588

 Score = 62.0 bits (149), Expect(2) = 1e-20
 Identities = 32/106 (30%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G+K ++      +   ++ WV  KL  +  +
Sbjct: 427 IAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRSAHQKGVMLDWVK-KLHQEGKL 485

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             ++D  + + F + +  +++++A+LCT   P+ RP M  V++MLE
Sbjct: 486 KQLIDKDLNDKFDRVELEEIVQVALLCTQFNPSHRPKMSEVMKMLE 531



 Score = 60.8 bits (146), Expect(2) = 1e-20
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 376 CDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRDS--HVTTAVRGTVGHIAP 429



>pir|T47793|T47793 receptor-like protein kinase - Arabidopsis
           thaliana>gb:ATF17J16_1548972 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F17J16.
          Length = 512

 Score = 67.4 bits (163), Expect(2) = 1e-20
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 2/105 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENN-DIVSWVSTKLKSKESILSMV 442
           EY  T  + EKSD+YSFGV+L+E ++G+ P++ E   N  ++V W+   + ++ +   +V
Sbjct: 362 EYANTGLLNEKSDIYSFGVLLLETITGRDPVDYERPANEVNLVEWLKMMVGTRRA-EEVV 420

Query: 441 DSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
           DS I+ P    A+K  L +A+ C       RP M +VV+MLE  E
Sbjct: 421 DSRIEPPPATRALKRALLVALRCVDPEAQKRPKMSQVVRMLESDE 465



 Score = 55.5 bits (132), Expect(2) = 1e-20
 Identities = 27/52 (51%), Positives = 39/52 (75%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++HRD+K+SNIL+D+ F  +++DFGLAK+L    S   TT V+ GT GY+AP
Sbjct: 312 VVHRDIKASNILIDDDFNAKLSDFGLAKLLDSGES-HITTRVM-GTFGYVAP 361



>gb:ATAC009755_1543036 Arabidopsis thaliana chromosome III BAC F14P3
            genomic sequence, complete
            sequence.>gb:ATAC011664_1543339 Arabidopsis thaliana
            chromosome III BAC F1C9 genomic sequence, complete
            sequence.
          Length = 1151

 Score = 72.4 bits (176), Expect(2) = 2e-20
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 3/107 (2%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE---AEYGENNDIVSWVSTKLKSKESILS 448
            EY  T +V +K+DVYS+GVVL+EL+S KK ++     YG   +IV W    L+   +   
Sbjct: 1042 EYAMTCRVSDKADVYSYGVVLLELLSDKKALDPSFVSYGNGFNIVQWACMLLRQGRAKEF 1101

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
                       +D ++VL +A++CT    ++RPTM++VV+ L+  +P
Sbjct: 1102 FTAGLWDAGPHDDLVEVLHLAVVCTVDSLSTRPTMKQVVRRLKQLQP 1148



 Score = 50.1 bits (118), Expect(2) = 2e-20
 Identities = 26/56 (46%), Positives = 36/56 (64%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   ++HRDVK SNILLD+     ++DFGLA++L   +S    T  + GT GY+AP
Sbjct: 988  CVPRVLHRDVKPSNILLDDDCNAYLSDFGLARLL--GTSETHATTGVAGTFGYVAP 1041



>pir|T18536|T18536 receptor-like protein kinase - Ipomoea nil
            (Japanese morning glory)
          Length = 1109

 Score = 64.7 bits (156), Expect(2) = 2e-20
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 5/107 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS---TKLKSKES 457
            +  E  +T     +SDVYS+GVVL+EL++ KK ++  +    DIV WV    T+    + 
Sbjct: 986  MAPENAFTTVKSRESDVYSYGVVLLELITRKKALDPSFNGETDIVGWVRSVWTQTGEIQK 1045

Query: 456  IL--SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            I+  S++D  I     E   + L +A+ C     + RPTMR VV+ L
Sbjct: 1046 IVDPSLLDELIDSSVMEQVTEALSLALRCAEKEVDKRPTMRDVVKQL 1092



 Score = 57.8 bits (138), Expect(2) = 2e-20
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            CD  I+HRD+K  NILLD   +P I+DFG+AK+L   S+    ++ + GT GY+AP
Sbjct: 934  CDPAIVHRDIKPMNILLDSDLEPHISDFGIAKLLD-QSATSIPSNTVQGTIGYMAP 988



>sp|P93194|RPK1_PHANI Receptor-like protein kinase precursor (EC
            2.7.1.37).>gb:INU77888_1683175 Ipomoea nil receptor-like
            protein kinase INRPK1 (inrpk1) gene, complete cds,
            alternatively spliced.
          Length = 1109

 Score = 64.7 bits (156), Expect(2) = 2e-20
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 5/107 (4%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS---TKLKSKES 457
            +  E  +T     +SDVYS+GVVL+EL++ KK ++  +    DIV WV    T+    + 
Sbjct: 986  MAPENAFTTVKSRESDVYSYGVVLLELITRKKALDPSFNGETDIVGWVRSVWTQTGEIQK 1045

Query: 456  IL--SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            I+  S++D  I     E   + L +A+ C     + RPTMR VV+ L
Sbjct: 1046 IVDPSLLDELIDSSVMEQVTEALSLALRCAEKEVDKRPTMRDVVKQL 1092



 Score = 57.8 bits (138), Expect(2) = 2e-20
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            CD  I+HRD+K  NILLD   +P I+DFG+AK+L   S+    ++ + GT GY+AP
Sbjct: 934  CDPAIVHRDIKPMNILLDSDLEPHISDFGIAKLLD-QSATSIPSNTVQGTIGYMAP 988



>gb:AP002061_1821787 Arabidopsis thaliana genomic DNA, chromosome 3,
            BAC clone: T21E2.
          Length = 1042

 Score = 67.4 bits (163), Expect(2) = 2e-20
 Identities = 40/132 (30%), Positives = 71/132 (53%), Gaps = 2/132 (1%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEY-GENNDIVSWVSTKLKSKESIL 451
            +  EY     + +K+DVYSFGVV +E+V GK    +    +   ++ WV   L+ + ++L
Sbjct: 863  MAPEYAMRGHLTDKADVYSFGVVALEIVHGKSNTSSRSKADTFYLLDWVHV-LREQNTLL 921

Query: 450  SMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKD 274
             +VD  +   + K++A+ +++I +LCT+  P  RP+M  VV MLE      +  ++    
Sbjct: 922  EVVDPRLGTDYNKQEALMMIQIGMLCTSPAPGDRPSMSTVVSMLEGHSTVNVEKLL---- 977

Query: 273  AAKLDNPSDNTS 238
             A ++N  D  S
Sbjct: 978  EASVNNEKDEES 989



 Score = 55.1 bits (131), Expect(2) = 2e-20
 Identities = 25/55 (45%), Positives = 41/55 (74%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           I+HRD+K++N+LLD+   P+I+DFGLAK+ +     ++ TH+   + GT+GY+AP
Sbjct: 816 IVHRDIKATNVLLDKELNPKISDFGLAKLDE-----EENTHISTRVAGTYGYMAP 865



>pir|B84659|B84659 probable receptor-like protein kinase, ERECTA
            [imported] - Arabidopsis thaliana>gb:AC004484_1531781
            Arabidopsis thaliana chromosome 2 clone T1D16 map B68,
            complete sequence.>gb:ATHER_1553162 Arabidopsis thaliana
            DNA for receptor protein kinase, complete
            cds.>gb:ATU47029_1557030 Arabidopisis thaliana ERECTA
            mRNA, complete cds.>gb:AY035110_1559881 Arabidopsis
            thaliana putative receptor protein kinase, ERECTA
            (At2g26330) mRNA, complete cds.
          Length = 976

 Score = 67.8 bits (164), Expect(2) = 2e-20
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EY  T ++ EKSDVYS+G+VL+EL++ +K ++ E   ++ I+S           ++ M D
Sbjct: 819  EYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMS-----KTGNNEVMEMAD 873

Query: 438  SAIQEPFKEDAI--KVLRIAILCTAALPNSRPTMRRVVQML 322
              I    K+  +  KV ++A+LCT   PN RPTM +V ++L
Sbjct: 874  PDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVL 914



 Score = 54.7 bits (130), Expect(2) = 2e-20
 Identities = 30/56 (53%), Positives = 37/56 (66%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   IIHRDVKSSNILLD+  + R+ DFG+AK L  + S   T+  + GT GYI P
Sbjct: 765 CSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKS--HTSTYVMGTIGYIDP 818



>gb:AP004123_1837931 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1654_A02.
          Length = 683

 Score = 66.2 bits (160), Expect(2) = 2e-20
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEY-GENNDIVSWVSTKLKSKESIL 451
           L  E   T K    +DV++FGV L+E+ +G+KP+E +  G  + +V  +S  L  +   +
Sbjct: 528 LAPEITRTGKASPLTDVFAFGVFLLEVTTGRKPVERDTEGGIHMLVDLISAHLDRETLPM 587

Query: 450 SMVDSAIQEPFKED-AIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
            MVD  ++  +  D A  VL++ +LC+  LP+ RP+MR+V+Q L+   P
Sbjct: 588 DMVDPRLEGEYNTDEASLVLKLGLLCSHPLPDLRPSMRQVMQYLDGQLP 636



 Score = 56.2 bits (134), Expect(2) = 2e-20
 Identities = 26/55 (47%), Positives = 37/55 (67%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           ++ ++HRD+K+SN+LLD     R+ DFGLAK+  YN      T +I GT GY+AP
Sbjct: 478 EQVVVHRDIKASNVLLDSEMNARLGDFGLAKL--YNHGSDMQTTIIAGTLGYLAP 530



>gb:AP003863_1834480 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1058_A12.>gb:AP005810_1858251 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0696F12.
          Length = 678

 Score = 63.2 bits (152), Expect(2) = 2e-20
 Identities = 30/102 (29%), Positives = 61/102 (59%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
           +  EY     V  K DV SFGV+++E+V+G++ + ++  +  +++S V     +K ++  
Sbjct: 521 MAPEYAIHGNVSTKIDVLSFGVLVLEIVTGRRNLNSDDHDRGNLLSDV-WNCWTKGTVTQ 579

Query: 447 MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           ++D +++E F+  A++ + I +LC  + P+ RP M  V+ ML
Sbjct: 580 LIDQSLEEQFRRQALRCIHIGLLCVQSDPDDRPHMSSVIFML 621



 Score = 59.3 bits (142), Expect(2) = 2e-20
 Identities = 29/52 (55%), Positives = 40/52 (76%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+KS+NILL E  +P+IADFGLA++L+   +   TT ++ GT GY+AP
Sbjct: 473 IIHRDLKSNNILLGEDMEPKIADFGLARLLEEGHTNTRTTRIV-GTFGYMAP 523



>gb:INU77888_1683176 Ipomoea nil receptor-like protein kinase INRPK1
           (inrpk1) gene, complete cds, alternatively spliced.
          Length = 647

 Score = 64.7 bits (156), Expect(2) = 2e-20
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 5/107 (4%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS---TKLKSKES 457
           +  E  +T     +SDVYS+GVVL+EL++ KK ++  +    DIV WV    T+    + 
Sbjct: 524 MAPENAFTTVKSRESDVYSYGVVLLELITRKKALDPSFNGETDIVGWVRSVWTQTGEIQK 583

Query: 456 IL--SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           I+  S++D  I     E   + L +A+ C     + RPTMR VV+ L
Sbjct: 584 IVDPSLLDELIDSSVMEQVTEALSLALRCAEKEVDKRPTMRDVVKQL 630



 Score = 57.8 bits (138), Expect(2) = 2e-20
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  I+HRD+K  NILLD   +P I+DFG+AK+L   S+    ++ + GT GY+AP
Sbjct: 472 CDPAIVHRDIKPMNILLDSDLEPHISDFGIAKLLD-QSATSIPSNTVQGTIGYMAP 526



>gb:INU77888_1683178 Ipomoea nil receptor-like protein kinase INRPK1
           (inrpk1) gene, complete cds, alternatively spliced.
          Length = 443

 Score = 64.7 bits (156), Expect(2) = 2e-20
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 5/107 (4%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS---TKLKSKES 457
           +  E  +T     +SDVYS+GVVL+EL++ KK ++  +    DIV WV    T+    + 
Sbjct: 320 MAPENAFTTVKSRESDVYSYGVVLLELITRKKALDPSFNGETDIVGWVRSVWTQTGEIQK 379

Query: 456 IL--SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           I+  S++D  I     E   + L +A+ C     + RPTMR VV+ L
Sbjct: 380 IVDPSLLDELIDSSVMEQVTEALSLALRCAEKEVDKRPTMRDVVKQL 426



 Score = 57.8 bits (138), Expect(2) = 2e-20
 Identities = 27/56 (48%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  I+HRD+K  NILLD   +P I+DFG+AK+L   S+    ++ + GT GY+AP
Sbjct: 268 CDPAIVHRDIKPMNILLDSDLEPHISDFGIAKLLD-QSATSIPSNTVQGTIGYMAP 322



>pir|G96813|G96813 hypothetical protein T30F21.14 [imported] -
           Arabidopsis thaliana>gb:AE005173_895371 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007260_1535711 Arabidopsis thaliana
           chromosome I BAC T30F21 genomic sequence, complete
           sequence.
          Length = 355

 Score = 65.9 bits (159), Expect(2) = 2e-20
 Identities = 42/108 (38%), Positives = 63/108 (58%), Gaps = 5/108 (4%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLK-SKESI 454
           L  EY  T K   K DVYSFGVVL+EL++G+KP + E + E   +V+WV   ++  +E +
Sbjct: 240 LAPEYFDTGKATMKGDVYSFGVVLLELLTGRKPTDDEFFEEGTKLVTWVKGVVRDQREEV 299

Query: 453 L---SMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +    +  S++QE   E+   V  IA++C    P  RP M  VV++LE
Sbjct: 300 VIDNRLRGSSVQE--NEEMNDVFGIAMMCLEPEPAIRPAMTEVVKLLE 345



 Score = 56.6 bits (135), Expect(2) = 2e-20
 Identities = 30/59 (50%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           C   IIHRD+KSSNILLD   + R++DFGLA +++      D THV   + GT GY+AP
Sbjct: 189 CIPHIIHRDIKSSNILLDHNMEARVSDFGLATLME-----PDKTHVSTFVAGTFGYLAP 242



>gb:AP007224_1863294 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1049

 Score = 66.2 bits (160), Expect(2) = 2e-20
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 1/105 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       K DVYSFGVVL+EL++G++P+      + ++V WV   +   + I  ++D
Sbjct: 942  EYGQAWVATLKGDVYSFGVVLLELLTGRRPVPI-LSTSKELVPWVQEMISEGKQI-EVLD 999

Query: 438  SAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
            S +Q    +E  +KVL  A  C    P  RPTM  VV  L+  +P
Sbjct: 1000 STLQGTGCEEQMLKVLETACKCVDGNPLMRPTMMEVVASLDSIDP 1044



 Score = 55.8 bits (133), Expect(2) = 2e-20
 Identities = 29/56 (51%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRD+KSSNILLD+ FK  IADFGL++++  N +    T  + GT GYI P
Sbjct: 888  CKPRIVHRDIKSSNILLDKEFKAYIADFGLSRLILPNKT--HVTTELVGTLGYIPP 941



>gb:AY756174_1627014 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1049

 Score = 66.2 bits (160), Expect(2) = 2e-20
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 1/105 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       K DVYSFGVVL+EL++G++P+      + ++V WV   +   + I  ++D
Sbjct: 942  EYGQAWVATLKGDVYSFGVVLLELLTGRRPVPI-LSTSKELVPWVQEMISEGKQI-EVLD 999

Query: 438  SAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
            S +Q    +E  +KVL  A  C    P  RPTM  VV  L+  +P
Sbjct: 1000 STLQGTGCEEQMLKVLETACKCVDGNPLMRPTMMEVVASLDSIDP 1044



 Score = 55.8 bits (133), Expect(2) = 2e-20
 Identities = 29/56 (51%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRD+KSSNILLD+ FK  IADFGL++++  N +    T  + GT GYI P
Sbjct: 888  CKPRIVHRDIKSSNILLDKEFKAYIADFGLSRLILPNKT--HVTTELVGTLGYIPP 941



>gb:OSJN00019_1693374 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0043L09, complete sequence.
          Length = 814

 Score = 65.9 bits (159), Expect(2) = 2e-20
 Identities = 43/131 (32%), Positives = 71/131 (54%), Gaps = 4/131 (3%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EY        KSD+YSFGV+L+E+VSG K    +  +  +++++ + +L   +  + +VD
Sbjct: 671  EYAMDGVFSVKSDIYSFGVILLEIVSGLKISLPQLMDFPNLLAY-AWRLWKDDKTMDLVD 729

Query: 438  SAIQEP-FKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED---AEPCKLVSIIVSKDA 271
            S+I E   K + +  + I +LC    PNSRP M  VV MLE+   A P  +  +  +  A
Sbjct: 730  SSIAESCSKNEVLLCIHIGLLCVQDNPNSRPLMSSVVFMLENEQAALPAPIQPVYFAHRA 789

Query: 270  AKLDNPSDNTS 238
            ++     +NTS
Sbjct: 790  SETKQTGENTS 800



 Score = 56.2 bits (134), Expect(2) = 2e-20
 Identities = 27/52 (51%), Positives = 38/52 (73%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+K+SNILLD    P+I+DFG+A+I   N    +T  V+ GT+GY++P
Sbjct: 620 IIHRDLKTSNILLDADMSPKISDFGMARIFGGNQQEANTNRVV-GTYGYMSP 670



>gb:AP004301_1839828 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0483E09.
          Length = 695

 Score = 64.3 bits (155), Expect(2) = 2e-20
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESIL 451
           L  E  +T K    +DV++FG  L+E++ G++PI+ + +G    +V WV     + ES+L
Sbjct: 541 LAPELIHTGKASTLTDVFAFGTFLLEVICGQRPIKEDAHGNQILLVDWVLEHWHN-ESLL 599

Query: 450 SMVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
             VD  +Q  +  E+A  VL++ +LC+    N+RP M++VV  LE   P
Sbjct: 600 DTVDPRLQGDYNVEEACLVLKLGLLCSHPSTNARPCMQQVVDYLEGDTP 648



 Score = 57.8 bits (138), Expect(2) = 2e-20
 Identities = 27/59 (45%), Positives = 41/59 (69%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           D+ +IHRD+K+SN+LLD+    R+ DFGLA++  + +    TTH++ GT GY+AP   H
Sbjct: 491 DKVVIHRDIKASNVLLDKEMNARLGDFGLARLYDHGTDA-HTTHMV-GTMGYLAPELIH 547



>gb:AP006172_1861335 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0088O14.
          Length = 671

 Score = 64.3 bits (155), Expect(2) = 2e-20
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESIL 451
           L  E  +T K    +DV++FG  L+E++ G++PI+ + +G    +V WV     + ES+L
Sbjct: 517 LAPELIHTGKASTLTDVFAFGTFLLEVICGQRPIKEDAHGNQILLVDWVLEHWHN-ESLL 575

Query: 450 SMVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
             VD  +Q  +  E+A  VL++ +LC+    N+RP M++VV  LE   P
Sbjct: 576 DTVDPRLQGDYNVEEACLVLKLGLLCSHPSTNARPCMQQVVDYLEGDTP 624



 Score = 57.8 bits (138), Expect(2) = 2e-20
 Identities = 27/59 (45%), Positives = 41/59 (69%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           D+ +IHRD+K+SN+LLD+    R+ DFGLA++  + +    TTH++ GT GY+AP   H
Sbjct: 467 DKVVIHRDIKASNVLLDKEMNARLGDFGLARLYDHGTDA-HTTHMV-GTMGYLAPELIH 523



>gb:AC133334_1741356 Oryza sativa chromosome 3 BAC OSJNBa0004L11
           genomic sequence, complete sequence.
          Length = 605

 Score = 63.9 bits (154), Expect(2) = 2e-20
 Identities = 36/106 (33%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESI 454
           +  EY  T K  E++DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ +  +
Sbjct: 452 IAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLQREGQL 511

Query: 453 LSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
            ++VD  +   +    ++ +++IA+LCT A P  RP+M  VV+MLE
Sbjct: 512 GAIVDRNLSSNYDGQEVEMMIQIALLCTQASPEDRPSMSEVVRMLE 557



 Score = 58.2 bits (139), Expect(2) = 2e-20
 Identities = 28/56 (50%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+P + DFGLAK++    +    T  + GT G+IAP
Sbjct: 401 CNPKIIHRDVKAANVLLDEDFEPVVGDFGLAKLVDVQKT--SVTTQVRGTMGHIAP 454



>gb:AC133334_1741357 Oryza sativa chromosome 3 BAC OSJNBa0004L11
           genomic sequence, complete sequence.
          Length = 543

 Score = 63.9 bits (154), Expect(2) = 2e-20
 Identities = 36/106 (33%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESI 454
           +  EY  T K  E++DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ +  +
Sbjct: 390 IAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLQREGQL 449

Query: 453 LSMVDSAIQEPFKEDAIK-VLRIAILCTAALPNSRPTMRRVVQMLE 319
            ++VD  +   +    ++ +++IA+LCT A P  RP+M  VV+MLE
Sbjct: 450 GAIVDRNLSSNYDGQEVEMMIQIALLCTQASPEDRPSMSEVVRMLE 495



 Score = 58.2 bits (139), Expect(2) = 2e-20
 Identities = 28/56 (50%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+P + DFGLAK++    +    T  + GT G+IAP
Sbjct: 339 CNPKIIHRDVKAANVLLDEDFEPVVGDFGLAKLVDVQKT--SVTTQVRGTMGHIAP 392



>gb:AP003222_1825524 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0003E08.
          Length = 492

 Score = 61.6 bits (148), Expect(2) = 2e-20
 Identities = 28/55 (50%), Positives = 42/55 (76%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           D  ++HRD+KSSNIL+D+ F  +++DFGLAK+L  +SS  +T   + GT+GY+AP
Sbjct: 302 DPKVVHRDIKSSNILIDDEFNSKVSDFGLAKLLNSDSSYINTR--VMGTYGYVAP 354



 Score = 60.5 bits (145), Expect(2) = 2e-20
 Identities = 34/102 (33%), Positives = 59/102 (57%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
           EY  +  + EKSD+YSFGVVL+E V+ + P++ ++  +  ++V W+   + SK +   +V
Sbjct: 355 EYANSGMLNEKSDIYSFGVVLLESVTARDPVDYSKPADETNLVEWLKMMISSKRA-EEVV 413

Query: 441 DSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           D  ++ +P K    + + + + C     + RP M  VVQMLE
Sbjct: 414 DPNLEIKPPKRALKRAILVGLKCVDPDADKRPKMSHVVQMLE 455



>gb:AY094451_1575749 Arabidopsis thaliana At5g56885 mRNA, complete
            cds.>gb:BT002287_1635890 Arabidopsis thaliana At5g56885
            mRNA, complete cds.
          Length = 1113

 Score = 69.3 bits (168), Expect(2) = 3e-20
 Identities = 46/135 (34%), Positives = 77/135 (57%), Gaps = 9/135 (6%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEY--GENNDIVSWVSTKLKSKESILSM 445
            EY  T  +  KSDVYS+GVVL+EL++G+KP++     G+ N +VSW    L S E + ++
Sbjct: 897  EYAMTGHLLVKSDVYSYGVVLLELLTGRKPVDMSQPPGQEN-LVSWTRPFLTSAEGLAAI 955

Query: 444  VDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLE----DAEPCKLVSII-- 286
            +D ++      D+I KV  IA +C     + RP M  VVQ L+    + +  K ++ +  
Sbjct: 956  IDQSLGPEISFDSIAKVAAIASMCVQPEVSHRPFMGEVVQALKLVSNECDEAKELNSLTS 1015

Query: 285  VSKDAAKLDNPSDNT 241
            +SKD  + D  ++++
Sbjct: 1016 ISKDDFRDDTQAESS 1030



 Score = 52.4 bits (124), Expect(2) = 3e-20
 Identities = 24/52 (46%), Positives = 35/52 (67%)
 Frame = -1

Query: 884  IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            +IHRD KSSNILL+  F P+++DFGLA+    +   +  +  + GT GY+AP
Sbjct: 845  VIHRDFKSSNILLENDFTPKVSDFGLARNALDDEDNRHISTRVMGTFGYVAP 896



>gb:AP005896_1859826 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OSJNBb0032C09.>gb:AP007224_1863299 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, PAC
            clone:P0463E12.
          Length = 1046

 Score = 66.6 bits (161), Expect(2) = 3e-20
 Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       + DVYSFGVVL+EL++G++P+      + ++V WV  ++KSK ++L ++D
Sbjct: 943  EYGQGWVATLRGDVYSFGVVLLELLTGRRPVSI-LSTSEELVPWV-LEMKSKGNMLEVLD 1000

Query: 438  SAIQEPFKED-AIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
              +Q    E+  +KVL +A  C    P  RPT+  VV  L+
Sbjct: 1001 PTLQGTGNEEQMLKVLEVACKCVNCNPCMRPTITEVVSCLD 1041



 Score = 55.1 bits (131), Expect(2) = 3e-20
 Identities = 28/56 (50%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRD+KSSNILLD+ FK  +ADFGL++++  N +    T  + GT GYI P
Sbjct: 889  CKPHIVHRDIKSSNILLDKEFKAYVADFGLSRLILPNKN--HITTELVGTLGYIPP 942



>gb:AY756174_1627011 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1046

 Score = 66.6 bits (161), Expect(2) = 3e-20
 Identities = 38/101 (37%), Positives = 60/101 (59%), Gaps = 1/101 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       + DVYSFGVVL+EL++G++P+      + ++V WV  ++KSK ++L ++D
Sbjct: 943  EYGQGWVATLRGDVYSFGVVLLELLTGRRPVSI-LSTSEELVPWV-LEMKSKGNMLEVLD 1000

Query: 438  SAIQEPFKED-AIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
              +Q    E+  +KVL +A  C    P  RPT+  VV  L+
Sbjct: 1001 PTLQGTGNEEQMLKVLEVACKCVNCNPCMRPTITEVVSCLD 1041



 Score = 55.1 bits (131), Expect(2) = 3e-20
 Identities = 28/56 (50%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRD+KSSNILLD+ FK  +ADFGL++++  N +    T  + GT GYI P
Sbjct: 889  CKPHIVHRDIKSSNILLDKEFKAYVADFGLSRLILPNKN--HITTELVGTLGYIPP 942



>gb:AP005419_1851480 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0046G12.
          Length = 458

 Score = 67.8 bits (164), Expect(2) = 3e-20
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYSFGVVL+EL+SG+K ++ +       +V W    LK  + +  ++
Sbjct: 262 EYIMTGHLTAKSDVYSFGVVLLELLSGRKSVDRSRRPREQSLVDWARPYLKWADKLYKVM 321

Query: 441 DSAIQEPFKEDAIKVLR-IAILCTAALPNSRPTMRRVVQMLE 319
           D A++  +     +V   +A  C +  P SRPTMR VV+ LE
Sbjct: 322 DPALECQYSCQGAEVAALVAYKCLSENPKSRPTMREVVKALE 363



 Score = 53.9 bits (128), Expect(2) = 3e-20
 Identities = 29/58 (50%), Positives = 38/58 (65%), Gaps = 3/58 (5%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           D P+I+RD K+SNILLD  +  +++DFGLAK    +    D THV   + GTHGY AP
Sbjct: 208 DPPVIYRDFKASNILLDLDYNTKLSDFGLAK----DGPQGDATHVTTRVMGTHGYAAP 261



>pir|H86301|H86301 hypothetical protein F19K19.4 [imported] -
           Arabidopsis thaliana>gb:AE005172_890644 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC011808_1537467 Arabidopsis thaliana
           chromosome I BAC F19K19 genomic sequence, complete
           sequence.
          Length = 396

 Score = 63.9 bits (154), Expect(2) = 3e-20
 Identities = 35/103 (33%), Positives = 57/103 (55%), Gaps = 1/103 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
           L  EY    ++  K+D+YSFGV+LME+VSG+             +   + +L  +  ++ 
Sbjct: 218 LAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQYLLERAWELYERNELVD 277

Query: 447 MVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           +VDS +   F  E+A + L+I +LCT   P  RP+M  VV++L
Sbjct: 278 LVDSGLNGVFDAEEACRYLKIGLLCTQDSPKLRPSMSTVVRLL 320



 Score = 57.8 bits (138), Expect(2) = 3e-20
 Identities = 27/52 (51%), Positives = 39/52 (75%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+K+SNILLD++  P+I+DFGLA+++  N +   T   + GT GY+AP
Sbjct: 171 IIHRDIKASNILLDKYLSPKISDFGLARLMPPNMTHVSTR--VAGTIGYLAP 220



>gb:AY059921_1564765 Arabidopsis thaliana Unknown protein (F19K19.4)
           mRNA, complete cds.>gb:BT000152_1634430 Arabidopsis
           thaliana Unknown protein (At1g16670) mRNA, complete cds.
          Length = 390

 Score = 63.9 bits (154), Expect(2) = 3e-20
 Identities = 35/103 (33%), Positives = 57/103 (55%), Gaps = 1/103 (0%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
           L  EY    ++  K+D+YSFGV+LME+VSG+             +   + +L  +  ++ 
Sbjct: 212 LAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQYLLERAWELYERNELVD 271

Query: 447 MVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           +VDS +   F  E+A + L+I +LCT   P  RP+M  VV++L
Sbjct: 272 LVDSGLNGVFDAEEACRYLKIGLLCTQDSPKLRPSMSTVVRLL 314



 Score = 57.8 bits (138), Expect(2) = 3e-20
 Identities = 27/52 (51%), Positives = 39/52 (75%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+K+SNILLD++  P+I+DFGLA+++  N +   T   + GT GY+AP
Sbjct: 165 IIHRDIKASNILLDKYLSPKISDFGLARLMPPNMTHVSTR--VAGTIGYLAP 214



>gb:AP007224_1863293 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0463E12.
          Length = 1063

 Score = 63.9 bits (154), Expect(2) = 3e-20
 Identities = 35/104 (33%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       K D+YSFGVVL+EL++G++P+      + ++V WV  ++KS+ + + ++D
Sbjct: 951  EYGQGWVATLKGDIYSFGVVLLELLTGRRPVHI-LSSSKELVKWVQ-EMKSEGNQIEVLD 1008

Query: 438  SAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
              ++   + E  +KVL  A  C    P  RPT++ VV  L+  +
Sbjct: 1009 PILRGTGYDEQMLKVLETACKCVNCNPCMRPTIKEVVSCLDSID 1052



 Score = 57.4 bits (137), Expect(2) = 3e-20
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRD+KSSNILLD+ FK  +ADFGLA+++  N +    T  + GT GYI P
Sbjct: 897  CKPHIIHRDIKSSNILLDKEFKAYVADFGLARLILANKT--HVTTELVGTLGYIPP 950



>gb:AY756174_1627015 Oryza rufipogon putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1063

 Score = 63.9 bits (154), Expect(2) = 3e-20
 Identities = 35/104 (33%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       K D+YSFGVVL+EL++G++P+      + ++V WV  ++KS+ + + ++D
Sbjct: 951  EYGQGWVATLKGDIYSFGVVLLELLTGRRPVHI-LSSSKELVKWVQ-EMKSEGNQIEVLD 1008

Query: 438  SAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
              ++   + E  +KVL  A  C    P  RPT++ VV  L+  +
Sbjct: 1009 PILRGTGYDEQMLKVLETACKCVNCNPCMRPTIKEVVSCLDSID 1052



 Score = 57.4 bits (137), Expect(2) = 3e-20
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRD+KSSNILLD+ FK  +ADFGLA+++  N +    T  + GT GYI P
Sbjct: 897  CKPHIIHRDIKSSNILLDKEFKAYVADFGLARLILANKT--HVTTELVGTLGYIPP 950



>gb:AY714494_1624025 Oryza sativa (indica cultivar-group) clone
            OsInlk6 putative leucine-rich repeat receptor-like kinase
            mRNA, complete cds.>gb:AY730046_1625388 Oryza sativa
            (indica cultivar-group) putative leucine-rich repeat
            receptor-like kinase genes, complete cds.
          Length = 1065

 Score = 63.9 bits (154), Expect(2) = 3e-20
 Identities = 35/104 (33%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       K D+YSFGVVL+EL++G++P+      + ++V WV  ++KS+ + + ++D
Sbjct: 953  EYGQGWVATLKGDIYSFGVVLLELLTGRRPVHI-LSSSKELVKWVQ-EMKSEGNQIEVLD 1010

Query: 438  SAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
              ++   + E  +KVL  A  C    P  RPT++ VV  L+  +
Sbjct: 1011 PILRGTGYDEQMLKVLETACKCVNCNPCMRPTIKEVVSCLDSID 1054



 Score = 57.4 bits (137), Expect(2) = 3e-20
 Identities = 30/56 (53%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   IIHRD+KSSNILLD+ FK  +ADFGLA+++  N +    T  + GT GYI P
Sbjct: 899  CKPHIIHRDIKSSNILLDKEFKAYVADFGLARLILANKT--HVTTELVGTLGYIPP 952



>gb:OSJN00152_1695767 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0008M17, complete sequence.
          Length = 1042

 Score = 66.2 bits (160), Expect(2) = 3e-20
 Identities = 42/122 (34%), Positives = 64/122 (52%), Gaps = 1/122 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY     + EK DV++FGVV +E V+G+   +    E+   +     +L      L 
Sbjct: 865  LAPEYAMRGHMTEKVDVFAFGVVALETVAGESNYQNTLEEDRTYIFERVWELYENGHPLD 924

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVSIIVSKDA 271
             VD  + E   E+ I+V+R+A+LCT   P+ RP M +VV ML  DA+        +++DA
Sbjct: 925  FVDPKLSEFNSEEVIRVIRVALLCTQGSPHKRPPMSKVVSMLTGDAD--------ITEDA 976

Query: 270  AK 265
            AK
Sbjct: 977  AK 978



 Score = 55.1 bits (131), Expect(2) = 3e-20
 Identities = 25/52 (48%), Positives = 37/52 (71%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SN+LLD    P+I+DFGLAK+  Y++     +  + GT GY+AP
Sbjct: 818 IVHRDIKASNVLLDAGLNPKISDFGLAKL--YDNKKTHVSTKVAGTFGYLAP 867



>gb:AP005111_1848027 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0643F09.
          Length = 739

 Score = 70.1 bits (170), Expect(2) = 3e-20
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPI-EAEYGENNDIVSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYS+GVVL+EL+SG+KP+  ++     ++V+W    L  KE +  ++
Sbjct: 516 EYAMTGHLLVKSDVYSYGVVLLELLSGRKPVCMSDTNGPQNLVTWARPLLCHKEGLERLI 575

Query: 441 DSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           D ++   F  +D  KV  IA +C    P+ RP M  VVQ L+
Sbjct: 576 DPSLNGNFNFDDVAKVASIASMCVHNDPSQRPFMGEVVQALK 617



 Score = 51.2 bits (121), Expect(2) = 3e-20
 Identities = 24/52 (46%), Positives = 35/52 (67%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD K SNILL+E F P++ DFGLA+  +  +  +  +  + GT GY+AP
Sbjct: 466 VIHRDFKGSNILLEEDFTPKVTDFGLAR--EATNGIQPISTRVMGTFGYVAP 515



>pir|T48335|T48335 receptor like protein kinase - Arabidopsis
           thaliana>gb:AB005240_1509461 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MOK16.>gb:ATF15A17_1548650 Arabidopsis thaliana
           DNA chromosome 5, BAC clone F15A17 (ESSA
           project).>gb:AY093212_1575166 Arabidopsis thaliana
           receptor like protein kinase (At5g03140) mRNA, complete
           cds.>gb:BT008791_1639987 Arabidopsis thaliana At5g03140
           gene, complete cds.
          Length = 711

 Score = 63.5 bits (153), Expect(2) = 3e-20
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 7/109 (6%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-------AEYGENNDIVSWVSTKLK 469
           L  EY  T +  EK+DV+S+G V++E+ +G++PI           G  + +V WV   L 
Sbjct: 540 LAPEYLLTGRATEKTDVFSYGAVVLEVCTGRRPITRPEPEPGLRPGLRSSLVDWV-WGLY 598

Query: 468 SKESILSMVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            +  +L+ VD  + E   E+  +V+ + + C+   P +RPTMR VVQ+L
Sbjct: 599 REGKLLTAVDERLSEFNPEEMSRVMMVGLACSQPDPVTRPTMRSVVQIL 647



 Score = 57.8 bits (138), Expect(2) = 3e-20
 Identities = 28/56 (50%), Positives = 38/56 (67%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK+SNI+LD  F P++ DFGLA+  +++ S   T     GT GY+AP
Sbjct: 489 CENQIIHRDVKTSNIMLDANFNPKLGDFGLARQTEHDKSPDAT--AAAGTMGYLAP 542



>gb:AP005111_1848028 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0643F09.
          Length = 685

 Score = 70.1 bits (170), Expect(2) = 3e-20
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 2/102 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPI-EAEYGENNDIVSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYS+GVVL+EL+SG+KP+  ++     ++V+W    L  KE +  ++
Sbjct: 462 EYAMTGHLLVKSDVYSYGVVLLELLSGRKPVCMSDTNGPQNLVTWARPLLCHKEGLERLI 521

Query: 441 DSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           D ++   F  +D  KV  IA +C    P+ RP M  VVQ L+
Sbjct: 522 DPSLNGNFNFDDVAKVASIASMCVHNDPSQRPFMGEVVQALK 563



 Score = 51.2 bits (121), Expect(2) = 3e-20
 Identities = 24/52 (46%), Positives = 35/52 (67%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD K SNILL+E F P++ DFGLA+  +  +  +  +  + GT GY+AP
Sbjct: 412 VIHRDFKGSNILLEEDFTPKVTDFGLAR--EATNGIQPISTRVMGTFGYVAP 461



>gb:CQ768555_1451795 Sequence 50 from Patent
           WO2004007712.>gb:AX120061_1461710 Sequence 44 from
           Patent WO0129240.
          Length = 613

 Score = 66.2 bits (160), Expect(2) = 3e-20
 Identities = 37/106 (34%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESI 454
           +  EY  T K  E++DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +
Sbjct: 460 IAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRL 519

Query: 453 LSMVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            ++VD  +  E  KE+   ++++A+LCT   P  RP M  VV+MLE
Sbjct: 520 GAIVDKNLDGEYIKEEVEMMIQVALLCTQGSPEDRPVMSEVVRMLE 565



 Score = 55.1 bits (131), Expect(2) = 3e-20
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 409 CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 462



>pir|T50817|T50817 protein serine/threonine kinase-like protein -
           Arabidopsis thaliana>gb:ATF18D22_1549106 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F18D22 (ESSA
           project).
          Length = 605

 Score = 66.2 bits (160), Expect(2) = 3e-20
 Identities = 37/106 (34%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESI 454
           +  EY  T K  E++DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +
Sbjct: 452 IAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRL 511

Query: 453 LSMVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            ++VD  +  E  KE+   ++++A+LCT   P  RP M  VV+MLE
Sbjct: 512 GAIVDKNLDGEYIKEEVEMMIQVALLCTQGSPEDRPVMSEVVRMLE 557



 Score = 55.1 bits (131), Expect(2) = 3e-20
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 401 CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 454



>gb:AP004768_1844703 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0010C01.>gb:AP005513_1853210 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0014E22.
          Length = 447

 Score = 67.8 bits (164), Expect(2) = 3e-20
 Identities = 38/104 (36%), Positives = 69/104 (66%), Gaps = 2/104 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEA-EYGENNDIVSWVSTKLKSKESIL 451
           +  EY    ++ +K+DVYSFGV+++E++SG++  +    G      +W+   L  + S+L
Sbjct: 208 MAPEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIRSGMFLVRQAWM---LHEQGSLL 264

Query: 450 SMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
            MVD +++  + +E+A+K +++A+ CT A P SRPTMR+VV++L
Sbjct: 265 DMVDPSMKGGYPEEEALKFIKVALACTQAKPCSRPTMRQVVKLL 308



 Score = 53.5 bits (127), Expect(2) = 3e-20
 Identities = 26/52 (50%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SN+LLD  + P+I DFG+AK+   N S   T   + GT GY+AP
Sbjct: 161 IVHRDIKASNVLLDRNYIPKIGDFGIAKLFPDNVSHVSTR--VIGTTGYMAP 210



>gb:AK117450_1815484 Arabidopsis thaliana At3g58690 mRNA for
           putative serine/threonine-specific protein kinase,
           complete cds, clone: RAFL17-05-P15.
          Length = 271

 Score = 67.0 bits (162), Expect(2) = 3e-20
 Identities = 34/101 (33%), Positives = 60/101 (59%), Gaps = 2/101 (1%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDI-VSWVSTKLKSKESILSMV 442
           EY  T  +  KSDVYS+GVVL+EL++G+ P++ +      + VSW   +L  ++ ++ ++
Sbjct: 134 EYALTGHLTTKSDVYSYGVVLLELLTGRVPVDMKRATGEGVLVSWALPQLADRDKVVDIM 193

Query: 441 DSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           D  ++  +  ++ ++V  IA +C  A  + RP M  VVQ L
Sbjct: 194 DPTLEGQYSTKEVVQVAAIAAMCVQAEADYRPLMADVVQSL 234



 Score = 54.3 bits (129), Expect(2) = 3e-20
 Identities = 27/53 (50%), Positives = 36/53 (67%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           P+IHRD KSSNILL   F  +++DFGLAK+    +    +T V+ GT GY+AP
Sbjct: 82  PVIHRDFKSSNILLGRNFNAKVSDFGLAKVGSDKAGGHVSTRVL-GTQGYVAP 133



>sp|P47735|RLK5_ARATH Receptor-like protein kinase 5 precursor (EC
            2.7.1.37).>pir|S27756|S27756 receptor-like protein kinase
            5 (EC 2.7.1.-) precursor - Arabidopsis
            thaliana>gb:ATCHRIV68_1546729 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 68.>gb:ATF20O9_1549548
            Arabidopsis thaliana DNA chromosome 4, BAC clone F20O9
            (ESSA project).>gb:ATHRLPKC_1553352 A.thaliana
            receptor-like protein kinase mRNA, complete cds.
          Length = 999

 Score =  100 bits (249), Expect = 4e-20
 Identities = 53/111 (47%), Positives = 76/111 (68%), Gaps = 3/111 (2%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            +  EY YT +V EKSD+YSFGVVL+ELV+GK+P ++E G+  D+  WV T L  K  +  
Sbjct: 865  IAPEYVYTLRVNEKSDIYSFGVVLLELVTGKQPTDSELGD-KDMAKWVCTAL-DKCGLEP 922

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED---AEPC 304
            ++D  +   FKE+  KV+ I +LCT+ LP +RP+MR+VV ML++   A PC
Sbjct: 923  VIDPKLDLKFKEEISKVIHIGLLCTSPLPLNRPSMRKVVIMLQEVSGAVPC 973



 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYN-SSCKDTTHVIPGTHGYIAPGTK 720
            C  PI+HRDVKSSNILLD  +  ++ADFG+AK+ Q + S   +    I G+ GYIAP   
Sbjct: 811  CVPPIVHRDVKSSNILLDSDYGAKVADFGIAKVGQMSGSKTPEAMSGIAGSCGYIAP--- 867

Query: 719  HFKFYYKLCLN 687
              ++ Y L +N
Sbjct: 868  --EYVYTLRVN 876



>gb:AP003453_1829707 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0480C01.
          Length = 1121

 Score = 70.5 bits (171), Expect(2) = 4e-20
 Identities = 42/119 (35%), Positives = 69/119 (57%), Gaps = 2/119 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
            EY  + +   K DVYS+GVVL+EL++GK P + A++GE+N++V WV    K K + +   
Sbjct: 980  EYYQSFRCTTKGDVYSYGVVLLELLTGKPPTDSADFGEDNNLVGWVKQHTKLKITDVFDP 1039

Query: 441  DSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA 268
            +   ++P  E + ++ L+IA  C    P+ RPTM +V+ M ++ +    V    S  AA
Sbjct: 1040 ELLKEDPSVELELLEHLKIACACLDDRPSRRPTMLKVMAMFKEIQAGSTVDSKTSSAAA 1098



 Score = 50.4 bits (119), Expect(2) = 4e-20
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT---THVIPGTHGYIAP 729
            C   IIHRD+KSSN+L+DE  + R++DFG+A+++    S  DT      + GT GY+ P
Sbjct: 925  CIPHIIHRDMKSSNVLIDEQLEARVSDFGMARLM----SVVDTHLSVSTLAGTPGYVPP 979



>gb:AB007644_1510128 Arabidopsis thaliana genomic DNA, chromosome 5,
            TAC clone:K19P17.>gb:AY064019_1565958 Arabidopsis
            thaliana putative receptor protein kinase (At5g53890)
            mRNA, complete cds.>gb:AY091180_1574390 Arabidopsis
            thaliana putative receptor protein kinase (At5g53890)
            mRNA, complete cds.
          Length = 1036

 Score = 63.5 bits (153), Expect(2) = 4e-20
 Identities = 39/103 (37%), Positives = 62/103 (60%), Gaps = 2/103 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGEN-NDIVSWVSTKLKSKESILSMV 442
            EY  +     + DVYSFGVVL+ELV+G++P+E   G++  D+VS V  ++K+++    ++
Sbjct: 926  EYSQSLIATCRGDVYSFGVVLLELVTGRRPVEVCKGKSCRDLVSRV-FQMKAEKREAELI 984

Query: 441  DSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            D+ I+E   E   +++L IA  C    P  RP +  VV  LED
Sbjct: 985  DTTIRENVNERTVLEMLEIACKCIDHEPRRRPLIEEVVTWLED 1027



 Score = 57.4 bits (137), Expect(2) = 4e-20
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQ-YNSSCKDTTHVIPGTHGYIAP 729
            C+  +IHRDVKSSNILLDE F+  +ADFGLA++L+ Y++    TT ++ GT GYI P
Sbjct: 872  CEPNVIHRDVKSSNILLDEKFEAHLADFGLARLLRPYDTHV--TTDLV-GTLGYIPP 925



>gb:AC008030_1536482 Arabidopsis thaliana chromosome I BAC F1N18
            genomic sequence, complete sequence.
          Length = 1013

 Score = 75.1 bits (183), Expect(2) = 4e-20
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 2/105 (1%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESIL 451
            +  EY    ++ EK+DVYSFGVV ME+VSGK   + +   ++  +++W  T L+    IL
Sbjct: 838  MAPEYALWGQLTEKADVYSFGVVAMEIVSGKSNTKQQGNADSVSLINWALT-LQQTGDIL 896

Query: 450  SMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  ++  F + +A++++++A++CT + P+ RPTM   V+MLE
Sbjct: 897  EIVDRMLEGEFNRSEAVRMIKVALVCTNSSPSLRPTMSEAVKMLE 941



 Score = 45.8 bits (107), Expect(2) = 4e-20
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           ++HRD+K++N+LLD     +I+DFGLA++ +      + TH+   + GT GY+AP
Sbjct: 791 MVHRDIKTTNVLLDTDLNAKISDFGLARLHE-----AEHTHISTKVAGTIGYMAP 840



>pir|F86420|F86420 probable receptor-like serine/threonine kinase -
            Arabidopsis thaliana>gb:AE005172_891822 Arabidopsis
            thaliana chromosome 1, top arm complete
            sequence.>gb:AC079288_1732516 Arabidopsis thaliana
            chromosome 1 BAC T3M22 genomic sequence, complete
            sequence.
          Length = 920

 Score = 75.1 bits (183), Expect(2) = 4e-20
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 2/105 (1%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESIL 451
            +  EY    ++ EK+DVYSFGVV ME+VSGK   + +   ++  +++W  T L+    IL
Sbjct: 741  MAPEYALWGQLTEKADVYSFGVVAMEIVSGKSNTKQQGNADSVSLINWALT-LQQTGDIL 799

Query: 450  SMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             +VD  ++  F + +A++++++A++CT + P+ RPTM   V+MLE
Sbjct: 800  EIVDRMLEGEFNRSEAVRMIKVALVCTNSSPSLRPTMSEAVKMLE 844



 Score = 45.8 bits (107), Expect(2) = 4e-20
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           ++HRD+K++N+LLD     +I+DFGLA++ +      + TH+   + GT GY+AP
Sbjct: 694 MVHRDIKTTNVLLDTDLNAKISDFGLARLHE-----AEHTHISTKVAGTIGYMAP 743



>gb:AP005650_1855480 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBa0078K05.
          Length = 776

 Score = 66.6 bits (161), Expect(2) = 4e-20
 Identities = 47/133 (35%), Positives = 66/133 (49%), Gaps = 1/133 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY +T    E+SDVYSFGV+ +E+ +G++P E        +V+WV T L  +  ++ 
Sbjct: 638  LAPEYVHTGVATERSDVYSFGVLALEVATGRRPAE----RGISVVNWVWT-LWGRRRLVD 692

Query: 447  MVDSAIQEPFKEDAI-KVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDA 271
              D  +Q  F  D + +VL + + C       RP MRRVV ML+   P  LV     K  
Sbjct: 693  AADRRLQGRFVADEMRRVLLVGLCCVHPDCRKRPGMRRVVSMLDGTAPLILVP---DKMP 749

Query: 270  AKLDNPSDNTSKM 232
              L  P  N S M
Sbjct: 750  PVLLQPVPNASSM 762



 Score = 54.3 bits (129), Expect(2) = 4e-20
 Identities = 28/60 (46%), Positives = 36/60 (60%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           C+  IIHRDVKSSN++LD  F  R+ DFGLA+ + +      T     GT GY+AP   H
Sbjct: 587 CENRIIHRDVKSSNVMLDAEFNARLGDFGLARTVSHGGLPLTTQPA--GTLGYLAPEYVH 644



>gb:AY093029_1574983 Arabidopsis thaliana protein serine/threonine
           kinase-like protein (At5g10290) mRNA, complete cds.
          Length = 613

 Score = 65.9 bits (159), Expect(2) = 4e-20
 Identities = 37/106 (34%), Positives = 64/106 (60%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVS--TKLKSKESI 454
           +  EY  T K  E++DV+ +G++L+ELV+G++ I+    E  D V  +    KL+ ++ +
Sbjct: 460 IAPEYLSTGKSSERTDVFGYGIMLLELVTGQRAIDFSRLEEEDDVLLLDHVKKLEREKRL 519

Query: 453 LSMVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            ++VD  +  E  KE+   ++++A+LCT   P  RP M  VV+MLE
Sbjct: 520 GAIVDKNLDGEYIKEEVGMMIQVALLCTQGSPEDRPVMSEVVRMLE 565



 Score = 55.1 bits (131), Expect(2) = 4e-20
 Identities = 27/56 (48%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C+  IIHRDVK++N+LLDE F+  + DFGLAK++    +  + T  + GT G+IAP
Sbjct: 409 CNPKIIHRDVKAANVLLDEDFEAVVGDFGLAKLVDVRRT--NVTTQVRGTMGHIAP 462



>gb:AB041503_1519669 Populus nigra PnPK1 mRNA for protein kinase 1,
           complete cds.
          Length = 405

 Score = 66.6 bits (161), Expect(2) = 4e-20
 Identities = 38/102 (37%), Positives = 57/102 (55%), Gaps = 3/102 (2%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESILSM 445
           +Y  T ++  KSD+YSFGVVL+EL++G+K I+   E GE N +V+W     K + +   M
Sbjct: 272 DYAMTGQLTFKSDIYSFGVVLLELITGRKAIDQRKERGEQN-LVAWARPMFKDRRNFSCM 330

Query: 444 VDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQML 322
           VD  +Q  +      + L IA +C    PN RP +  +V  L
Sbjct: 331 VDPLLQGQYPIRGLYQALAIAAMCVQEQPNMRPAVSDLVMAL 372



 Score = 54.3 bits (129), Expect(2) = 4e-20
 Identities = 28/56 (50%), Positives = 38/56 (67%), Gaps = 3/56 (5%)
 Frame = -1

Query: 887 PIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           P+I+RD+K SNILL E + P+++DFGLAK+        D THV   + GT+GY AP
Sbjct: 220 PVIYRDLKCSNILLGEGYHPKLSDFGLAKV----GPSGDKTHVSTRVMGTYGYCAP 271



>gb:AY113170_1578244 Arabidopsis thaliana At1g29720/T3M22_6 mRNA,
           complete cds.>gb:AF367338_1791790 Arabidopsis thaliana
           At1g29720/T3M22_6 mRNA, complete cds.
          Length = 300

 Score = 75.1 bits (183), Expect(2) = 5e-20
 Identities = 39/105 (37%), Positives = 68/105 (64%), Gaps = 2/105 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAE-YGENNDIVSWVSTKLKSKESIL 451
           +  EY    ++ EK+DVYSFGVV ME+VSGK   + +   ++  +++W  T L+    IL
Sbjct: 121 MAPEYALWGQLTEKADVYSFGVVAMEIVSGKSNTKQQGNADSVSLINWALT-LQQTGDIL 179

Query: 450 SMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
            +VD  ++  F + +A++++++A++CT + P+ RPTM   V+MLE
Sbjct: 180 EIVDRMLEGEFNRSEAVRMIKVALVCTNSSPSLRPTMSEAVKMLE 224



 Score = 45.8 bits (107), Expect(2) = 5e-20
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
           ++HRD+K++N+LLD     +I+DFGLA++ +      + TH+   + GT GY+AP
Sbjct: 74  MVHRDIKTTNVLLDTDLNAKISDFGLARLHE-----AEHTHISTKVAGTIGYMAP 123



>gb:AP003278_1827097 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0518F01.
          Length = 245

 Score = 65.9 bits (159), Expect(2) = 5e-20
 Identities = 40/104 (38%), Positives = 60/104 (57%), Gaps = 4/104 (3%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENND---IVSWVSTKLKSKESILS 448
           EY  T ++ EKSDVYSFGV+L+E V+G+ P+   YG   D   ++ W+     S+ +   
Sbjct: 103 EYANTGQLNEKSDVYSFGVLLLEAVTGRDPV--NYGRPTDEVHLLEWIKLMASSRRA-EE 159

Query: 447 MVDSAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
           +VD A++ +P K    + L  A+ C     + RPTM  VV+MLE
Sbjct: 160 VVDPAMEAKPTKRQLRRALVAALKCVDPKADKRPTMGSVVRMLE 203



 Score = 55.1 bits (131), Expect(2) = 5e-20
 Identities = 28/52 (53%), Positives = 40/52 (76%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD+KSSNIL+D+ F  +++DFGL+K+L+   S   TT V+ GT GY+AP
Sbjct: 53  VIHRDIKSSNILIDKDFTGKLSDFGLSKLLRAGKS-HITTRVM-GTFGYVAP 102



>gb:AF503433_1806732 Sorghum bicolor BAC 170F8, complete sequence.
          Length = 1053

 Score = 69.7 bits (169), Expect(2) = 6e-20
 Identities = 40/124 (32%), Positives = 68/124 (54%), Gaps = 3/124 (2%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE---AEYGENNDIVSWVSTKLKSKESILS 448
            EY  T +V +K+DVYS+GVVL+EL+S KK ++   + YG   +IV+W    L+   S   
Sbjct: 824  EYAMTCRVSDKADVYSYGVVLLELISDKKALDPSFSPYGNGFNIVAWACMLLQKGRSREF 883

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKLVSIIVSKDAA 268
             ++        +D +++L + I CT    +SRPTM++V           L++++V+  A 
Sbjct: 884  FIEGLWDVAPHDDLVEILHLGIKCTVESLSSRPTMKQV----------GLLAVLVTATAG 933

Query: 267  KLDN 256
             + N
Sbjct: 934  NVPN 937



 Score = 50.8 bits (120), Expect(2) = 6e-20
 Identities = 30/56 (53%), Positives = 36/56 (64%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           C   I+HRDVK SNILLD      ++DFGLA++L  NS    TT V  GT GY+AP
Sbjct: 770 CVPRILHRDVKPSNILLDNDHTAYLSDFGLARLLG-NSETHATTGV-AGTFGYVAP 823



>gb:AP005100_1847816 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBa0018O23.>gb:AP005766_1857492 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBa0028O21.
          Length = 669

 Score = 64.3 bits (155), Expect(2) = 6e-20
 Identities = 33/109 (30%), Positives = 65/109 (59%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPI-EAEYGENNDIVSWVSTKLKSKESIL 451
           L  E G+T K    +DV++FG+ ++E+  G++PI ++       +V WV  +  +K S++
Sbjct: 517 LAPELGHTSKATPLTDVFAFGMFVLEVACGQRPINQSSLDSQTMLVDWVLEQW-NKGSLV 575

Query: 450 SMVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
           S VDS ++  +   +A+  + + +LC+    N+RP+MR+V+  L+ + P
Sbjct: 576 STVDSRLEGNYNVREAVLAINLGLLCSHPFANARPSMRQVIHYLDGSIP 624



 Score = 56.2 bits (134), Expect(2) = 6e-20
 Identities = 27/59 (45%), Positives = 40/59 (67%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAPGTKH 717
           ++ +IHRD+K+SN+LLD     R+ DFGLA++  ++     TTHV+ GT GY+AP   H
Sbjct: 467 EKAVIHRDIKASNVLLDGDMNGRLGDFGLARLYDHDDD-PQTTHVV-GTIGYLAPELGH 523



>gb:CQ768563_1451799 Sequence 58 from Patent WO2004007712.
          Length = 649

 Score = 60.5 bits (145), Expect(2) = 6e-20
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 419 CDPKIIHRDVKAANILLDECFEAVVGDFGLAKLLNHADS--HVTTAVRGTVGHIAP 472



 Score = 60.1 bits (144), Expect(2) = 6e-20
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E      +   ++ WV  KL  +  +
Sbjct: 470 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKTVSQKGAMLEWV-RKLHEEMKV 528

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             ++D  +   + K +  ++L++A+LCT  LP  RP M  VV MLE
Sbjct: 529 EELLDRELGTNYDKIEVGEMLQVALLCTQYLPAHRPKMSEVVLMLE 574



>gb:AY070043_1566686 Arabidopsis thaliana putative receptor kinase
           homolog (At4g30520) mRNA, complete
           cds.>gb:AY096538_1576080 Arabidopsis thaliana putative
           receptor kinase-like protein (At4g30520) mRNA, complete
           cds.
          Length = 648

 Score = 60.5 bits (145), Expect(2) = 6e-20
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 418 CDPKIIHRDVKAANILLDECFEAVVGDFGLAKLLNHADS--HVTTAVRGTVGHIAP 471



 Score = 60.1 bits (144), Expect(2) = 6e-20
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E      +   ++ WV  KL  +  +
Sbjct: 469 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKTVSQKGAMLEWV-RKLHEEMKV 527

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             ++D  +   + K +  ++L++A+LCT  LP  RP M  VV MLE
Sbjct: 528 EELLDRELGTNYDKIEVGEMLQVALLCTQYLPAHRPKMSEVVLMLE 573



>gb:AP004123_1837935 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1654_A02.>gb:AP005534_1853648 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0030M21.
          Length = 591

 Score = 65.9 bits (159), Expect(2) = 6e-20
 Identities = 38/109 (34%), Positives = 60/109 (55%), Gaps = 2/109 (1%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEY-GENNDIVSWVSTKLKSKESIL 451
           +  E   T K    +DV++FG  L+E+ SG++P+E +  G    +  WV     SKE IL
Sbjct: 445 MAPELALTGKASPLTDVFAFGAFLLEVTSGRRPVEQDIEGHRLLLTDWVFENC-SKEQIL 503

Query: 450 SMVDSAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
           +++D  +       +A  VL++ +LC+  + N RPTMR+VVQ L    P
Sbjct: 504 AVIDPRLNGNINISEASLVLKLGLLCSHPMSNVRPTMRQVVQYLNGDMP 552



 Score = 54.7 bits (130), Expect(2) = 6e-20
 Identities = 26/52 (50%), Positives = 35/52 (67%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           +IHRD+K SN+LLD     R+ DFGLA++  YN   +  T V+ GT GY+AP
Sbjct: 398 VIHRDIKPSNVLLDNDMNGRLGDFGLARL--YNRDTELQTTVVAGTFGYMAP 447



>gb:AX120067_1461713 Sequence 50 from Patent WO0129240.
          Length = 573

 Score = 60.5 bits (145), Expect(2) = 6e-20
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 343 CDPKIIHRDVKAANILLDECFEAVVGDFGLAKLLNHADS--HVTTAVRGTVGHIAP 396



 Score = 60.1 bits (144), Expect(2) = 6e-20
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E      +   ++ WV  KL  +  +
Sbjct: 394 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKTVSQKGAMLEWV-RKLHEEMKV 452

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             ++D  +   + K +  ++L++A+LCT  LP  RP M  VV MLE
Sbjct: 453 EELLDRELGTNYDKIEVGEMLQVALLCTQYLPAHRPKMSEVVLMLE 498



>pir|A85357|A85357 receptor-like kinase homolog [imported] -
           Arabidopsis thaliana>gb:ATCHRIV73_1546973 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 73.
          Length = 573

 Score = 60.5 bits (145), Expect(2) = 6e-20
 Identities = 31/56 (55%), Positives = 39/56 (69%)
 Frame = -1

Query: 896 CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           CD  IIHRDVK++NILLDE F+  + DFGLAK+L +  S    T  + GT G+IAP
Sbjct: 343 CDPKIIHRDVKAANILLDECFEAVVGDFGLAKLLNHADS--HVTTAVRGTVGHIAP 396



 Score = 60.1 bits (144), Expect(2) = 6e-20
 Identities = 35/106 (33%), Positives = 61/106 (57%), Gaps = 3/106 (2%)
 Frame = -3

Query: 627 LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE--AEYGENNDIVSWVSTKLKSKESI 454
           +  EY  T +  EK+DV+ FG++L+EL++G + +E      +   ++ WV  KL  +  +
Sbjct: 394 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKTVSQKGAMLEWV-RKLHEEMKV 452

Query: 453 LSMVDSAIQEPF-KEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE 319
             ++D  +   + K +  ++L++A+LCT  LP  RP M  VV MLE
Sbjct: 453 EELLDRELGTNYDKIEVGEMLQVALLCTQYLPAHRPKMSEVVLMLE 498



>gb:AP003279_1827110 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0529E05.>gb:AP004072_1837303 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0529H11.
          Length = 333

 Score = 62.0 bits (149), Expect(2) = 6e-20
 Identities = 36/102 (35%), Positives = 63/102 (61%), Gaps = 3/102 (2%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVS-WVSTKLKSKESILSMV 442
           EY  T ++ ++SDVYSFGV+L+EL++G++PIE   G +  + + W   K +  +++++M 
Sbjct: 192 EYMRTNQLTDRSDVYSFGVLLVELLTGRRPIERGRGRHQRLTTQWALRKCRDGDAVVAM- 250

Query: 441 DSAIQEPFKEDAI--KVLRIAILCTAALPNSRPTMRRVVQML 322
           D+ ++      A   KV+ +A  CTA    +RP MRR  ++L
Sbjct: 251 DARMRRTSAVVAAMEKVMALAAECTAPDRAARPAMRRCAEVL 292



 Score = 58.5 bits (140), Expect(2) = 6e-20
 Identities = 25/55 (45%), Positives = 37/55 (67%)
 Frame = -1

Query: 893 DRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           D PIIHRD+KSSNILL +  + ++ADFG A++   N+     + ++ GT GY+ P
Sbjct: 137 DHPIIHRDIKSSNILLTDQLRAKVADFGFARLAPDNTEATHVSTMVKGTAGYVDP 191



>gb:CRU303349_1673665 Capsella rubella ORF1, ORF2, ORF3, ORF4, ORF5
            and ORF6 (partial).
          Length = 1166

 Score = 66.6 bits (161), Expect(2) = 7e-20
 Identities = 37/103 (35%), Positives = 58/103 (56%), Gaps = 2/103 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
            EY  + +   K DVYS+GV+L+EL+SGKKPI+  E+GE+N++V W     + K     + 
Sbjct: 1034 EYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPGEFGEDNNLVGWAKQLYREKSGTEILD 1093

Query: 441  DSAIQEPFKE-DAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
               + E   + +    L+IA  C    P  RPTM +V+ M ++
Sbjct: 1094 PELVTEKSGDAELFHYLKIASQCLDDRPFKRPTMIQVMAMFKE 1136



 Score = 53.5 bits (127), Expect(2) = 7e-20
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDT---THVIPGTHGYIAP 729
            C   IIHRD+KSSN+LLDE F+ R++DFG+A+++    S  DT      + GT GY+ P
Sbjct: 979  CIPHIIHRDMKSSNVLLDEDFEARVSDFGMARLV----SALDTHLSVSTLAGTPGYVPP 1033



>gb:AY730046_1625387 Oryza sativa (indica cultivar-group) putative
            leucine-rich repeat receptor-like kinase genes, complete
            cds.
          Length = 1049

 Score = 64.3 bits (155), Expect(2) = 7e-20
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 1/105 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EYG       K DVYSFGVVL+EL++G++P+      + ++V WV   +   + I  ++D
Sbjct: 942  EYGQAWVATLKGDVYSFGVVLLELLTGRRPVPI-LSTSKELVPWVQEMISEGKQI-EVLD 999

Query: 438  SAIQ-EPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEP 307
              +Q    +E  +KVL  A  C    P  RPTM  VV  L+  +P
Sbjct: 1000 PTLQGTGCEEQMLKVLETACKCVDGNPLMRPTMMEVVTSLDSIDP 1044



 Score = 55.8 bits (133), Expect(2) = 7e-20
 Identities = 29/56 (51%), Positives = 38/56 (67%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
            C   I+HRD+KSSNILLD+ FK  IADFGL++++  N +    T  + GT GYI P
Sbjct: 888  CKPRIVHRDIKSSNILLDKEFKAYIADFGLSRLILPNKT--HVTTELVGTLGYIPP 941



>gb:AP006168_1861232 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:B1469H02.
          Length = 1047

 Score = 62.4 bits (150), Expect(2) = 7e-20
 Identities = 35/103 (33%), Positives = 60/103 (58%), Gaps = 2/103 (1%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-AEYGENNDIVSWVSTKLKSKESILSMV 442
            EYG +     K DVYSFG+VL+EL++GK+P++  +     ++VSWV   +K K     ++
Sbjct: 937  EYGQSSVANFKGDVYSFGIVLLELLTGKRPVDMCKPKGARELVSWV-LHMKEKNCEAEVL 995

Query: 441  DSAI-QEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLED 316
            D A+  + F+   ++++ IA LC +  P  RP    +V  L++
Sbjct: 996  DRAMYDKKFEMQMVQMIDIACLCISESPKLRPLTHELVLWLDN 1038



 Score = 57.8 bits (138), Expect(2) = 7e-20
 Identities = 31/59 (52%), Positives = 39/59 (66%), Gaps = 3/59 (5%)
 Frame = -1

Query: 896  CDRPIIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHV---IPGTHGYIAP 729
            C   I+HRD+KSSNILLDE F+  +ADFGLA+++     C   THV   + GT GYI P
Sbjct: 883  CQPHILHRDIKSSNILLDEDFEAHLADFGLARLI-----CPYDTHVTTDLVGTLGYIPP 936



>gb:AP005442_1851834 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OSJNBa0073I05.
          Length = 864

 Score = 64.3 bits (155), Expect(2) = 7e-20
 Identities = 33/107 (30%), Positives = 61/107 (57%), Gaps = 1/107 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY     + EK+DV++FG+V ME+++G+   +    ++   +   +  L   +  L 
Sbjct: 685  LAPEYAMMGHLTEKADVFAFGIVAMEIIAGRPNFDDSVEDDKKYLLGWAWCLHENKQPLE 744

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQML-EDAE 310
            ++D  + E  +E+ ++V+ + +LCT  LP+ RP M +VV +L ED E
Sbjct: 745  ILDPKLTEFNQEEVMRVINVILLCTMGLPHQRPPMSKVVSILTEDIE 791



 Score = 55.8 bits (133), Expect(2) = 7e-20
 Identities = 26/52 (50%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           I+HRD+K+SN+LLD    P+I+DFGLA+   YN S    +  + GT GY+AP
Sbjct: 638 IVHRDIKTSNVLLDANLNPKISDFGLAR--HYNDSMTHVSTGVAGTLGYLAP 687



>pir|E96602|E96602 hypothetical protein T6H22.9 [imported] -
            Arabidopsis thaliana>gb:AE005173_893494 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC009894_1536872 Arabidopsis thaliana
            chromosome I BAC T6H22 genomic sequence, complete
            sequence.
          Length = 858

 Score = 66.6 bits (161), Expect(2) = 7e-20
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 1/131 (0%)
 Frame = -3

Query: 627  LVAEYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILS 448
            L  EY     + EK+DVY+FGVV +ELVSG+K  +    E    +   +  L  K   + 
Sbjct: 688  LAPEYAMRGHLTEKTDVYAFGVVALELVSGRKNSDENLEEGKKYLLEWAWNLHEKNRDVE 747

Query: 447  MVDSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLE-DAEPCKLVSIIVSKDA 271
            ++D  + E   E+  +++ IA+LCT +    RP M RVV ML  DAE    V+   SK  
Sbjct: 748  LIDDELSEYNMEEVKRMIGIALLCTQSSYALRPPMSRVVAMLSGDAE----VNDATSKPG 803

Query: 270  AKLDNPSDNTS 238
               D   D+T+
Sbjct: 804  YLTDCTFDDTT 814



 Score = 53.5 bits (127), Expect(2) = 7e-20
 Identities = 27/52 (51%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRDVK+SNILLD    P+++DFGLAK+  Y+      +  + GT GY+AP
Sbjct: 641 IIHRDVKASNILLDSELVPKVSDFGLAKL--YDDKKTHISTRVAGTIGYLAP 690



>pir|C84922|C84922 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006072_1533410 Arabidopsis thaliana
           chromosome 2 clone T9J23 map CIC06C03, complete
           sequence.>gb:ATZ84202_1557549 A.thaliana ORFb, ORFc and
           AtPK2324 gene.>gb:AY037237_1560131 Arabidopsis thaliana
           At2g48010/T9J23.16 mRNA, complete
           cds.>gb:BT000518_1634796 Arabidopsis thaliana putative
           protein kinase (At2g48010/T9J23.16) mRNA, complete
           cds.>gb:AF024650_1762138 Arabidopsis thaliana
           receptor-like serine/threonine kinase (RKF3) mRNA,
           complete cds.
          Length = 617

 Score = 65.1 bits (157), Expect(2) = 8e-20
 Identities = 39/104 (37%), Positives = 62/104 (59%), Gaps = 1/104 (0%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEA-EYGENNDIVSWVSTKLKSKESILSMV 442
           EY    ++ EKSDVYSFGVVL+EL+S +K I   E G+   +  W  + ++  +++  + 
Sbjct: 458 EYALYGQLTEKSDVYSFGVVLLELLSRRKAIVTDEEGQPVSVADWAWSLVREGQTLDVVE 517

Query: 441 DSAIQEPFKEDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAE 310
           D   ++   E   K + IA+LC+    ++RPTM +VV+MLE  E
Sbjct: 518 DGMPEKGPPEVLEKYVLIAVLCSHPQLHARPTMDQVVKMLESNE 561



 Score = 55.1 bits (131), Expect(2) = 8e-20
 Identities = 28/52 (53%), Positives = 36/52 (69%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+K+SNILLDE F+ ++ADFGLAK      +   T   + GT GY+AP
Sbjct: 408 IIHRDIKASNILLDERFEAKVADFGLAKFNPEGMTHMSTR--VAGTMGYVAP 457



>gb:AP004752_1844391 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0501G04.
          Length = 588

 Score = 66.6 bits (161), Expect(2) = 8e-20
 Identities = 41/111 (36%), Positives = 65/111 (58%), Gaps = 7/111 (6%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-----AEYGENNDIVSWVSTKLK-SKES 457
           EY    K   KSDV+SFGVV++EL++G++PI      A  GE+  +V W + +L+ S+  
Sbjct: 415 EYAIVGKASLKSDVFSFGVVILELITGRQPIHHHRPPAAAGES--LVLWAAPRLRDSRLV 472

Query: 456 ILSMVDSAIQEPFKEDAIKVL-RIAILCTAALPNSRPTMRRVVQMLEDAEP 307
           +  + D A+Q  F ++ ++++  +A  C    P SRPTM  VVQ+L    P
Sbjct: 473 VAELPDPALQGRFPQEEMQIMAHLARECLQWEPESRPTMSEVVQILATIAP 523



 Score = 53.5 bits (127), Expect(2) = 8e-20
 Identities = 26/54 (48%), Positives = 37/54 (68%), Gaps = 2/54 (3%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYN--SSCKDTTHVIPGTHGYIAP 729
           I+HRD+KS+NILLD+ F+ +I D G+AK L  +  +SC  +   + GT GY AP
Sbjct: 361 ILHRDIKSTNILLDDKFRAKITDLGMAKCLMNDGVTSCSSSPARMLGTFGYFAP 414



>gb:AP004752_1844393 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0501G04.
          Length = 579

 Score = 66.6 bits (161), Expect(2) = 8e-20
 Identities = 41/111 (36%), Positives = 65/111 (58%), Gaps = 7/111 (6%)
 Frame = -3

Query: 618 EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIE-----AEYGENNDIVSWVSTKLK-SKES 457
           EY    K   KSDV+SFGVV++EL++G++PI      A  GE+  +V W + +L+ S+  
Sbjct: 406 EYAIVGKASLKSDVFSFGVVILELITGRQPIHHHRPPAAAGES--LVLWAAPRLRDSRLV 463

Query: 456 ILSMVDSAIQEPFKEDAIKVL-RIAILCTAALPNSRPTMRRVVQMLEDAEP 307
           +  + D A+Q  F ++ ++++  +A  C    P SRPTM  VVQ+L    P
Sbjct: 464 VAELPDPALQGRFPQEEMQIMAHLARECLQWEPESRPTMSEVVQILATIAP 514



 Score = 53.5 bits (127), Expect(2) = 8e-20
 Identities = 26/54 (48%), Positives = 37/54 (68%), Gaps = 2/54 (3%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYN--SSCKDTTHVIPGTHGYIAP 729
           I+HRD+KS+NILLD+ F+ +I D G+AK L  +  +SC  +   + GT GY AP
Sbjct: 352 ILHRDIKSTNILLDDKFRAKITDLGMAKCLMNDGVTSCSSSPARMLGTFGYFAP 405



>pir|A85041|A85041 probable receptor kinase [imported] - Arabidopsis
            thaliana>gb:AC005275_1532354 Arabidopsis thaliana BAC
            F4C21 from chromosome IV, top arm, near 17 cM, complete
            sequence.>gb:ATCHRIV8_1547304 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 8.
          Length = 852

 Score = 60.8 bits (146), Expect(2) = 1e-19
 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 1/108 (0%)
 Frame = -3

Query: 618  EYGYTQKVKEKSDVYSFGVVLMELVSGKKPIEAEYGENNDIVSWVSTKLKSKESILSMVD 439
            EY        KSDV+SFGVV++E +SGK+       E +  +   +  L   E  + ++D
Sbjct: 704  EYALEGLFSFKSDVFSFGVVVIETISGKRNTGFHEPEKSLSLLGHAWDLWKAERGIELLD 763

Query: 438  SAIQEPFK-EDAIKVLRIAILCTAALPNSRPTMRRVVQMLEDAEPCKL 298
             A+QE  + E  +K L + +LC    PN RPTM  VV ML  +E   L
Sbjct: 764  QALQESCETEGFLKCLNVGLLCVQEDPNDRPTMSNVVFMLGSSEAATL 811



 Score = 58.9 bits (141), Expect(2) = 1e-19
 Identities = 28/52 (53%), Positives = 40/52 (76%)
 Frame = -1

Query: 884 IIHRDVKSSNILLDEFFKPRIADFGLAKILQYNSSCKDTTHVIPGTHGYIAP 729
           IIHRD+K+SNILLDE   P+I+DFGLA+I   + +  +T  V+ GT+GY++P
Sbjct: 653 IIHRDLKTSNILLDEEMNPKISDFGLARIFGGSETSANTNRVV-GTYGYMSP 703


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 918,670,023
Number of Sequences: 1806583
Number of extensions: 18312747
Number of successful extensions: 69491
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 59373
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 67655
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 62274892842
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)