BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig11400
         (1171 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|H86240|H86240 hypothetical protein [imported] - Arabidopsis ...   387   e-106   Arabidopsis thaliana [mouse-ear cress]
gb:AC137620_1743672 Oryza sativa (japonica cultivar-group) chrom...   364   2e-99   
gb:BT005251_1638191 Arabidopsis thaliana At1g23330 mRNA, complet...   348   9e-95   
pir|D86367|D86367 protein F26F24.20 [imported] - Arabidopsis tha...   348   9e-95   Arabidopsis thaliana [mouse-ear cress]
gb:AC009398_1536763 Genomic sequence for Arabidopsis thaliana BA...   286   4e-76   
gb:AF134840_482070 Bacillus thermoleovorans lipase (ARA) gene, c...    58   3e-07   
gb:BTTGL_757208 B.thermocatenulatus triacylglycerol lipase gene.       57   6e-07   
gb:AY855077_647689 Bacillus sp. L2 thermostable lipase gene, com...    57   7e-07   
gb:AY787835_646173 Bacillus sp. 42 thermostable organic solvent ...    57   7e-07   
gb:AF237623_491485 Bacillus stearothermophilus lipase gene, comp...    57   7e-07   
pir|JC8061|JC8061 triacylglycerol lipase (EC 3.1.1.3) - Geobacil...    57   7e-07   
gb:BA000043_738563 Geobacillus kaustophilus HTA426 DNA, complete...    57   9e-07   
gb:AF429311_510015 Bacillus stearothermophilus lipase gene, comp...    55   3e-06   
gb:AY095262_588579 Bacillus sp. Tosh lipase (lipA) gene, complet...    55   4e-06   
gb:AY095260_588578 Geobacillus thermoleovorans thermostable lipa...    54   5e-06   
gb:AF141874_482683 Bacillus sp. TP10A.1 triacylglycerol lipase (...    54   6e-06   
pir|JW0068|JW0068 triacylglycerol lipase (EC 3.1.1.3), thermosta...    52   3e-05   Geobacillus stearothermophilus
gb:AE015939_320101 Clostridium tetani E88, section 4 of 10 of th...    47   6e-04   
gb:CP000001_852962 Bacillus cereus ZK, complete genome.                46   0.002   
gb:AE017355_463689 Bacillus thuringiensis serovar konkukian str....    46   0.002   
gb:AE017272_423838 Bacillus cereus ATCC 10987, section 9 of 18 o...    46   0.002   
gb:BX571856_779785 Staphylococcus aureus subsp. aureus strain MR...    44   0.005   
gb:SSI308427_190613 Staphylococcus simulans partial lipad-1 gene...    44   0.005   
sp|Q8NYC2|LIP_STAAW|LIP_STAAW Lipase precursor (EC 3.1.1.3) (Glycerol este...    44   0.005   Staphylococcus aureus
sp|P10335|LIP_STAAU|LIP_STAAU Lipase precursor (EC 3.1.1.3) (Glycerol este...    44   0.005   Staphylococcus aureus
gb:AF208229_488476 Staphylococcus xylosus lipase precursor GehM ...    44   0.006   
pir|B89797|B89797 glycerol ester hydrolase [imported] - Staphylo...    44   0.006   Staphylococcus aureus subsp. aureus N315
pir|C75533|C75533 probable lipase - Deinococcus radiodurans (str...    42   0.018   Deinococcus radiodurans
gb:AE017032_382697 Bacillus anthracis str. Ames section 9 of 18 ...    42   0.024   
gb:BC084827_2564072 Xenopus laevis hypothetical LOC495363, mRNA ...    40   0.070   
gb:AF208033_488462 Staphylococcus warneri lipase precursor (gehA...    40   0.12    
gb:CP000029_82875 Staphylococcus epidermidis RP62A, complete gen...    40   0.12    
pir|A47705|A47705 triacylglycerol lipase (EC 3.1.1.3) - Staphylo...    40   0.12    Staphylococcus epidermidis
sp|Q02510|LIP_STAEP|LIP_STAEP Lipase precursor (EC 3.1.1.3) (Glycerol este...    40   0.12    Staphylococcus epidermidis
sp|P04635|LIP_STAHY|LIP_STAHY Lipase precursor (EC 3.1.1.3) (Triacylglycer...    39   0.16    Staphylococcus hyicus
gb:BA000033_712882 Staphylococcus aureus subsp. aureus MW2 DNA, ...    38   0.45    
gb:CP000046_92759 Staphylococcus aureus subsp. aureus COL, compl...    38   0.45    
pir|S68970|S68970 triacylglycerol lipase (EC 3.1.1.3) precursor ...    38   0.45    Staphylococcus aureus
gb:CP000046_90488 Staphylococcus aureus subsp. aureus COL, compl...    37   1.0     
gb:BX571856_782172 Staphylococcus aureus subsp. aureus strain MR...    36   1.7     
sp|Q99QX0|LIP_STAAM|LIP_STAAM Lipase precursor (EC 3.1.1.3) (Glycerol este...    36   1.7     Staphylococcus aureus
gb:AE017345_1757118 Cryptococcus neoformans var. neoformans JEC2...    33   8.5     
gb:CNS07EGG_1374035 chromosome X of strain GB-M1 of Encephalitoz...    33   8.5     
gb:AY058406_1291560 Drosophila melanogaster GH18129 full length ...    33   8.5     
gb:AE013599_1132296 Drosophila melanogaster chromosome 2R, compl...    33   8.5     
pir|T13693|T13693 hypothetical protein EG0003.5 - fruit fly (Dro...    33   8.5     Drosophila melanogaster


>pir|H86240|H86240 hypothetical protein [imported] - Arabidopsis
            thaliana>gb:AE005172_890087 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AY120749_1579631 Arabidopsis thaliana
            putative lipase (At1g10740) mRNA, complete
            cds.>gb:BT006614_1639501 Arabidopsis thaliana At1g10740
            mRNA, complete cds.>gb:T16B5_1723523 Arabidopsis thaliana
            chromosome 1 BAC T16B5 sequence, complete
            sequence.>gb:AF361099_1791311 Arabidopsis thaliana clone
            C00190 (a) putative lipase (At1g10740) mRNA, complete
            cds.
          Length = 473

 Score =  387 bits (995), Expect = e-106
 Identities = 173/213 (81%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query: 1170 DIPWLKAYYNFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSH 991
            DI WLK YYNFGFDHFNISWKK+G+ GLVDCLMGNAGPFASGDWILPDLTIQG+  +NS+
Sbjct: 243  DISWLKTYYNFGFDHFNISWKKTGVRGLVDCLMGNAGPFASGDWILPDLTIQGSTSINSN 302

Query: 990  LRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKGYR 811
            L+TFPNTYYFSYATKRTR++MG+T+PSG+LGIHP+LF+RV QMS W+ P DVSPPYKGYR
Sbjct: 303  LQTFPNTYYFSYATKRTRRVMGMTIPSGVLGIHPMLFLRVFQMSQWKFPQDVSPPYKGYR 362

Query: 810  DEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIVEGDHILFIINR 631
            DEDW ENDGALNTISMTHPRLPVEHPS+ +  DS+CQ LQPGIWYYKIVE DHI+FI+NR
Sbjct: 363  DEDWQENDGALNTISMTHPRLPVEHPSRFIRSDSECQTLQPGIWYYKIVEADHIMFIVNR 422

Query: 630  ERAGVQFDLIYDGIFERCRKHVFRKLP-TLPDK 535
            ERAGVQFDLIYD IF+RCRKHVFRK+P TLP++
Sbjct: 423  ERAGVQFDLIYDSIFQRCRKHVFRKIPQTLPNQ 455



>gb:AC137620_1743672 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OSJNBb0014K18, complete
            sequence.>gb:AC137928_1743831 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone P0040B10, complete
            sequence.
          Length = 471

 Score =  364 bits (934), Expect = 2e-99
 Identities = 160/213 (75%), Positives = 189/213 (88%), Gaps = 1/213 (0%)
 Frame = -2

Query: 1170 DIPWLKAYYNFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSH 991
            DIPWLK YYNFGFDHF +SW+K G+ GL+D L+G+ GPFASGDWILPDLTIQG++ +NS 
Sbjct: 254  DIPWLKNYYNFGFDHFEMSWRKVGLSGLIDLLLGHTGPFASGDWILPDLTIQGSLTLNST 313

Query: 990  LRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKGYR 811
            LRTFPNT+YFSYATKRTRK+ G+TVPS +LGIHP+LF+RVLQM +WRHP +   PYKGYR
Sbjct: 314  LRTFPNTFYFSYATKRTRKLFGITVPSSVLGIHPMLFLRVLQMCMWRHPQNAPLPYKGYR 373

Query: 810  DEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIVEGDHILFIINR 631
            DEDW +NDGALNTISMTHPR+P EHP++ VV DSDC PLQPGIWYYKI+E DHILFI+NR
Sbjct: 374  DEDWEDNDGALNTISMTHPRIPTEHPNRLVVDDSDCHPLQPGIWYYKIIEADHILFIVNR 433

Query: 630  ERAGVQFDLIYDGIFERCRKHVFRKL-PTLPDK 535
            ERAGVQFDL+YDGIF+RCRKH FR+  PT+P++
Sbjct: 434  ERAGVQFDLLYDGIFQRCRKHAFRRSPPTVPNE 466



>gb:BT005251_1638191 Arabidopsis thaliana At1g23330 mRNA, complete
            cds.>gb:AK117971_1815977 Arabidopsis thaliana At1g23330
            mRNA for unknown protein, complete cds, clone:
            RAFL19-17-L08.
          Length = 231

 Score =  348 bits (894), Expect = 9e-95
 Identities = 164/215 (76%), Positives = 190/215 (88%), Gaps = 3/215 (1%)
 Frame = -2

Query: 1170 DIPWLKAYYNFGFDHFNISWKKSGIWGLVDCLMGNAGPFAS-GDWILPDLTIQGAIKVNS 994
            DIPWLK+YYNFGFDHFN+S KK+G+ GLVD L+GNAGPFA+ GDWILPDL+IQG++ +N+
Sbjct: 6    DIPWLKSYYNFGFDHFNMSRKKTGVRGLVDLLLGNAGPFAACGDWILPDLSIQGSMTLNA 65

Query: 993  HLRTFPNTYYFSYATKRTRKIMGV-TVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG 817
             L+TFPNT+YFSYATKRT K +G+ TVPSG++GIHPLLFIRVLQMS W+ P D+  PYKG
Sbjct: 66   SLQTFPNTFYFSYATKRTTKPLGMMTVPSGVMGIHPLLFIRVLQMSQWQFPRDIPLPYKG 125

Query: 816  YRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIVEGDHILFII 637
            YRDEDW +NDGALNTISMTHPR+PVEH S  +  DSDC PLQPGIWYYKIVE DHI+FII
Sbjct: 126  YRDEDWQDNDGALNTISMTHPRIPVEHSSLILRSDSDCLPLQPGIWYYKIVEADHIMFII 185

Query: 636  NRERAGVQFDLIYDGIFERCRKHVFRKLP-TLPDK 535
            NRERAGV+FDLIYD IFERCRKHVFRK P TLP++
Sbjct: 186  NRERAGVEFDLIYDSIFERCRKHVFRKAPQTLPNE 220



>pir|D86367|D86367 protein F26F24.20 [imported] - Arabidopsis
            thaliana>gb:AE005172_891286 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC005292_1532429 Genomic sequence for
            Arabidopsis thaliana BAC F26F24 from chromosome I,
            complete sequence.
          Length = 471

 Score =  348 bits (894), Expect = 9e-95
 Identities = 164/215 (76%), Positives = 190/215 (88%), Gaps = 3/215 (1%)
 Frame = -2

Query: 1170 DIPWLKAYYNFGFDHFNISWKKSGIWGLVDCLMGNAGPFAS-GDWILPDLTIQGAIKVNS 994
            DIPWLK+YYNFGFDHFN+S KK+G+ GLVD L+GNAGPFA+ GDWILPDL+IQG++ +N+
Sbjct: 246  DIPWLKSYYNFGFDHFNMSRKKTGVRGLVDLLLGNAGPFAACGDWILPDLSIQGSMTLNA 305

Query: 993  HLRTFPNTYYFSYATKRTRKIMGV-TVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG 817
             L+TFPNT+YFSYATKRT K +G+ TVPSG++GIHPLLFIRVLQMS W+ P D+  PYKG
Sbjct: 306  SLQTFPNTFYFSYATKRTTKPLGMMTVPSGVMGIHPLLFIRVLQMSQWQFPRDIPLPYKG 365

Query: 816  YRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIVEGDHILFII 637
            YRDEDW +NDGALNTISMTHPR+PVEH S  +  DSDC PLQPGIWYYKIVE DHI+FII
Sbjct: 366  YRDEDWQDNDGALNTISMTHPRIPVEHSSLILRSDSDCLPLQPGIWYYKIVEADHIMFII 425

Query: 636  NRERAGVQFDLIYDGIFERCRKHVFRKLP-TLPDK 535
            NRERAGV+FDLIYD IFERCRKHVFRK P TLP++
Sbjct: 426  NRERAGVEFDLIYDSIFERCRKHVFRKAPQTLPNE 460



>gb:AC009398_1536763 Genomic sequence for Arabidopsis thaliana BAC
            F20B24 from chromosome I, complete sequence.
          Length = 404

 Score =  286 bits (733), Expect = 4e-76
 Identities = 137/213 (64%), Positives = 157/213 (73%), Gaps = 1/213 (0%)
 Frame = -2

Query: 1170 DIPWLKAYYNFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSH 991
            DI WLK YYNFGFDHFNISWKK+G+ GLVDCLMGNAGPFASGDWILPDLTIQG+  +NS+
Sbjct: 218  DISWLKTYYNFGFDHFNISWKKTGVRGLVDCLMGNAGPFASGDWILPDLTIQGSTSINSN 277

Query: 990  LRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKGYR 811
            L+TFPNTYYFSYATKRTR++MG+T+PSG+LGIHP+LF+RV QMS W+ P DVSPPYKGYR
Sbjct: 278  LQTFPNTYYFSYATKRTRRVMGMTIPSGVLGIHPMLFLRVFQMSQWKFPQDVSPPYKGYR 337

Query: 810  DEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIVEGDHILFIINR 631
                                                        YYKIVE DHI+FI+NR
Sbjct: 338  --------------------------------------------YYKIVEADHIMFIVNR 353

Query: 630  ERAGVQFDLIYDGIFERCRKHVFRKLP-TLPDK 535
            ERAGVQFDLIYD IF+RCRKHVFRK+P TLP++
Sbjct: 354  ERAGVQFDLIYDSIFQRCRKHVFRKIPQTLPNQ 386



>gb:AF134840_482070 Bacillus thermoleovorans lipase (ARA) gene,
            complete cds.>gb:AY149997_592516 Geobacillus
            thermoleovorans IHI-91 thermophilic lipase gene, complete
            cds.
          Length = 416

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 43/131 (32%), Positives = 65/131 (49%), Gaps = 3/131 (2%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA K+N  ++  PNTYY S+
Sbjct: 249  FDHYFERLKRSPVW-------------TSTDTARYDLSVSGAEKLNQWVQASPNTYYLSF 295

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQ-MSLWRHPTDVSPPYKGYRDEDWWENDG 784
            AT+RT +  + G   P   LG++    +     +  +R+PT       G  D+ W ENDG
Sbjct: 296  ATERTYRGALTGNYYPE--LGMNAFSAVVCAPFLGSYRNPT------LGI-DDRWLENDG 346

Query: 783  ALNTISMTHPR 751
             +NT+SM  P+
Sbjct: 347  IVNTVSMNGPK 357



>gb:BTTGL_757208 B.thermocatenulatus triacylglycerol lipase gene.
          Length = 417

 Score = 57.4 bits (137), Expect = 6e-07
 Identities = 44/137 (32%), Positives = 64/137 (46%), Gaps = 9/137 (6%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL+I GA K+N  ++  PNTYY S+
Sbjct: 250  FDHYFERLKRSPVW-------------TSTDTARYDLSIPGAEKLNQWVQASPNTYYLSF 296

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YR------DED 802
            +T+RT +  + G   P   LG++    +             V  P+ G YR      D+ 
Sbjct: 297  STERTHRGALTGNYYPE--LGMNAFSAV-------------VCAPFLGSYRNEALGIDDR 341

Query: 801  WWENDGALNTISMTHPR 751
            W ENDG +NT+SM  P+
Sbjct: 342  WLENDGIVNTVSMNGPK 358



>gb:AY855077_647689 Bacillus sp. L2 thermostable lipase gene, complete
            cds.
          Length = 416

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 42/131 (32%), Positives = 65/131 (49%), Gaps = 3/131 (2%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA K+N  ++  PNTYY S+
Sbjct: 249  FDHYFERLKRSPVW-------------TSTDTARYDLSVSGAEKLNQWVQASPNTYYLSF 295

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQ-MSLWRHPTDVSPPYKGYRDEDWWENDG 784
            +T+RT +  + G   P   LG++    +     +  +R+PT       G  D+ W ENDG
Sbjct: 296  STERTYRGALTGNHYPE--LGMNAFSAVVCAPFLGSYRNPT------LGI-DDRWLENDG 346

Query: 783  ALNTISMTHPR 751
             +NT+SM  P+
Sbjct: 347  IVNTVSMNGPK 357



>gb:AY787835_646173 Bacillus sp. 42 thermostable organic solvent
            tolerant lipase gene, complete cds.
          Length = 416

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 42/131 (32%), Positives = 65/131 (49%), Gaps = 3/131 (2%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA K+N  ++  PNTYY S+
Sbjct: 249  FDHYFERLKRSPVW-------------TSTDTARYDLSVSGAEKLNQWVQASPNTYYLSF 295

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQ-MSLWRHPTDVSPPYKGYRDEDWWENDG 784
            +T+RT +  + G   P   LG++    +     +  +R+PT       G  D+ W ENDG
Sbjct: 296  STERTYRGALTGNHYPE--LGMNAFSAVVCAPFLGSYRNPT------LGI-DDRWLENDG 346

Query: 783  ALNTISMTHPR 751
             +NT+SM  P+
Sbjct: 347  IVNTVSMNGPK 357



>gb:AF237623_491485 Bacillus stearothermophilus lipase gene, complete
            cds.
          Length = 417

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 43/131 (32%), Positives = 64/131 (48%), Gaps = 3/131 (2%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA K+N  ++  PNTYY S+
Sbjct: 250  FDHYFERLKRSPVW-------------TSTDTARYDLSVSGAEKLNQWVQASPNTYYLSF 296

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQ-MSLWRHPTDVSPPYKGYRDEDWWENDG 784
            +T+RT +  + G   P   LG++    +     +  +R+PT       G  D  W ENDG
Sbjct: 297  STERTYRGALTGNHYPE--LGMNAFSAVVCAPFLGSYRNPT------LGI-DSHWLENDG 347

Query: 783  ALNTISMTHPR 751
             +NTISM  P+
Sbjct: 348  IVNTISMNGPK 358



>pir|JC8061|JC8061 triacylglycerol lipase (EC 3.1.1.3) - Geobacillus
            sp.  (Strain T1)>gb:AY260764_603617 Geobacillus sp. T1
            thermostable lipase gene, complete cds.
          Length = 416

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 42/131 (32%), Positives = 65/131 (49%), Gaps = 3/131 (2%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA K+N  ++  PNTYY S+
Sbjct: 249  FDHYFERLKRSPVW-------------TSTDTARYDLSVSGAEKLNQWVQASPNTYYLSF 295

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQ-MSLWRHPTDVSPPYKGYRDEDWWENDG 784
            +T+RT +  + G   P   LG++    +     +  +R+PT       G  D+ W ENDG
Sbjct: 296  STERTYRGALTGNHYPE--LGMNAFSAVVCAPFLGSYRNPT------LGI-DDRWLENDG 346

Query: 783  ALNTISMTHPR 751
             +NT+SM  P+
Sbjct: 347  IVNTVSMNGPK 357



>gb:BA000043_738563 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 418

 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 44/137 (32%), Positives = 63/137 (45%), Gaps = 9/137 (6%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA K+N  ++  PNTYY S+
Sbjct: 251  FDHYFERLKRSPVW-------------TSTDTARYDLSVPGAEKLNQWVKASPNTYYLSF 297

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YR------DED 802
            AT+RT +  + G   P   LG++    +             V  P+ G YR      D+ 
Sbjct: 298  ATERTYRGALTGNYYPE--LGMNAFSAV-------------VCAPFLGSYRNATLGIDDR 342

Query: 801  WWENDGALNTISMTHPR 751
            W ENDG +NT SM  P+
Sbjct: 343  WLENDGIVNTFSMNGPK 359



>gb:AF429311_510015 Bacillus stearothermophilus lipase gene, complete
            cds.
          Length = 418

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 42/149 (28%), Positives = 69/149 (46%), Gaps = 9/149 (6%)
 Frame = -2

Query: 1170 DIPWLKAYYNFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSH 991
            ++P+    Y+F  D + +  +    +      +  +  + S D    DL++ GA K+N  
Sbjct: 226  NVPYTSQVYDFKLDQWGLRRQPGESFDQYFERLKRSPVWTSTDTARYDLSVPGAEKLNQW 285

Query: 990  LRTFPNTYYFSYATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG 817
            ++  PNTYY S+AT+RT +  + G   P   LG++    +             V  P+ G
Sbjct: 286  VKASPNTYYLSFATERTYRGALTGNYYPE--LGMNAFSAV-------------VCAPFLG 330

Query: 816  -YR------DEDWWENDGALNTISMTHPR 751
             YR      D+ W ENDG +NT SM  P+
Sbjct: 331  SYRNATLGIDDRWLENDGIVNTFSMNGPK 359



>gb:AY095262_588579 Bacillus sp. Tosh lipase (lipA) gene, complete
            cds.
          Length = 417

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 44/137 (32%), Positives = 63/137 (45%), Gaps = 9/137 (6%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA  +N  ++  PNTYY S+
Sbjct: 250  FDHYFERLKRSPVW-------------TSTDTARYDLSVPGAETLNRWVKASPNTYYLSF 296

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YR------DED 802
            +T+RT +  + G   P   LG++    I             V  P+ G YR      D  
Sbjct: 297  STERTYRGALTGNYYPE--LGMNAFSAI-------------VCAPFLGSYRNAALGIDSH 341

Query: 801  WWENDGALNTISMTHPR 751
            W ENDG +NTISM+ P+
Sbjct: 342  WLENDGIVNTISMSGPK 358



>gb:AY095260_588578 Geobacillus thermoleovorans thermostable lipase
            (lipA) gene, complete cds.
          Length = 416

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 44/137 (32%), Positives = 62/137 (45%), Gaps = 9/137 (6%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA  +N  ++  PNTYY S+
Sbjct: 249  FDHYFERLKRSPVW-------------TSTDTARYDLSVPGAETLNRWVKASPNTYYLSF 295

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YR------DED 802
            +T+RT +  + G   P   LG++    I             V  P+ G YR      D  
Sbjct: 296  STERTYRGALTGNYYPE--LGMNAFSAI-------------VCAPFLGSYRNAALGIDSH 340

Query: 801  WWENDGALNTISMTHPR 751
            W ENDG +NTISM  P+
Sbjct: 341  WLENDGIVNTISMNGPK 357



>gb:AF141874_482683 Bacillus sp. TP10A.1 triacylglycerol lipase (lip1)
            gene, complete cds.
          Length = 418

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 42/149 (28%), Positives = 68/149 (45%), Gaps = 9/149 (6%)
 Frame = -2

Query: 1170 DIPWLKAYYNFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSH 991
            ++P+    Y+F  D + +  +    +      +  +  + S D    DL++ GA  +N  
Sbjct: 226  NVPYTSQVYDFKLDQWGLRRQPGESFDQYFERLKQSPVWTSADTARYDLSVPGAEALNQW 285

Query: 990  LRTFPNTYYFSYATKRTRKIMGVTVPSGIL--GIHPLLFIRVLQMSLWRHPTDVSPPYKG 817
            ++  PNTYY S+AT+RT +        G L    +P L + V   +       V  P+ G
Sbjct: 286  VQASPNTYYLSFATERTYR--------GALTGNYYPELGMNVFSAA-------VCAPFLG 330

Query: 816  -YR------DEDWWENDGALNTISMTHPR 751
             YR      D+ W ENDG +NT SM  P+
Sbjct: 331  SYRNAALGIDDRWLENDGIVNTFSMNGPK 359



>pir|JW0068|JW0068 triacylglycerol lipase (EC 3.1.1.3), thermostable -
            Bacillus stearothermophilus>gb:BSU78785_751868 Bacillus
            stearothermophilus lipase gene, complete cds.
          Length = 417

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 43/137 (31%), Positives = 61/137 (44%), Gaps = 9/137 (6%)
 Frame = -2

Query: 1134 FDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSY 955
            FDH+    K+S +W              S D    DL++ GA  +N  ++  PNTYY S+
Sbjct: 250  FDHYFERLKRSPVW-------------TSTDTARYDLSVPGAETLNRWVKASPNTYYLSF 296

Query: 954  ATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YR------DED 802
            +T+RT +  + G   P   LG++    I             V  P+ G YR      D  
Sbjct: 297  STERTYRGALTGNYYPE--LGMNAFSAI-------------VCAPFLGSYRNAALGIDSH 341

Query: 801  WWENDGALNTISMTHPR 751
            W  NDG +NTISM  P+
Sbjct: 342  WLGNDGIVNTISMNGPK 358



>gb:AE015939_320101 Clostridium tetani E88, section 4 of 10 of the
            complete genome.>gb:AE015927_962890 Clostridium tetani
            E88, complete genome.
          Length = 457

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 28/96 (29%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSL 856
            DL+ +GA ++N  ++  P+ YYFS+ T+ T++  + G ++ + I  ++PLL++    M  
Sbjct: 312  DLSTKGAEELNKWVKAQPDVYYFSWTTQATKESALTGHSI-AQIGPMNPLLYVPANLMGK 370

Query: 855  WRHPTDVSPPYKGYRDEDWWENDGALNTISMTHPRL 748
            +      + P     +++W+ NDG +N IS   P+L
Sbjct: 371  YSR----NEPNLPIINKEWFPNDGVVNCISQNGPKL 402



>gb:CP000001_852962 Bacillus cereus ZK, complete genome.
          Length = 413

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYA--TKRTRKIMGVTVPSGILGIHPLLFIRVLQMSL 856
            DL+  GA ++N+ ++T PN YY SY+    +   I G+ +P   + ++ +L      +  
Sbjct: 265  DLSTDGAKELNNWVKTQPNVYYLSYSGHASQAAPITGLHLPH--ITMNKVLMGNTFFLGS 322

Query: 855  WRHPTDVSPPYKGYRDEDWWENDGALNTISMTHP 754
            +    +  P      D  WW+NDG +NT SM  P
Sbjct: 323  YARYEENRPLI----DTTWWQNDGVVNTSSMIAP 352



>gb:AE017355_463689 Bacillus thuringiensis serovar konkukian str.
            97-27, complete genome.
          Length = 413

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYA--TKRTRKIMGVTVPSGILGIHPLLFIRVLQMSL 856
            DL+  GA ++N+ ++T PN YY SY+    +   I G+ +P   + ++ +L      +  
Sbjct: 265  DLSTDGAKELNNWVKTQPNVYYLSYSGHASQAAPITGLHLPH--ITMNKVLMGNAFFLGS 322

Query: 855  WRHPTDVSPPYKGYRDEDWWENDGALNTISMTHP 754
            +    +  P      D  WW+NDG +NT SM  P
Sbjct: 323  YARYEENRPLI----DTTWWQNDGVVNTSSMIAP 352



>gb:AE017272_423838 Bacillus cereus ATCC 10987, section 9 of 18 of the
            complete genome.>gb:AE017194_1062257 Bacillus cereus ATCC
            10987, complete genome.
          Length = 413

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 2/94 (2%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYA--TKRTRKIMGVTVPSGILGIHPLLFIRVLQMSL 856
            DL+  GA ++N+ ++T PN YY SY+    +   I G+ +P   + ++ +L      +  
Sbjct: 265  DLSTDGAKELNNWVKTQPNVYYLSYSGHASQAAPITGLHLPH--ITMNKVLMGNAFFLGS 322

Query: 855  WRHPTDVSPPYKGYRDEDWWENDGALNTISMTHP 754
            +    +  P      D  WW+NDG +NT SM  P
Sbjct: 323  YARYEENRPLI----DTTWWQNDGVVNTSSMIAP 352



>gb:BX571856_779785 Staphylococcus aureus subsp. aureus strain
            MRSA252, complete genome.
          Length = 691

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 49/164 (29%), Positives = 72/164 (43%), Gaps = 8/164 (4%)
 Frame = -2

Query: 1056 FASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGI-HPLLF 880
            + S D    DLT+ G+ K+N+     PN  Y +Y         GV+  +G LG  +P L 
Sbjct: 529  WTSDDNAAYDLTLNGSAKLNNMTSMNPNITYTTYT--------GVSSHTGPLGYENPDLG 580

Query: 879  IRVLQMSLWRHPTDVSPPYKGY-RDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDC 703
               L         D +    G+   E+W +NDG +  IS  HP      P  +V  D   
Sbjct: 581  TFFLM--------DTTSRIIGHDAREEWRKNDGVVPVISSLHPS---NQPFVNVTNDEPA 629

Query: 702  QPLQPGIWYYK-IVEG-DHILFI----INRERAGVQFDLIYDGI 589
               + GIW  K I++G DH+ FI    ++ +R G +    Y GI
Sbjct: 630  --TRRGIWQVKPIIQGWDHVDFIGVDFLDFKRKGAELANFYTGI 671



>gb:SSI308427_190613 Staphylococcus simulans partial lipad-1 gene for
            lipase.>gb:SSI310391_190614 Staphylococcus simulans
            partial lipad-1 gene for lipase.
          Length = 395

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 49/164 (29%), Positives = 72/164 (43%), Gaps = 8/164 (4%)
 Frame = -2

Query: 1056 FASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGI-HPLLF 880
            + S D    DLT+ G+ K+N+     PN  Y +Y         GV+  +G LG  +P L 
Sbjct: 233  WTSDDNAAYDLTLDGSAKLNNMTSMNPNITYTTYT--------GVSSHTGPLGYENPDLG 284

Query: 879  IRVLQMSLWRHPTDVSPPYKGY-RDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDC 703
               L         D +    G+   E+W +NDG +  IS  HP      P  +V  D   
Sbjct: 285  TFFLM--------DTTSRIIGHDAREEWRKNDGVVPVISSLHPS---NQPFVNVTNDEPA 333

Query: 702  QPLQPGIWYYK-IVEG-DHILFI----INRERAGVQFDLIYDGI 589
               + GIW  K I++G DH+ FI    ++ +R G +    Y GI
Sbjct: 334  --TRRGIWQVKPIIQGWDHVDFIGVDFLDFKRKGAELANFYTGI 375



>sp|Q8NYC2|LIP_STAAW Lipase precursor (EC 3.1.1.3) (Glycerol ester
            hydrolase).>gb:BA000033_710589 Staphylococcus aureus
            subsp. aureus MW2 DNA, complete genome,
            strain:MW2.>gb:BX571857_782512 Staphylococcus aureus
            strain MSSA476, complete genome.
          Length = 690

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 49/164 (29%), Positives = 72/164 (43%), Gaps = 8/164 (4%)
 Frame = -2

Query: 1056 FASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGI-HPLLF 880
            + S D    DLT+ G+ K+N+     PN  Y +Y         GV+  +G LG  +P L 
Sbjct: 528  WTSDDNAAYDLTLDGSAKLNNMTSMNPNITYTTYT--------GVSSHTGPLGYENPDLG 579

Query: 879  IRVLQMSLWRHPTDVSPPYKGY-RDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDC 703
               L         D +    G+   E+W +NDG +  IS  HP      P  +V  D   
Sbjct: 580  TFFLM--------DTTSRIIGHDAREEWRKNDGVVPVISSLHPS---NQPFVNVTNDEPA 628

Query: 702  QPLQPGIWYYK-IVEG-DHILFI----INRERAGVQFDLIYDGI 589
               + GIW  K I++G DH+ FI    ++ +R G +    Y GI
Sbjct: 629  --TRRGIWQVKPIIQGWDHVDFIGVDFLDFKRKGAELANFYTGI 670



>sp|P10335|LIP_STAAU Lipase precursor (EC 3.1.1.3) (Glycerol ester
            hydrolase).>pir|A24545|A24545 triacylglycerol lipase (EC
            3.1.1.3) - Staphylococcus aureus>gb:STAGEH_192127
            S.aureus geh gene encoding lipase (glycerol ester
            hydrolase).
          Length = 690

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 46/166 (27%), Positives = 68/166 (40%), Gaps = 10/166 (6%)
 Frame = -2

Query: 1056 FASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHP---- 889
            + S D    DLT+ G+ K+N+     PN  Y +Y         GV+  +G LG       
Sbjct: 528  WTSDDNAAYDLTLDGSAKLNNMTSMNPNITYTTYT--------GVSSHTGPLGYENPDLG 579

Query: 888  LLFIRVLQMSLWRHPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDS 709
              F+      +  H             E+W +NDG +  IS  HP      P  +V  D 
Sbjct: 580  TFFLMATTSRIIGHDAR----------EEWRKNDGVVPVISSLHPS---NQPFVNVTNDE 626

Query: 708  DCQPLQPGIWYYK-IVEG-DHILFI----INRERAGVQFDLIYDGI 589
                 + GIW  K I++G DH+ FI    ++ +R G +    Y GI
Sbjct: 627  PA--TRRGIWQVKPIIQGWDHVDFIGVDFLDFKRKGAELANFYTGI 670



>gb:AF208229_488476 Staphylococcus xylosus lipase precursor GehM
            (gehM) gene, complete cds.
          Length = 739

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 41/171 (23%), Positives = 76/171 (44%), Gaps = 3/171 (1%)
 Frame = -2

Query: 1143 NFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYY 964
            +FGF  + +  ++   +      + N+G + + D    DLT +GA K+N +    PN  Y
Sbjct: 559  DFGFGQWGLKQREGETYAQYVQRVQNSGLWKTEDNGFYDLTREGAAKLNKNTSLNPNIVY 618

Query: 963  FSYATKRTRKIMGVTVPSGILGIHPLLF-IRVLQMSLWRHPTDVSPPYKGYRDEDWWEND 787
             +Y  + TR               P LF  +   ++L+   T          +++W END
Sbjct: 619  KTYTGESTR---------------PTLFGNQKSDVNLFLPFTVTGNVIGKAAEKEWREND 663

Query: 786  GALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIVE--GDHILFI 640
            G ++TIS  HP       +Q  ++ +D   ++ G+W    ++   DH+ F+
Sbjct: 664  GLVSTISSQHPF------NQAFIEATD--EVKKGVWQVTPIKHGWDHVDFV 706



>pir|B89797|B89797 glycerol ester hydrolase [imported] -
            Staphylococcus aureus  (strain N315)>gb:AY028918_585346
            Staphylococcus aureus lipase gene, complete
            cds.>gb:BA000017_676018 Staphylococcus aureus subsp.
            aureus Mu50 DNA, complete genome.>gb:BA000018_678715
            Staphylococcus aureus subsp. aureus N315 genomic DNA,
            complete genome.
          Length = 691

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 49/164 (29%), Positives = 72/164 (43%), Gaps = 8/164 (4%)
 Frame = -2

Query: 1056 FASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGI-HPLLF 880
            + S D    DLT+ G+ K+N+     PN  Y +Y         GV+  +G LG  +P L 
Sbjct: 529  WTSDDNAAYDLTLDGSAKLNNMTSMNPNITYTTYT--------GVSSHTGPLGYENPDLG 580

Query: 879  IRVLQMSLWRHPTDVSPPYKGY-RDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDC 703
               L         D +    G+   E+W +NDG +  IS  HP      P  +V  D   
Sbjct: 581  TFFLM--------DTTSRIIGHDAREEWRKNDGVVPVISSLHPS---NQPFINVTNDEPA 629

Query: 702  QPLQPGIWYYK-IVEG-DHILFI----INRERAGVQFDLIYDGI 589
               + GIW  K I++G DH+ FI    ++ +R G +    Y GI
Sbjct: 630  --TRRGIWQVKPIIQGWDHVDFIGVDFLDFKRKGAELANFYTGI 671



>pir|C75533|C75533 probable lipase - Deinococcus radiodurans (strain
            R1)>gb:AE001893_40613 Deinococcus radiodurans R1 section
            30 of 229 of the complete chromosome
            1.>gb:AE000513_881508 Deinococcus radiodurans R1 complete
            chromosome 1.
          Length = 486

 Score = 42.4 bits (98), Expect = 0.018
 Identities = 38/130 (29%), Positives = 55/130 (42%), Gaps = 12/130 (9%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRK--IMGVTVPSGILGIHPLLFIRVLQMSL 856
            DL+  G+ ++N  +    +T Y S+AT  T K  + G   P       P++F  +  ++ 
Sbjct: 334  DLSSDGSAELNQFIGRSTHTIYASWATSATSKGLVTGWAYPM------PVMFAPLSALA- 386

Query: 855  WRHP----------TDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSD 706
            W +P          T  SP  K   D  WWENDG +   S   P        Q  V  + 
Sbjct: 387  WPYPWPMRQTIGNMTGSSPLGKVQYDASWWENDGLVPVKSQGAPL------GQSEVAYAG 440

Query: 705  CQPLQPGIWY 676
              P+QPG WY
Sbjct: 441  -GPVQPGQWY 449



>gb:AE017032_382697 Bacillus anthracis str. Ames section 9 of 18 of
            the complete genome.>gb:AE017225_407819 Bacillus
            anthracis str. Sterne, complete
            genome.>gb:AE017334_452545 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE016879_1012402 Bacillus
            anthracis str. Ames complete genome.
          Length = 400

 Score = 42.0 bits (97), Expect = 0.024
 Identities = 27/94 (28%), Positives = 46/94 (48%), Gaps = 2/94 (2%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYA--TKRTRKIMGVTVPSGILGIHPLLFIRVLQMSL 856
            DL+  GA ++N+ ++T  N YY SY+    +   I G+ +P   + ++ +L      +  
Sbjct: 252  DLSTDGAKELNNWVKTQLNVYYLSYSGHASQAAPITGLHLPH--ITMNKVLMGNAFFLGS 309

Query: 855  WRHPTDVSPPYKGYRDEDWWENDGALNTISMTHP 754
            +    +  P      D  WW+NDG +NT SM  P
Sbjct: 310  YARYEENRPLI----DTTWWQNDGVVNTSSMIAP 339



>gb:BC084827_2564072 Xenopus laevis hypothetical LOC495363, mRNA (cDNA
            clone MGC:85322 IMAGE:6875813), complete cds.
          Length = 510

 Score = 40.4 bits (93), Expect = 0.070
 Identities = 19/58 (32%), Positives = 31/58 (53%)
 Frame = -2

Query: 1002 VNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSP 829
            +N  +R FP+        K+T +I GVT+P+G++ + P LF+  L   +W  P    P
Sbjct: 367  INETMRLFPSAIRIDRVCKKTMEINGVTIPAGVVIVVP-LFVLHLNPEVWPEPEKFQP 423



>gb:AF208033_488462 Staphylococcus warneri lipase precursor (gehA)
            gene, complete cds.
          Length = 732

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 36/125 (28%), Positives = 54/125 (43%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWR 850
            DLT +GA ++N+H    PN  Y +Y         G +      GIH     R   M++  
Sbjct: 590  DLTTEGAQELNNHTSLNPNIVYKTYT--------GESSDPDKKGIHH----RNSHMNIKY 637

Query: 849  HPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYK 670
             PT  +       D+ W ENDG ++ +S        +HPS     D+  Q +Q G+W   
Sbjct: 638  LPT--TNVIGKLDDQAWRENDGLVSVVS-------AQHPSNQKYVDATDQ-IQKGVWQVT 687

Query: 669  IVEGD 655
             V+ D
Sbjct: 688  PVQHD 692



>gb:CP000029_82875 Staphylococcus epidermidis RP62A, complete
            genome.>gb:AF053006_473607 Staphylococcus epidermidis
            lipase precursor (geh1) gene, complete cds.
          Length = 688

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 43/171 (25%), Positives = 72/171 (42%), Gaps = 3/171 (1%)
 Frame = -2

Query: 1143 NFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYY 964
            +FG +H+ +  K +  +      + N+  + S D  L DLT  GA  +N      PN  Y
Sbjct: 505  DFGLEHWGLKQKPNESYIQYVKRVQNSKLWKSKDSGLHDLTRDGATDLNRKTSLNPNIVY 564

Query: 963  FSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YRDEDWWEND 787
             +Y  + T K +     +             L M L   P  ++    G  ++++W END
Sbjct: 565  KTYTGESTHKTLAGKQKAD------------LNMFL---PFTITGNLIGKAKEKEWREND 609

Query: 786  GALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIV--EGDHILFI 640
            G ++ IS  HP       +Q  V+ +D    Q G+W       + DH+ F+
Sbjct: 610  GLVSVISSQHPF------NQKYVEATDKN--QKGVWQVTPTKHDWDHVDFV 652



>pir|A47705|A47705 triacylglycerol lipase (EC 3.1.1.3) -
            Staphylococcus epidermidis>gb:STAGEHC_192128
            Staphylococcus epidermidis lipase (gehC) gene, complete
            cds.
          Length = 688

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 43/171 (25%), Positives = 72/171 (42%), Gaps = 3/171 (1%)
 Frame = -2

Query: 1143 NFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYY 964
            +FG +H+ +  K +  +      + N+  + S D  L DLT  GA  +N      PN  Y
Sbjct: 505  DFGLEHWGLKQKPNESYIQYVKRVQNSKLWKSKDSGLHDLTRDGATDLNRKTSLNPNIVY 564

Query: 963  FSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YRDEDWWEND 787
             +Y  + T K +     +             L M L   P  ++    G  ++++W END
Sbjct: 565  KTYTGESTHKTLAGKQKAD------------LNMFL---PFTITGNLIGKAKEKEWREND 609

Query: 786  GALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIV--EGDHILFI 640
            G ++ IS  HP       +Q  V+ +D    Q G+W       + DH+ F+
Sbjct: 610  GLVSVISSQHPF------NQKYVEATDKN--QKGVWQVTPTKHDWDHVDFV 652



>sp|Q02510|LIP_STAEP Lipase precursor (EC 3.1.1.3) (Glycerol ester
            hydrolase).>gb:AE016744_321931 Staphylococcus epidermidis
            ATCC 12228, section 1 of 9 of the complete
            genome.>gb:AE015929_1146600 Staphylococcus epidermidis
            ATCC 12228, complete genome.
          Length = 688

 Score = 39.7 bits (91), Expect = 0.12
 Identities = 43/171 (25%), Positives = 72/171 (42%), Gaps = 3/171 (1%)
 Frame = -2

Query: 1143 NFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYY 964
            +FG +H+ +  K +  +      + N+  + S D  L DLT  GA  +N      PN  Y
Sbjct: 505  DFGLEHWGLKQKPNESYIQYVKRVQNSKLWKSKDSGLHDLTRDGATDLNRKTSLNPNIVY 564

Query: 963  FSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKG-YRDEDWWEND 787
             +Y  + T K +     +             L M L   P  ++    G  ++++W END
Sbjct: 565  KTYTGESTHKTLAGKQKAD------------LNMFL---PFTITGNLIGKAKEKEWREND 609

Query: 786  GALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYKIV--EGDHILFI 640
            G ++ IS  HP       +Q  V+ +D    Q G+W       + DH+ F+
Sbjct: 610  GLVSVISSQHPF------NQKYVEATDKN--QKGVWQVTPTKHDWDHVDFV 652



>sp|P04635|LIP_STAHY Lipase precursor (EC 3.1.1.3) (Triacylglycerol
            lipase).>pir|A24075|A24075 lipase precursor -
            Staphylococcus hyicus>gb:SHLIP_183448 Staphylococcus
            hyicus ssp. hyicus lip gene for lipase.
          Length = 641

 Score = 39.3 bits (90), Expect = 0.16
 Identities = 40/131 (30%), Positives = 53/131 (40%), Gaps = 1/131 (0%)
 Frame = -2

Query: 1143 NFGFDHFNISWKKSGIWGLVDCLMGNAGPFASGDWILPDLTIQGAIKVNSHLRTFPNTYY 964
            +FG DH+    K        +  +  +  + S D  L DLT +GA K+N      PN YY
Sbjct: 455  DFGMDHWGFKRKDGESLTDYNKRIAESKIWDSEDTGLYDLTREGAEKINQKTELNPNIYY 514

Query: 963  FSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWRHPTDVSPPYKGYRDEDWWE-ND 787
             +Y         GV      LG H    I  L M   +  T     Y G  D+  W  ND
Sbjct: 515  KTYT--------GVATHETQLGKH----IADLGMEFTKILTG---NYIGSVDDILWRPND 559

Query: 786  GALNTISMTHP 754
            G ++ IS  HP
Sbjct: 560  GLVSEISSQHP 570



>gb:BA000033_712882 Staphylococcus aureus subsp. aureus MW2 DNA,
            complete genome, strain:MW2.>gb:BX571857_784793
            Staphylococcus aureus strain MSSA476, complete genome.
          Length = 681

 Score = 37.7 bits (86), Expect = 0.45
 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 2/132 (1%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWR 850
            DLT +GA  +N      PN  Y +Y  + T K +        L    + F  V+  +L  
Sbjct: 534  DLTREGATDLNRKTSLNPNIVYKTYTGEATHKALNSDRQKADLN---MFFPFVITGNLIG 590

Query: 849  HPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYK 670
              T+          ++W ENDG ++ IS  HP       +Q   K +D   +Q GIW   
Sbjct: 591  KATE----------KEWRENDGLVSVISSQHPF------NQAYTKATD--KIQKGIWQVT 632

Query: 669  IV--EGDHILFI 640
                + DH+ F+
Sbjct: 633  PTKHDWDHVDFV 644



>gb:CP000046_92759 Staphylococcus aureus subsp. aureus COL, complete
            genome.
          Length = 680

 Score = 37.7 bits (86), Expect = 0.45
 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 2/132 (1%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWR 850
            DLT +GA  +N      PN  Y +Y  + T K +        L    + F  V+  +L  
Sbjct: 533  DLTREGATDLNRKTSLNPNIVYKTYTGEATHKALNSDRQKADLN---MFFPFVITGNLIG 589

Query: 849  HPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYK 670
              T+          ++W ENDG ++ IS  HP       +Q   K +D   +Q GIW   
Sbjct: 590  KATE----------KEWRENDGLVSVISSQHPF------NQAYTKATD--KIQKGIWQVT 631

Query: 669  IV--EGDHILFI 640
                + DH+ F+
Sbjct: 632  PTKHDWDHVDFV 643



>pir|S68970|S68970 triacylglycerol lipase (EC 3.1.1.3) precursor -
            Staphylococcus aureus>gb:STAGEHLIP_192129 Staphylococcus
            aureus glycerol ester hydrolase (lip) gene, complete cds.
          Length = 682

 Score = 37.7 bits (86), Expect = 0.45
 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 2/132 (1%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWR 850
            DLT +GA  +N      PN  Y +Y  + T K +        L    + F  V+  +L  
Sbjct: 535  DLTREGATDLNRKTSLNPNIVYKTYTGEATHKALNSDRQKADLN---MFFPFVITGNLIG 591

Query: 849  HPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYK 670
              T+          ++W ENDG ++ IS  HP       +Q   K +D   +Q GIW   
Sbjct: 592  KATE----------KEWRENDGLVSVISSQHPF------NQAYTKATD--KIQKGIWQVT 633

Query: 669  IV--EGDHILFI 640
                + DH+ F+
Sbjct: 634  PTKHDWDHVDFV 645



>gb:CP000046_90488 Staphylococcus aureus subsp. aureus COL, complete
            genome.
          Length = 644

 Score = 36.6 bits (83), Expect = 1.0
 Identities = 37/138 (26%), Positives = 54/138 (39%), Gaps = 5/138 (3%)
 Frame = -2

Query: 1056 FASGDWILPDLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHP---- 889
            + S D    DLT+ G+ K+N+     PN  Y +Y         GV+  +G LG       
Sbjct: 528  WTSDDNAAYDLTLDGSAKLNNMTSMNPNITYTTYT--------GVSSHTGPLGYENPDLG 579

Query: 888  LLFIRVLQMSLWRHPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDS 709
              F+      +  H             E+W +NDG +  IS  HP      P  +V  D 
Sbjct: 580  TFFLMATTSRIIGHDAR----------EEWRKNDGVVPVISSLHPS---NQPFVNVTNDE 626

Query: 708  DCQPLQPGIWYYK-IVEG 658
                 + GIW  K I++G
Sbjct: 627  PA--TRRGIWQVKPIIQG 642



>gb:BX571856_782172 Staphylococcus aureus subsp. aureus strain
            MRSA252, complete genome.
          Length = 681

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 2/132 (1%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWR 850
            DLT +GA  +N      PN  Y +Y  + T K +        L    + F  V+  +L  
Sbjct: 534  DLTREGATDLNRKTSLNPNIVYKTYTGEATHKALNSDRQKADLN---MFFPFVITGNLIG 590

Query: 849  HPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYK 670
              T+          ++W ENDG ++ IS  HP       +Q     +D   +Q GIW   
Sbjct: 591  KATE----------KEWRENDGLVSVISSQHPF------NQAYTNATD--KIQKGIWQVT 632

Query: 669  IV--EGDHILFI 640
                + DH+ F+
Sbjct: 633  PTKHDWDHVDFV 644



>sp|Q99QX0|LIP_STAAM Lipase precursor (EC 3.1.1.3) (Glycerol ester
            hydrolase).>pir|G90075|G90075 triacylglycerol lipase
            precursor [imported] - Staphylococcus aureus (strain
            N315)>gb:BA000017_678356 Staphylococcus aureus subsp.
            aureus Mu50 DNA, complete genome.>gb:BA000018_680950
            Staphylococcus aureus subsp. aureus N315 genomic DNA,
            complete genome.
          Length = 681

 Score = 35.8 bits (81), Expect = 1.7
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 2/132 (1%)
 Frame = -2

Query: 1029 DLTIQGAIKVNSHLRTFPNTYYFSYATKRTRKIMGVTVPSGILGIHPLLFIRVLQMSLWR 850
            DLT +GA  +N      PN  Y +Y  + T K +        L    + F  V+  +L  
Sbjct: 534  DLTREGATDLNRKTSLNPNIVYKTYTGEATHKALNSDRQKADLN---MFFPFVITGNLIG 590

Query: 849  HPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPVEHPSQHVVKDSDCQPLQPGIWYYK 670
              T+          ++W ENDG ++ IS  HP       +Q     +D   +Q GIW   
Sbjct: 591  KATE----------KEWRENDGLVSVISSQHPF------NQAYTNATD--KIQKGIWQVT 632

Query: 669  IV--EGDHILFI 640
                + DH+ F+
Sbjct: 633  PTKHDWDHVDFV 644



>gb:AE017345_1757118 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 269

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 23/83 (27%), Positives = 38/83 (45%), Gaps = 7/83 (8%)
 Frame = -2

Query: 894 HPLLFIRVLQMS--LWRHPTDVSPPYKGYRDEDWWENDGALNTISMTHPRLPV-EHPSQH 724
           HP  F+   Q +  ++  P   + P    R+E WWE   A +      P+LPV  +P++ 
Sbjct: 71  HPSAFLTTRQAAPRIFPFPLGKTRPEAAVREELWWEGGNAPHVGHFNRPKLPVPPNPNED 130

Query: 723 V----VKDSDCQPLQPGIWYYKI 667
           V    V+ S  +  Q  +W  +I
Sbjct: 131 VLMKRVQASMAREAQERLWKRRI 153



>gb:CNS07EGG_1374035 chromosome X of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).
          Length = 1068

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = -2

Query: 696 LQPGIWYYKIVEGDHILFIINRERAGVQFDLIYDGIFERCRKHV 565
           L PG+W   I E +H + I+N  R  V+ DLI   I   C K+V
Sbjct: 380 LFPGLWRSLITEDNHAMLIMNMPRGAVKEDLI--DIMATCLKYV 421



>gb:AY058406_1291560 Drosophila melanogaster GH18129 full length
           cDNA.
          Length = 1007

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 4/70 (5%)
 Frame = +1

Query: 40  DPYNCSSHLQLPKTEPKRI*LI--F*LLVPSQPQES--TMDISLNNGFQTPN*PHSFNSV 207
           DP+  + HLQ P  EP  + LI  F  + P+  QES  T    L N  QTP+       V
Sbjct: 25  DPHKITQHLQRPHPEPSAMELIVQFISMTPNTAQESVGTPGSDLQNLNQTPSNSGPIPGV 84

Query: 208 AGNYSSNTIP 237
            G   + T P
Sbjct: 85  VGRAPAPTTP 94



>gb:AE013599_1132296 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003805_1225386 Drosophila melanogaster
           chromosome 2R, section 45 of 74 of the complete
           sequence.
          Length = 1007

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 4/70 (5%)
 Frame = +1

Query: 40  DPYNCSSHLQLPKTEPKRI*LI--F*LLVPSQPQES--TMDISLNNGFQTPN*PHSFNSV 207
           DP+  + HLQ P  EP  + LI  F  + P+  QES  T    L N  QTP+       V
Sbjct: 25  DPHKITQHLQRPHPEPSAMELIVQFISMTPNTAQESVGTPGSDLQNLNQTPSNSGPIPGV 84

Query: 208 AGNYSSNTIP 237
            G   + T P
Sbjct: 85  VGGAPAPTTP 94



>pir|T13693|T13693 hypothetical protein EG0003.5 - fruit fly
           (Drosophila melanogaster)>gb:DMCEG0003_1378538
           Drosophila melanogaster cosmid EG0003.
          Length = 1007

 Score = 33.5 bits (75), Expect = 8.5
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 4/70 (5%)
 Frame = +1

Query: 40  DPYNCSSHLQLPKTEPKRI*LI--F*LLVPSQPQES--TMDISLNNGFQTPN*PHSFNSV 207
           DP+  + HLQ P  EP  + LI  F  + P+  QES  T    L N  QTP+       V
Sbjct: 25  DPHKITQHLQRPHPEPSAMELIVQFISMTPNTAQESVGTPGSDLQNLNQTPSNSGPIPGV 84

Query: 208 AGNYSSNTIP 237
            G   + T P
Sbjct: 85  VGGAPAPTTP 94


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,387,863,498
Number of Sequences: 1806583
Number of extensions: 32776470
Number of successful extensions: 84615
Number of sequences better than 10.0: 46
Number of HSP's better than 10.0 without gapping: 81144
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 84568
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 93177879971
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)